BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018B12

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01995.1|  unnamed protein product                                285   2e-92   Coffea canephora [robusta coffee]
ref|XP_002282021.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    279   7e-90   Vitis vinifera
ref|XP_007046882.1|  Gamma carbonic anhydrase 1, CA1                    278   1e-89   Theobroma cacao [chocolate]
ref|XP_010029770.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    278   1e-89   Eucalyptus grandis [rose gum]
gb|KHG23300.1|  hypothetical protein F383_08437                         278   1e-89   Gossypium arboreum [tree cotton]
ref|XP_006346962.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    277   2e-89   Solanum tuberosum [potatoes]
ref|XP_009588225.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    277   3e-89   Nicotiana tomentosiformis
ref|XP_008452092.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    276   5e-89   Cucumis melo [Oriental melon]
gb|KJB17752.1|  hypothetical protein B456_003G013500                    276   5e-89   Gossypium raimondii
gb|KJB43469.1|  hypothetical protein B456_007G201900                    273   5e-89   Gossypium raimondii
ref|XP_010102071.1|  hypothetical protein L484_009014                   276   6e-89   Morus notabilis
ref|XP_010265678.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    276   7e-89   Nelumbo nucifera [Indian lotus]
ref|XP_009772840.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    275   1e-88   Nicotiana sylvestris
gb|KJB43471.1|  hypothetical protein B456_007G201900                    273   2e-88   Gossypium raimondii
gb|KHG18626.1|  Protein YrdA                                            272   3e-88   Gossypium arboreum [tree cotton]
ref|XP_007017577.1|  Gamma carbonic anhydrase 1, CA1                    275   3e-88   
ref|XP_004146498.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    274   5e-88   Cucumis sativus [cucumbers]
gb|KJB43468.1|  hypothetical protein B456_007G201900                    274   5e-88   Gossypium raimondii
ref|XP_004233530.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    274   6e-88   
ref|XP_004152688.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    273   1e-87   Cucumis sativus [cucumbers]
ref|XP_007204711.1|  hypothetical protein PRUPE_ppa009928mg             273   1e-87   Prunus persica
ref|XP_010263617.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    272   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_008444737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    272   2e-87   Cucumis melo [Oriental melon]
ref|XP_004160973.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    272   3e-87   
ref|XP_010922032.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    271   4e-87   Elaeis guineensis
ref|XP_008338081.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    271   5e-87   
gb|KDP38527.1|  hypothetical protein JCGZ_04452                         271   5e-87   Jatropha curcas
gb|KHG00707.1|  hypothetical protein F383_22748                         271   1e-86   Gossypium arboreum [tree cotton]
gb|KCW68230.1|  hypothetical protein EUGRSUZ_F01883                     269   1e-86   Eucalyptus grandis [rose gum]
gb|KJB12032.1|  hypothetical protein B456_002G126800                    270   1e-86   Gossypium raimondii
ref|XP_002302024.1|  transcription factor APFI family protein           270   1e-86   Populus trichocarpa [western balsam poplar]
gb|KCW68231.1|  hypothetical protein EUGRSUZ_F01883                     268   2e-86   Eucalyptus grandis [rose gum]
ref|XP_008241708.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    270   2e-86   Prunus mume [ume]
ref|XP_006425642.1|  hypothetical protein CICLE_v10026267mg             270   2e-86   Citrus clementina [clementine]
ref|XP_006386210.1|  hypothetical protein POPTR_0002s03550g             270   2e-86   
ref|XP_006466826.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    270   2e-86   Citrus sinensis [apfelsine]
ref|NP_001241093.1|  uncharacterized protein LOC100805278               270   3e-86   Glycine max [soybeans]
ref|XP_009371625.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    269   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_010061298.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    269   5e-86   Eucalyptus grandis [rose gum]
ref|XP_002510411.1|  Protein yrdA, putative                             269   5e-86   Ricinus communis
gb|KDP38522.1|  hypothetical protein JCGZ_04447                         269   5e-86   Jatropha curcas
ref|XP_003523810.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    269   6e-86   Glycine max [soybeans]
ref|XP_002510412.1|  Protein yrdA, putative                             268   6e-86   Ricinus communis
gb|AFK46651.1|  unknown                                                 268   9e-86   Lotus japonicus
ref|XP_002306878.1|  transcription factor APFI family protein           268   9e-86   Populus trichocarpa [western balsam poplar]
gb|AFK48594.1|  unknown                                                 268   9e-86   Lotus japonicus
ref|XP_010931534.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    270   1e-85   Elaeis guineensis
ref|XP_008786862.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    268   1e-85   Phoenix dactylifera
ref|NP_001275071.1|  transcription factor APFI-like                     267   2e-85   Solanum tuberosum [potatoes]
ref|XP_008338249.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    267   2e-85   Malus domestica [apple tree]
gb|KEH36170.1|  gamma carbonic anhydrase-like protein                   267   2e-85   Medicago truncatula
ref|XP_009340721.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    267   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_009391607.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    267   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006878532.1|  hypothetical protein AMTR_s00011p00224870          267   3e-85   Amborella trichopoda
ref|XP_011007461.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    267   3e-85   Populus euphratica
ref|XP_007222873.1|  hypothetical protein PRUPE_ppa009923mg             267   3e-85   Prunus persica
ref|XP_008220827.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    266   4e-85   Prunus mume [ume]
gb|KDO84603.1|  hypothetical protein CISIN_1g0242241mg                  263   4e-85   Citrus sinensis [apfelsine]
ref|XP_009590737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    266   4e-85   Nicotiana tomentosiformis
ref|XP_006383176.1|  hypothetical protein POPTR_0005s12280g             266   7e-85   Populus trichocarpa [western balsam poplar]
ref|XP_004291863.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    266   8e-85   Fragaria vesca subsp. vesca
gb|AFK45344.1|  unknown                                                 265   1e-84   Medicago truncatula
ref|XP_009365039.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    265   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_009399949.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    265   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386943.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    265   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK41197.1|  unknown                                                 265   2e-84   Medicago truncatula
ref|XP_009336133.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    265   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_008788543.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    264   3e-84   Phoenix dactylifera
ref|XP_009799511.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    264   4e-84   Nicotiana sylvestris
ref|XP_011074556.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    264   4e-84   Sesamum indicum [beniseed]
ref|XP_010113421.1|  hypothetical protein L484_026755                   263   6e-84   Morus notabilis
ref|XP_010538097.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    264   6e-84   Tarenaya hassleriana [spider flower]
ref|XP_008388037.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    263   8e-84   Malus domestica [apple tree]
ref|XP_006435021.1|  hypothetical protein CICLE_v10002155mg             263   1e-83   Citrus clementina [clementine]
ref|XP_011083204.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    263   1e-83   Sesamum indicum [beniseed]
ref|XP_010523601.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    262   4e-83   Tarenaya hassleriana [spider flower]
ref|XP_009365536.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    261   4e-83   Pyrus x bretschneideri [bai li]
ref|XP_002890347.1|  F18O14.34                                          262   5e-83   
ref|XP_011011740.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    260   1e-82   Populus euphratica
gb|AAM61583.1|  unknown                                                 260   1e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44607.1|  unknown protein                                        260   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564091.1|  gamma carbonic anhydrase 1                            260   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287879.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    260   2e-82   Fragaria vesca subsp. vesca
gb|AAF79435.1|AC025808_17  F18O14.34                                    260   2e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43151.1|  unknown protein                                        259   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083663.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    259   4e-82   Sesamum indicum [beniseed]
ref|XP_008364986.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    259   5e-82   
ref|XP_009771198.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    258   1e-81   Nicotiana sylvestris
ref|XP_009612501.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    258   1e-81   Nicotiana tomentosiformis
ref|XP_004232424.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    258   1e-81   Solanum lycopersicum
ref|XP_010679758.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    257   2e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006340643.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    257   3e-81   Solanum tuberosum [potatoes]
gb|EYU45182.1|  hypothetical protein MIMGU_mgv1a011728mg                256   3e-81   Erythranthe guttata [common monkey flower]
ref|XP_003562574.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    256   3e-81   Brachypodium distachyon [annual false brome]
ref|XP_004238283.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    256   5e-81   Solanum lycopersicum
emb|CDP07494.1|  unnamed protein product                                255   1e-80   Coffea canephora [robusta coffee]
gb|KCW68228.1|  hypothetical protein EUGRSUZ_F01883                     255   1e-80   Eucalyptus grandis [rose gum]
ref|XP_006341958.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    254   2e-80   Solanum tuberosum [potatoes]
ref|XP_009799510.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    255   2e-80   Nicotiana sylvestris
tpg|DAA63887.1|  TPA: hypothetical protein ZEAMMB73_753225              253   2e-80   
ref|NP_001066265.1|  Os12g0169700                                       254   3e-80   
ref|XP_006305517.1|  hypothetical protein CARUB_v10009987mg             252   4e-80   
ref|XP_002463275.1|  hypothetical protein SORBIDRAFT_02g041030          253   1e-79   Sorghum bicolor [broomcorn]
ref|NP_001169012.1|  uncharacterized protein LOC100382844               253   1e-79   Zea mays [maize]
ref|XP_006305516.1|  hypothetical protein CARUB_v10009987mg             252   2e-79   Capsella rubella
ref|XP_006663861.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    252   2e-79   Oryza brachyantha
ref|NP_175159.1|  gamma carbonic anhydrase 2                            250   1e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47592.1|  BnaC08g04620D                                          250   1e-78   Brassica napus [oilseed rape]
ref|XP_002455477.1|  hypothetical protein SORBIDRAFT_03g011540          249   2e-78   Sorghum bicolor [broomcorn]
gb|EMT05784.1|  hypothetical protein F775_31542                         248   2e-78   
ref|XP_003567426.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    249   2e-78   Brachypodium distachyon [annual false brome]
ref|XP_004958498.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    249   2e-78   Setaria italica
ref|XP_010500247.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    249   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_003612060.1|  Transcription factor APFI-like protein             249   3e-78   Medicago truncatula
ref|XP_009107430.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    249   3e-78   
emb|CDM82924.1|  unnamed protein product                                248   5e-78   Triticum aestivum [Canadian hard winter wheat]
gb|AFW79497.1|  hypothetical protein ZEAMMB73_562884                    246   6e-78   
gb|KFK44104.1|  hypothetical protein AALP_AA1G216400                    248   1e-77   Arabis alpina [alpine rockcress]
ref|XP_008810436.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    247   2e-77   Phoenix dactylifera
ref|NP_001060439.1|  Os07g0642900                                       247   2e-77   
ref|XP_008655471.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    246   2e-77   
emb|CDY17034.1|  BnaA08g03980D                                          246   3e-77   Brassica napus [oilseed rape]
ref|XP_006393603.1|  hypothetical protein EUTSA_v10011707mg             246   3e-77   Eutrema salsugineum [saltwater cress]
ref|XP_009110271.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    246   3e-77   Brassica rapa
gb|AAK28403.1|AF249876_1  transcription factor APFI                     246   3e-77   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ04886.1|  hypothetical protein OsI_27068                          246   4e-77   Oryza sativa Indica Group [Indian rice]
gb|EYU31197.1|  hypothetical protein MIMGU_mgv1a012119mg                246   4e-77   Erythranthe guttata [common monkey flower]
emb|CDX96658.1|  BnaA08g22010D                                          246   4e-77   
ref|XP_003517218.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    246   5e-77   Glycine max [soybeans]
ref|XP_006644073.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    245   9e-77   Oryza brachyantha
emb|CDX83758.1|  BnaC08g18870D                                          245   1e-76   
emb|CDY67628.1|  BnaCnng55730D                                          244   2e-76   Brassica napus [oilseed rape]
ref|XP_006304043.1|  hypothetical protein CARUB_v10009842mg             245   3e-76   
gb|KHN36089.1|  Hypothetical protein glysoja_003212                     243   7e-76   Glycine soja [wild soybean]
ref|XP_010459631.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    243   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004512067.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    242   1e-75   Cicer arietinum [garbanzo]
gb|KFK36155.1|  hypothetical protein AALP_AA4G085200                    242   2e-75   Arabis alpina [alpine rockcress]
gb|ACU23675.1|  unknown                                                 241   2e-75   Glycine max [soybeans]
ref|XP_007156970.1|  hypothetical protein PHAVU_002G032600g             241   3e-75   Phaseolus vulgaris [French bean]
gb|EPS62312.1|  hypothetical protein M569_12479                         241   3e-75   Genlisea aurea
gb|ABK26184.1|  unknown                                                 241   5e-75   Picea sitchensis
ref|XP_003537599.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    241   5e-75   Glycine max [soybeans]
ref|XP_010498381.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    240   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010477178.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    240   8e-75   
gb|ACU19296.1|  unknown                                                 240   8e-75   Glycine max [soybeans]
ref|NP_001042763.1|  Os01g0283100                                       240   9e-75   
ref|XP_009145039.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    239   3e-74   Brassica rapa
gb|EEC70424.1|  hypothetical protein OsI_01428                          238   4e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_004967660.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    238   6e-74   Setaria italica
gb|KJB17751.1|  hypothetical protein B456_003G013500                    236   7e-74   Gossypium raimondii
emb|CBI17490.3|  unnamed protein product                                236   9e-74   Vitis vinifera
ref|XP_008672301.1|  PREDICTED: uncharacterized protein LOC100217...    235   1e-73   Zea mays [maize]
gb|ACG33606.1|  transcription factor APFI                               236   2e-73   Zea mays [maize]
ref|XP_008672300.1|  PREDICTED: uncharacterized protein LOC100217...    235   5e-73   Zea mays [maize]
emb|CDY23649.1|  BnaA05g17800D                                          234   2e-72   Brassica napus [oilseed rape]
ref|XP_010679759.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    232   7e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG35255.1|  transcription factor APFI                               232   7e-72   Zea mays [maize]
dbj|BAB10927.1|  ferripyochelin-binding protein-like                    223   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444788.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    224   1e-68   Camelina sativa [gold-of-pleasure]
ref|NP_569036.1|  gamma carbonic anhydrase 3                            223   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484635.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    223   2e-68   Camelina sativa [gold-of-pleasure]
ref|NP_001078808.1|  gamma carbonic anhydrase 3                         223   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71345.1|  hypothetical protein M569_03414                         222   4e-68   Genlisea aurea
gb|AFK09616.1|  gamma carbonic anhydrase 3                              223   6e-68   Arabidopsis halleri subsp. gemmifera
gb|AFK09615.1|  gamma carbonic anhydrase 3                              222   8e-68   Arabidopsis kamchatica
ref|XP_002865062.1|  gamma CA3                                          222   9e-68   
gb|AFK09618.1|  gamma carbonic anhydrase 3                              222   1e-67   Arabidopsis lyrata subsp. lyrata
gb|ACJ85087.1|  unknown                                                 220   1e-67   Medicago truncatula
dbj|BAK01732.1|  predicted protein                                      221   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006393845.1|  hypothetical protein EUTSA_v10004794mg             220   5e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010465384.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    218   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010550419.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    212   5e-64   Tarenaya hassleriana [spider flower]
gb|KHN45864.1|  Hypothetical protein glysoja_023087                     210   5e-64   Glycine soja [wild soybean]
ref|XP_009103523.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    210   3e-63   Brassica rapa
emb|CDY45234.1|  BnaA07g12560D                                          209   6e-63   Brassica napus [oilseed rape]
dbj|BAB39954.1|  OSJNBa0004B13.8                                        207   3e-62   Oryza sativa Japonica Group [Japonica rice]
gb|ADQ43216.1|  GAMMA CA3/carbonate dehydratase                         206   8e-62   Schrenkiella parvula
ref|XP_010649292.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    203   8e-62   
emb|CDY30772.1|  BnaC07g16720D                                          206   1e-61   Brassica napus [oilseed rape]
gb|KFK28325.1|  hypothetical protein AALP_AA8G501300                    203   1e-60   Arabis alpina [alpine rockcress]
emb|CDY50984.1|  BnaC02g48920D                                          203   2e-60   Brassica napus [oilseed rape]
gb|ACU22925.1|  unknown                                                 199   8e-60   Glycine max [soybeans]
ref|XP_002968991.1|  hypothetical protein SELMODRAFT_145865             197   5e-58   Selaginella moellendorffii
ref|XP_002894036.1|  hypothetical protein ARALYDRAFT_891497             196   8e-58   
emb|CDY55089.1|  BnaA02g34770D                                          189   2e-55   Brassica napus [oilseed rape]
ref|XP_001776500.1|  predicted protein                                  187   2e-54   
ref|XP_006279533.1|  hypothetical protein CARUB_v10028265mg             183   1e-53   
ref|XP_010461522.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    176   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_001758123.1|  predicted protein                                  176   5e-50   
ref|XP_009149442.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    172   2e-49   
gb|ACV52585.1|  transcription factor APFI-like protein                  165   4e-47   Nicotiana benthamiana
ref|XP_002504597.1|  predicted protein                                  167   7e-47   Micromonas commoda
ref|XP_003059787.1|  predicted protein                                  155   4e-42   Micromonas pusilla CCMP1545
ref|XP_001754319.1|  predicted protein                                  155   4e-42   
ref|XP_005847553.1|  hypothetical protein CHLNCDRAFT_35390              151   2e-40   Chlorella variabilis
gb|EMT05904.1|  hypothetical protein F775_31226                         143   2e-39   
ref|XP_007204710.1|  hypothetical protein PRUPE_ppa009928mg             144   1e-38   
ref|XP_007136607.1|  hypothetical protein PHAVU_009G0592001g            141   5e-38   Phaseolus vulgaris [French bean]
ref|XP_007136608.1|  hypothetical protein PHAVU_009G0592001g            142   8e-38   Phaseolus vulgaris [French bean]
gb|KJB12033.1|  hypothetical protein B456_002G126800                    142   1e-37   Gossypium raimondii
ref|XP_005644680.1|  gamma-carbonic anhydrase                           144   1e-37   Coccomyxa subellipsoidea C-169
ref|XP_003612061.1|  Transcription factor APFI-like protein             140   4e-37   
ref|XP_001696746.1|  gamma carbonic anhydrase                           142   1e-36   Chlamydomonas reinhardtii
gb|AFK37757.1|  unknown                                                 137   2e-36   Medicago truncatula
ref|NP_001137016.1|  uncharacterized protein LOC100217184               139   3e-36   Zea mays [maize]
tpg|DAA54233.1|  TPA: hypothetical protein ZEAMMB73_935334              139   3e-36   
ref|XP_010463232.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    135   3e-35   
ref|NP_001185039.1|  gamma carbonic anhydrase 1                         135   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|WP_025898515.1|  carbonic anhydrase                                 132   3e-34   Sneathiella glossodoripedis
ref|XP_002956125.1|  hypothetical protein VOLCADRAFT_83469              136   3e-34   Volvox carteri f. nagariensis
ref|XP_007136612.1|  hypothetical protein PHAVU_009G0594001g            125   1e-32   Phaseolus vulgaris [French bean]
ref|XP_007136610.1|  hypothetical protein PHAVU_009G0592000g            125   2e-32   Phaseolus vulgaris [French bean]
gb|KHN22240.1|  hypothetical protein glysoja_021996                     124   1e-31   Glycine soja [wild soybean]
ref|WP_011384197.1|  carbonic anhydrase                                 125   2e-31   Magnetospirillum magneticum
ref|XP_005649920.1|  trimeric LpxA-like protein                         126   3e-31   Coccomyxa subellipsoidea C-169
ref|WP_021132357.1|  carbonic anhydrase/acetyltransferase               124   3e-31   Phaeospirillum fulvum
ref|XP_005703463.1|  hypothetical protein Gasu_55130                    127   3e-31   Galdieria sulphuraria
gb|EME71085.1|  carbonic anhydrase/acetyltransferase                    123   8e-31   Magnetospirillum caucaseum
ref|WP_040475708.1|  carbonic anhydrase                                 123   8e-31   
ref|WP_002727628.1|  carbonic anhydrase                                 123   9e-31   Phaeospirillum molischianum
ref|XP_006581202.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    120   2e-30   
gb|AFK40628.1|  unknown                                                 105   2e-30   Lotus japonicus
ref|WP_024080899.1|  putative hexapeptide repeat acetyltransferase      121   6e-30   Magnetospirillum gryphiswaldense
ref|XP_011398885.1|  Uncharacterized protein F751_3627                  122   8e-30   Auxenochlorella protothecoides
ref|WP_007091625.1|  MULTISPECIES: carbonic anhydrase                   120   1e-29   Thalassospira
ref|WP_044828700.1|  carbonic anhydrase                                 120   2e-29   Thalassospira sp. HJ
ref|WP_041046278.1|  carbonic anhydrase                                 119   2e-29   Wolbachia endosymbiont of Cimex lectularius
gb|EKF07893.1|  carbonic anhydrase/acetyltransferase                    119   3e-29   Thalassospira profundimaris WP0211
gb|ETI49161.1|  hypothetical protein F443_06919                         121   3e-29   Phytophthora parasitica P1569
ref|XP_008903478.1|  hypothetical protein PPTG_09984                    121   3e-29   Phytophthora parasitica INRA-310
ref|WP_040823796.1|  carbonic anhydrase                                 119   4e-29   
ref|WP_033067257.1|  carbonic anhydrase                                 119   4e-29   Thalassospira australica
ref|XP_009821152.1|  hypothetical protein H257_00264                    120   4e-29   Aphanomyces astaci
ref|XP_009516211.1|  hypothetical protein PHYSODRAFT_537494             120   6e-29   Phytophthora sojae
ref|WP_028794944.1|  carbonic anhydrase                                 118   8e-29   Thalassobaculum
ref|XP_002673591.1|  gamma carbonic dehydratase                         120   8e-29   Naegleria gruberi strain NEG-M
ref|WP_009867839.1|  COG0663: Carbonic anhydrases/acetyltransfera...    118   8e-29   Magnetospirillum magnetotacticum
ref|XP_002997211.1|  conserved hypothetical protein                     120   1e-28   Phytophthora infestans T30-4
ref|WP_012459916.1|  acetyltransferase                                  117   1e-28   Sulfurihydrogenibium sp. YO3AOP1
ref|XP_008610617.1|  hypothetical protein SDRG_06605                    119   1e-28   Saprolegnia diclina VS20
ref|WP_007547159.1|  acetyltransferase                                  117   1e-28   Sulfurihydrogenibium yellowstonense
ref|WP_028791231.1|  carbonic anhydrase                                 117   2e-28   Thalassospira lucentensis
ref|XP_008862851.1|  hypothetical protein H310_01513                    119   2e-28   Aphanomyces invadans
ref|WP_008944647.1|  carbonic anhydrase                                 116   4e-28   Oceanibaculum indicum
gb|KIY95938.1|  transferase                                             118   7e-28   Monoraphidium neglectum
ref|WP_029013145.1|  carbonic anhydrase                                 115   8e-28   Niveispirillum irakense
ref|WP_044578399.1|  hypothetical protein                               115   1e-27   Rickettsiales bacterium Ac37b
ref|WP_014857207.1|  acetyltransferase                                  115   1e-27   Melioribacter roseus
ref|WP_028096230.1|  carbonic anhydrase                                 114   2e-27   Dongia sp. URHE0060
ref|WP_044564502.1|  carbonic anhydrase                                 114   3e-27   Azospirillum sp. B4
ref|WP_043335714.1|  anhydrase                                          114   4e-27   Halomonadaceae
ref|WP_026842119.1|  transferase                                        114   4e-27   Geobacter bremensis
emb|CCI50078.1|  unnamed protein product                                115   4e-27   Albugo candida
emb|CDR78889.1|  hexapeptide transferase family protein,hypotheti...    113   5e-27   Wolbachia endosymbiont of Drosophila simulans wAu
ref|WP_010962614.1|  MULTISPECIES: carbonic anhydrase                   113   5e-27   Wolbachia
ref|WP_028951275.1|  transferase                                        113   5e-27   Sulfurihydrogenibium subterraneum
gb|AAU93943.1|  gamma-carbonic anhydrase                                115   6e-27   Helicosporidium sp. ex Simulium jonesi
ref|WP_007548882.1|  MULTISPECIES: carbonic anhydrase                   113   6e-27   Wolbachia
ref|WP_015588968.1|  Hexapeptide transferase family protein             113   6e-27   Wolbachia endosymbiont of Drosophila simulans
ref|WP_025822980.1|  anhydrase                                          113   7e-27   Shewanella marina
ref|WP_015838795.1|  acetyltransferase                                  113   7e-27   Geobacter sp. M21
ref|WP_012674376.1|  acetyltransferase                                  113   7e-27   Sulfurihydrogenibium azorense
ref|WP_038251016.1|  carbonic anhydrase                                 112   8e-27   Wolbachia endosymbiont of Glossina morsitans morsitans
ref|WP_027852014.1|  anhydrase                                          112   1e-26   Marinospirillum insulare
ref|WP_041917455.1|  carbonic anhydrase                                 112   1e-26   Neorickettsia sennetsu
ref|WP_040848085.1|  hypothetical protein                               112   1e-26   
ref|XP_008871299.1|  hypothetical protein H310_07655                    114   1e-26   Aphanomyces invadans
ref|WP_024953352.1|  anhydrase                                          112   1e-26   Cobetia
ref|WP_015588396.1|  Hexapeptide transferase family protein             112   1e-26   Wolbachia endosymbiont of Drosophila simulans
gb|ABD46435.1|  hexapeptide transferase family protein                  112   1e-26   Neorickettsia sennetsu str. Miyayama
emb|CCA17668.1|  conserved hypothetical protein                         114   1e-26   Albugo laibachii Nc14
ref|WP_012531949.1|  acetyltransferase                                  112   1e-26   Geobacter bemidjiensis
ref|WP_007302594.1|  MULTISPECIES: carbonic anhydrase                   112   1e-26   Wolbachia
ref|WP_007234200.1|  anhydrase                                          112   1e-26   marine gamma proteobacterium HTCC2080
ref|WP_012675364.1|  acetyltransferase                                  112   1e-26   Persephonella marina
ref|WP_006012476.1|  carbonic anhydrase                                 112   2e-26   Wolbachia pipientis
ref|WP_022085005.1|  hypothetical protein                               111   2e-26   
ref|WP_017532531.1|  carbonic anhydrase                                 111   2e-26   Wolbachia endosymbiont of Diaphorina citri
ref|WP_027289020.1|  carbonic anhydrase                                 112   2e-26   
ref|XP_009523979.1|  hypothetical protein PHYSODRAFT_285582             113   3e-26   
ref|WP_016400037.1|  carbonic anhydrase                                 111   3e-26   
ref|WP_010404888.1|  carbonic anhydrase                                 111   3e-26   
ref|WP_014102582.1|  carbonic anhydrase                                 111   4e-26   
ref|WP_013343555.1|  hypothetical protein                               111   4e-26   
ref|WP_015718917.1|  acetyltransferase                                  111   5e-26   
emb|CCI47075.1|  unnamed protein product                                112   5e-26   
ref|WP_041351328.1|  carbonic anhydrase                                 110   5e-26   
gb|ACT69043.1|  hexapeptide transferase family protein                  110   5e-26   
ref|WP_014415395.1|  carbonic anhydrase                                 110   6e-26   
ref|XP_002908534.1|  conserved hypothetical protein                     112   6e-26   
ref|WP_022046913.1|  hypothetical protein                               110   7e-26   
ref|WP_044559198.1|  carbonic anhydrase                                 108   7e-26   
ref|WP_009653926.1|  hypothetical protein                               110   8e-26   
ref|WP_015467349.1|  carbonic anhydrase, family 3                       110   8e-26   
ref|WP_004854730.1|  hypothetical protein                               110   9e-26   
emb|CCA20868.1|  conserved hypothetical protein                         111   1e-25   
ref|WP_019052663.1|  hypothetical protein                               110   1e-25   
ref|XP_008890951.1|  hypothetical protein PPTG_01107                    111   1e-25   
ref|WP_007673447.1|  carbonic anhydrase                                 109   1e-25   
ref|WP_014839658.1|  hypothetical protein                               110   1e-25   
ref|WP_038012874.1|  carbonic anhydrase                                 109   1e-25   
ref|WP_011256488.1|  carbonic anhydrase                                 109   2e-25   
ref|WP_014227026.1|  hypothetical protein                               109   2e-25   
ref|XP_009831264.1|  hypothetical protein H257_07436                    110   2e-25   
gb|ADE39666.1|  hexapeptide transferase family protein                  110   2e-25   
ref|XP_009033998.1|  hypothetical protein AURANDRAFT_21261              110   2e-25   
ref|WP_041861268.1|  carbonic anhydrase                                 108   2e-25   
ref|XP_009042543.1|  hypothetical protein AURANDRAFT_34918              110   2e-25   
ref|WP_009023947.1|  anhydrase                                          109   2e-25   
ref|WP_017184183.1|  hypothetical protein                               109   2e-25   
ref|WP_028465013.1|  carbonic anhydrase                                 108   2e-25   
ref|WP_032693883.1|  hypothetical protein                               109   3e-25   
ref|WP_024360698.1|  MULTISPECIES: hypothetical protein                 108   3e-25   
ref|WP_042044584.1|  anhydrase                                          108   3e-25   
ref|WP_027849286.1|  anhydrase                                          108   3e-25   
ref|WP_012632885.1|  acetyltransferase                                  108   4e-25   
ref|WP_020593264.1|  hypothetical protein                               108   4e-25   
ref|WP_012525566.1|  acetyltransferase                                  108   4e-25   
ref|WP_009019187.1|  anhydrase                                          108   4e-25   
ref|WP_013782536.1|  hypothetical protein                               108   4e-25   
ref|WP_018963259.1|  hypothetical protein                               108   4e-25   
ref|XP_005536976.1|  transcription factor APFI                          110   5e-25   
ref|WP_006961722.1|  carbonic anhydrase, family 3                       108   5e-25   
ref|WP_005357003.1|  carbonic anhydrase                                 108   5e-25   
ref|WP_011451237.1|  carbonic anhydrase                                 107   5e-25   
ref|WP_041391656.1|  carbonic anhydrase                                 108   6e-25   
dbj|BAK64770.1|  conserved hypothetical protein                         108   6e-25   
ref|WP_006010492.1|  carbonic anhydrase                                 107   6e-25   
ref|XP_005850191.1|  hypothetical protein CHLNCDRAFT_20587              109   7e-25   
ref|WP_004106285.1|  MULTISPECIES: hypothetical protein                 107   8e-25   
pdb|3IXC|A  Chain A, Crystal Structure Of Hexapeptide Transferase...    108   8e-25   
ref|WP_037948129.1|  acetyltransferase                                  107   8e-25   
ref|WP_013459351.1|  acetyltransferase                                  107   8e-25   
gb|EOA62647.1|  hexapeptide transferase family protein                  107   8e-25   
ref|WP_044194011.1|  carbonic anhydrase                                 107   8e-25   
ref|WP_019174558.1|  hypothetical protein                               107   9e-25   
ref|WP_040240919.1|  anhydrase                                          107   9e-25   
ref|WP_008289121.1|  acetyltransferase                                  107   9e-25   
emb|CDY29419.1|  BnaA06g13770D                                          107   1e-24   
ref|WP_015027264.1|  acetyltransferase                                  107   1e-24   
ref|WP_021194724.1|  hypothetical protein                               107   1e-24   
ref|WP_011505709.1|  MULTISPECIES: anhydrase                            107   1e-24   
ref|WP_031384800.1|  anhydrase                                          107   1e-24   
ref|WP_043994545.1|  anhydrase                                          107   1e-24   
ref|WP_038538794.1|  hypothetical protein                               107   1e-24   
ref|WP_027251697.1|  anhydrase                                          107   1e-24   
ref|WP_035013879.1|  anhydrase                                          107   2e-24   
ref|WP_029522898.1|  transferase                                        106   2e-24   
ref|WP_024609635.1|  anhydrase                                          107   2e-24   
ref|WP_038423753.1|  hypothetical protein                               107   2e-24   
ref|WP_011421405.1|  acetyltransferase                                  106   2e-24   
ref|WP_039455831.1|  hypothetical protein                               106   2e-24   
gb|EDM66536.1|  Putative carbonic anhydrase, family 3                   107   2e-24   
ref|WP_004125862.1|  hypothetical protein                               107   2e-24   
ref|WP_010881079.1|  acetyltransferase                                  106   2e-24   
ref|WP_042445259.1|  carbonic anhydrase                                 106   2e-24   
ref|WP_016900050.1|  MULTISPECIES: hypothetical protein                 106   2e-24   
ref|WP_038558699.1|  carbonic anhydrase                                 106   2e-24   
emb|CDQ33994.1|  carnitine operon protein CaiE                          106   2e-24   
ref|WP_038180340.1|  anhydrase                                          106   2e-24   
ref|WP_028834916.1|  MULTISPECIES: anhydrase                            106   2e-24   
ref|WP_022679800.1|  carbonic anhydrase                                 106   2e-24   
ref|WP_009096622.1|  anhydrase                                          106   2e-24   
emb|CEG20404.1|  Carbonic anhydrases/Acetyltransferase, isoleucin...    106   2e-24   
gb|KDO22056.1|  hypothetical protein SPRG_12043                         108   2e-24   
ref|WP_007634755.1|  hypothetical protein                               106   2e-24   
ref|XP_008608997.1|  hypothetical protein SDRG_05080                    107   2e-24   
ref|WP_011985832.1|  acetyltransferase                                  106   2e-24   
ref|WP_024591294.1|  MULTISPECIES: anhydrase                            106   2e-24   
ref|WP_038483131.1|  hypothetical protein                               106   2e-24   
ref|WP_036980767.1|  anhydrase                                          106   2e-24   
ref|WP_011951931.1|  MULTISPECIES: carbonic anhydrase                   106   2e-24   
ref|WP_008172062.1|  hypothetical protein                               106   3e-24   
dbj|BAI74729.1|  carbonic anhydrase/acetyltransferase                   106   3e-24   
ref|WP_019019722.1|  anhydrase                                          106   3e-24   
ref|WP_034879021.1|  anhydrase                                          106   3e-24   
ref|WP_015652928.1|  hypothetical protein                               106   3e-24   
ref|WP_015703633.1|  hypothetical protein                               106   3e-24   
ref|WP_026893964.1|  hypothetical protein                               105   3e-24   
gb|AIE67411.1|  hypothetical protein HR38_02745                         107   3e-24   
dbj|BAH53384.1|  hypothetical protein                                   105   4e-24   
ref|WP_006156211.1|  carbonic anhydrase                                 105   4e-24   
ref|WP_041466615.1|  acetyltransferase                                  105   4e-24   
gb|ABB27525.1|  acetyltransferase, CysE/LacA/LpxA/NodL family           105   4e-24   
ref|WP_043825309.1|  anhydrase                                          106   4e-24   
ref|WP_012532741.1|  hypothetical protein                               105   4e-24   
ref|WP_017018069.1|  hypothetical protein                               105   5e-24   
ref|WP_029520498.1|  transferase                                        105   5e-24   
ref|WP_013463677.1|  MULTISPECIES: hypothetical protein                 105   5e-24   
ref|WP_021186388.1|  carbonic anhydrase, family 3                       105   5e-24   
ref|WP_022518714.1|  carbonic anhydrases/acetyltransferases isole...    105   5e-24   
ref|WP_012543665.1|  hypothetical protein                               105   5e-24   
ref|WP_005421510.1|  hypothetical protein                               105   5e-24   
ref|WP_037263136.1|  carbonic anhydrase                                 105   6e-24   
ref|WP_033113624.1|  anhydrase                                          105   6e-24   
ref|WP_041206725.1|  anhydrase                                          105   6e-24   
ref|WP_025325280.1|  anhydrase                                          105   6e-24   
ref|WP_027348896.1|  anhydrase                                          105   6e-24   
ref|WP_014745465.1|  carbonic anhydrase                                 106   6e-24   
ref|WP_035476877.1|  anhydrase                                          105   6e-24   
ref|WP_009603885.1|  carbonic anhydrase                                 105   6e-24   
ref|WP_021021484.1|  hypothetical protein                               105   6e-24   
ref|WP_022086093.1|  putative acetyltransferase protein                 104   6e-24   
ref|WP_042896069.1|  hypothetical protein                               105   7e-24   
gb|EPN61517.1|  hypothetical protein A244_05684                         103   7e-24   
ref|WP_043155683.1|  anhydrase                                          105   7e-24   
ref|XP_011398930.1|  Uncharacterized protein F751_3672                  106   7e-24   
ref|WP_011390173.1|  carbonic anhydrase                                 105   7e-24   
ref|WP_010203259.1|  anhydrase                                          105   7e-24   
ref|WP_043826439.1|  anhydrase                                          105   7e-24   
ref|WP_040459159.1|  anhydrase                                          105   8e-24   
ref|WP_008457228.1|  MULTISPECIES: hypothetical protein                 105   8e-24   
ref|WP_041212350.1|  MULTISPECIES: anhydrase                            105   8e-24   
ref|WP_017375920.1|  hypothetical protein                               105   8e-24   
ref|WP_019446520.1|  hypothetical protein                               104   8e-24   
ref|WP_042081845.1|  anhydrase                                          105   8e-24   
gb|KGY69586.1|  anhydrase                                               105   9e-24   
ref|WP_005357425.1|  hypothetical protein                               105   9e-24   
ref|WP_044425610.1|  carbonic anhydrase                                 104   9e-24   
emb|CCG33045.1|  carbonic anhydrase, family 3                           105   9e-24   
ref|WP_041202410.1|  anhydrase                                          104   9e-24   
ref|WP_042865397.1|  anhydrase                                          104   9e-24   
ref|WP_019952921.1|  anhydrase                                          104   9e-24   
ref|WP_008988366.1|  hypothetical protein                               105   9e-24   
ref|WP_041215790.1|  anhydrase                                          104   1e-23   
emb|CEI84790.1|  Transferase hexapeptide repeat                         104   1e-23   
ref|WP_012728390.1|  hypothetical protein                               104   1e-23   
ref|WP_027493620.1|  carbonic anhydrase                                 104   1e-23   
ref|WP_008138069.1|  hypothetical protein                               104   1e-23   
ref|WP_005356065.1|  hypothetical protein                               104   1e-23   
ref|WP_015831009.1|  hypothetical protein                               105   1e-23   
gb|KDD72217.1|  hypothetical protein H632_c3683p0                       105   1e-23   
gb|EKB10775.1|  hypothetical protein HMPREF1167_03274                   104   1e-23   
ref|WP_043151366.1|  carbonic anhydrase                                 105   1e-23   
ref|WP_039041153.1|  anhydrase                                          104   1e-23   
ref|XP_002179677.1|  predicted protein                                  104   1e-23   
ref|WP_040099506.1|  anhydrase                                          104   1e-23   
gb|AEB51905.1|  Bacterial transferase hexapeptide domain protein        104   1e-23   
ref|WP_020409186.1|  anhydrase                                          104   1e-23   
ref|WP_019644631.1|  hypothetical protein                               104   1e-23   
ref|WP_020403893.1|  hypothetical protein                               104   1e-23   
ref|WP_007377621.1|  MULTISPECIES: carbonic anhydrase                   104   1e-23   
ref|WP_029918443.1|  hypothetical protein                               104   1e-23   
ref|WP_006687341.1|  hypothetical protein                               104   1e-23   
ref|WP_023934037.1|  bacterial transferase hexapeptide domain pro...    104   1e-23   
emb|CCQ74394.1|  Conserved hypothetical protein yrdA                    104   1e-23   
ref|WP_019809120.1|  hypothetical protein                               104   1e-23   
ref|WP_008842533.1|  carbonic anhydrase/acetyltransferase               104   1e-23   
ref|WP_042312116.1|  hypothetical protein                               104   1e-23   
ref|WP_005342047.1|  hypothetical protein                               104   2e-23   
ref|WP_002959868.1|  MULTISPECIES: hypothetical protein                 104   2e-23   
ref|WP_024593212.1|  anhydrase                                          104   2e-23   
ref|WP_043288165.1|  carbonic anhydrase                                 104   2e-23   
ref|WP_019014984.1|  hypothetical protein                               104   2e-23   
ref|WP_014159084.1|  carbonic anhydrase                                 104   2e-23   
ref|WP_024072448.1|  carbonic anhydrase                                 103   2e-23   
ref|WP_042030410.1|  anhydrase                                          104   2e-23   
ref|WP_010555526.1|  hypothetical protein                               104   2e-23   
ref|WP_014992494.1|  anhydrase                                          103   2e-23   
ref|WP_044630444.1|  anhydrase                                          104   2e-23   
ref|WP_035921995.1|  carbonic anhydrase                                 103   2e-23   
ref|WP_040069429.1|  anhydrase                                          103   2e-23   
ref|WP_021242978.1|  hypothetical protein                               104   2e-23   
ref|WP_039183592.1|  anhydrase                                          104   2e-23   
ref|WP_013659390.1|  anhydrase                                          103   2e-23   
ref|WP_041878427.1|  hypothetical protein                               103   2e-23   
ref|WP_019442388.1|  hypothetical protein                               103   2e-23   
ref|WP_042639438.1|  anhydrase                                          103   2e-23   
ref|WP_008599387.1|  carbonic anhydrase, family 3                       103   2e-23   
ref|WP_016957024.1|  hypothetical protein                               103   2e-23   
ref|WP_040078379.1|  hypothetical protein                               103   2e-23   
dbj|GAF45864.1|  hypothetical protein RW1_027_00030                     103   2e-23   
gb|KDD73982.1|  hypothetical protein H632_c1679p0                       105   2e-23   
ref|WP_024685331.1|  anhydrase                                          103   2e-23   
ref|WP_026141477.1|  anhydrase                                          103   2e-23   
ref|WP_026301494.1|  anhydrase                                          103   2e-23   
ref|WP_024694236.1|  anhydrase                                          103   2e-23   
ref|WP_022221106.1|  bacterial transferase hexapeptide repeat pro...    103   2e-23   
gb|KGY64550.1|  hypothetical protein MC67_11110                         103   2e-23   
ref|WP_032690506.1|  MULTISPECIES: hypothetical protein                 103   2e-23   
ref|WP_007615600.1|  bacterial transferase hexapeptide domain pro...    103   2e-23   
ref|WP_026986265.1|  carbonic anhydrase                                 103   2e-23   
ref|WP_037232718.1|  anhydrase                                          103   2e-23   
gb|AAL08813.1|AF308663_1  hypothetical ferripyochelin binding pro...    103   2e-23   
ref|WP_041216372.1|  anhydrase                                          103   2e-23   
ref|WP_008112903.1|  hypothetical protein                               103   2e-23   
ref|WP_008293346.1|  anhydrase                                          103   2e-23   
ref|WP_043132607.1|  anhydrase                                          103   2e-23   
ref|WP_016349031.1|  carbonic anhydrase                                 103   3e-23   
ref|WP_041142948.1|  hypothetical protein                               103   3e-23   
ref|WP_043518575.1|  anhydrase                                          103   3e-23   
ref|WP_008368927.1|  acetyltransferase                                  103   3e-23   
ref|WP_044058616.1|  anhydrase                                          103   3e-23   
ref|WP_020910299.1|  Carbonic anhydrase, family 3                       103   3e-23   
ref|WP_038224114.1|  anhydrase                                          103   3e-23   
ref|WP_011304966.1|  carbonic anhydrase                                 103   3e-23   
ref|WP_024872181.1|  anhydrase                                          103   3e-23   
ref|WP_013510739.1|  carbonic anhydrase                                 103   3e-23   
ref|WP_004868312.1|  MULTISPECIES: hypothetical protein                 103   3e-23   
ref|WP_008467096.1|  hypothetical protein                               103   3e-23   



>emb|CDP01995.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 152/166 (92%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEIAFISQSALNYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIAFISQSALNYSNLAQVHAAENAKGFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   KDE+ DS+LGVVRETPP+LILP+N     APKAS
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVVRETPPELILPDNVLPDKAPKAS  271



>ref|XP_002282021.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Vitis vinifera]
 emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera]
 emb|CBI19719.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG +VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGSIVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEIAFISQSA+NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   +DED DS+LGVVRETPP+LILP+N     APK S
Sbjct  226  EFEKVLRKKFARRDEDYDSMLGVVRETPPELILPDNILPDKAPKVS  271



>ref|XP_007046882.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOX91039.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=271

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREMPPELILPDN  261



>ref|XP_010029770.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56730.1| hypothetical protein EUGRSUZ_I02417 [Eucalyptus grandis]
Length=271

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 147/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTR+PCGEVWGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRVPCGEVWGGNPAKFLRKLTEEEMAFISQSAVNYSNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDN  261



>gb|KHG23300.1| hypothetical protein F383_08437 [Gossypium arboreum]
Length=271

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRKK   +DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKMLRKKFARRDEEYDSMLGVVRETPPELILPDN  261



>ref|XP_006346962.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Solanum tuberosum]
 ref|XP_006346963.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Solanum tuberosum]
 ref|XP_006346964.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X3 [Solanum tuberosum]
Length=268

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 5/162 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HA ENAKS D  
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN--APKA  284
            EFEKVLRKK   KDE+ DS+LGVVRETPP+L+LP+N  APKA
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_009588225.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=268

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQ TRIPCGEVWGGNPA+FLRKLTEEEIAFISQSA NY+NL Q HAAENAKS D  
Sbjct  166  GALVRQKTRIPCGEVWGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN--APKAS  281
            EFEKVLRKK   KDE+ DS+LGV R+TPP+LILP+N  APKAS
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVDRQTPPELILPDNIQAPKAS  268



>ref|XP_008452092.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=271

 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMAFISQSAINYSNLSQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DED DS+LGVVRETP +LILP+N
Sbjct  226  EFEKVLRKKFARRDEDYDSMLGVVRETPSELILPDN  261



>gb|KJB17752.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=271

 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 146/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENGKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRKK   +DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKMLRKKFARRDEEYDSMLGVVRETPPELILPDN  261



>gb|KJB43469.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=188

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  23   VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  82

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE 
Sbjct  83   GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEI  142

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA+
Sbjct  143  ELETMLRKKFARRDEEYDSMLGVVRETPPELILPDNIIPDKAPKAA  188



>ref|XP_010102071.1| hypothetical protein L484_009014 [Morus notabilis]
 gb|EXB91921.1| hypothetical protein L484_009014 [Morus notabilis]
Length=272

 Score =   276 bits (707),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AF+SQSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPFGEVWGGNPAKFLRKLTEEEMAFVSQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   +DE+ DS+LGVVRETPP+L+LP+N     APKAS
Sbjct  226  EFEKVLRKKFAHRDEEYDSMLGVVRETPPELVLPDNILPDKAPKAS  271



>ref|XP_010265678.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   276 bits (706),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 148/162 (91%), Gaps = 4/162 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGE+WGGNPAKFLRKLTEEEIAFISQSA+NYSNL Q HAAENAK+ DE 
Sbjct  166  GALVRQNTRIPCGEIWGGNPAKFLRKLTEEEIAFISQSAINYSNLAQAHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA-PKAS  281
            E EKVLRKK   +DE+ DS+LGVVRE PP LILP++  PK S
Sbjct  226  ELEKVLRKKFARRDEEYDSMLGVVREVPPQLILPDSILPKES  267



>ref|XP_009772840.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=268

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTEEEIAFISQSA NY+NL Q HAAENAKS D  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN--APKAS  281
            EFEKVLRKK   KDE+ DS+LGV R+TPP+LILP+N  APKAS
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVDRQTPPELILPDNIQAPKAS  268



>gb|KJB43471.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=226

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE 
Sbjct  121  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEI  180

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA+
Sbjct  181  ELETMLRKKFARRDEEYDSMLGVVRETPPELILPDNIIPDKAPKAA  226



>gb|KHG18626.1| Protein YrdA [Gossypium arboreum]
 gb|KHG19737.1| Protein YrdA [Gossypium arboreum]
Length=191

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  24   VHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  83

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEEIAFISQSA NY+NL Q HAAENAK  DE 
Sbjct  84   GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEIAFISQSATNYTNLAQVHAAENAKPFDEI  143

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRK   K+DE+ DS+LGVVRETPP+LILP+N
Sbjct  144  EFEKILRKKFAKRDEEYDSMLGVVRETPPELILPDN  179



>ref|XP_007017577.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOY14802.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=273

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 146/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK+ DE 
Sbjct  166  GALVRQNTRIPTGEIWGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKAFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFAHRDEEYDSMLGVVRETPPELILPDN  261



>ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53299.1| hypothetical protein Csa_4G046620 [Cucumis sativus]
Length=271

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTR+PCGEVWGGNPAKFLRKLTEEE+ FISQSA+NYSNL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRVPCGEVWGGNPAKFLRKLTEEEMVFISQSAINYSNLSQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EKVLRKK   +DED DS+LGVVRETPP+L+LP+N
Sbjct  226  ELEKVLRKKFARRDEDYDSMLGVVRETPPELVLPDN  261



>gb|KJB43468.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
 gb|KJB43470.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=271

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA+
Sbjct  226  ELETMLRKKFARRDEEYDSMLGVVRETPPELILPDNIIPDKAPKAA  271



>ref|XP_004233530.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Solanum 
lycopersicum]
Length=268

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 146/162 (90%), Gaps = 5/162 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HA ENAKS D  
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN--APKA  284
            EFEK LRKK   KDE+ DS+LGVVRETPP+L+LP N  APKA
Sbjct  226  EFEKALRKKFAHKDEEYDSMLGVVRETPPELVLPVNIQAPKA  267



>ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004167040.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN62616.1| hypothetical protein Csa_2G361800 [Cucumis sativus]
Length=273

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVWGGNPAKFLRKLT+EEIAFISQSA NY NL Q HAAENAKS DE 
Sbjct  166  GALVRQNTKIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNYLNLSQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DED DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEDYDSMLGVVRETPPELILPDN  261



>ref|XP_007204711.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05910.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=271

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 147/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAENAKSLDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMAFISQSAINYSNLAQAHAAENAKSLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETP-----PDLILPNNAPKAS  281
            EFEKVLRKK   +DE+ DS+LG+VRETP     PD +LP   PK +
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGIVRETPAEITLPDNVLPGKVPKTA  271



>ref|XP_010263617.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEKN+M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNSMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEEIAFISQSA+NYSNL Q HAAENAK+ DE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPAKFLRKLTEEEIAFISQSAINYSNLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E EKVLRKK   +DE+ DS+LGVVRE PP LILP+N     +PKAS
Sbjct  226  ELEKVLRKKFARRDEEYDSMLGVVREVPPQLILPDNILPKESPKAS  271



>ref|XP_008444737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=273

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVWGGNPAKFLRKLT+EEIAFISQSA NY NL Q HAAENAKS DE 
Sbjct  166  GALVRQNTKIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNYLNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DED DS+LG+VRETPP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEDYDSMLGIVRETPPELILPDN  261



>ref|XP_004160973.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
Length=271

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTR+PCGEVWGGNPAKFLRKLTEEE+ FI QSA+NYSNL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRVPCGEVWGGNPAKFLRKLTEEEMVFICQSAINYSNLSQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EKVLRKK   +DED DS+LGVVRETPP+L+LP+N
Sbjct  226  ELEKVLRKKFARRDEDYDSMLGVVRETPPELVLPDN  261



>ref|XP_010922032.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=272

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE 
Sbjct  166  GALVRQNTKIPCGEVWGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N     +PK S
Sbjct  226  EFEKVLRKKYARRDEEYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|XP_008338081.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 147/163 (90%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA--PKAS  281
            EF+KVLRKK   +DE+ DS+LGV RETP +  LP+NA  PKA+
Sbjct  226  EFQKVLRKKFARRDEEYDSMLGVTRETPAETTLPDNASPPKAA  268



>gb|KDP38527.1| hypothetical protein JCGZ_04452 [Jatropha curcas]
Length=271

 Score =   271 bits (694),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 149/165 (90%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT++G+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTLVGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA FLRKLT+EEIAFISQSA+NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPAGEVWGGNPANFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>gb|KHG00707.1| hypothetical protein F383_22748 [Gossypium arboreum]
Length=271

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+ KVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSRKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA+
Sbjct  226  ELEMMLRKKFARRDEEYDSMLGVVRETPPELILPDNIIPDKAPKAA  271



>gb|KCW68230.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=241

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 8/164 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A 
Sbjct  74   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAG  133

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  134  GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEI  193

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  287
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APK
Sbjct  194  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  237



>gb|KJB12032.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=273

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEEI+FISQSA NY+NL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEISFISQSATNYTNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRK   K+DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFAKRDEEYDSMLGVVRETPPELILPDN  261



>ref|XP_002302024.1| transcription factor APFI family protein [Populus trichocarpa]
 ref|XP_011028863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Populus 
euphratica]
 gb|ABK95146.1| unknown [Populus trichocarpa]
 gb|EEE81297.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPTGEVWGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRK   KKDE+ DS+LGVVRE PP+LILPNN
Sbjct  226  EFEKVLRKKFAKKDEEYDSMLGVVRELPPELILPNN  261



>gb|KCW68231.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=209

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 8/164 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A 
Sbjct  42   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAG  101

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  102  GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEI  161

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  287
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APK
Sbjct  162  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  205



>ref|XP_008241708.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=271

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 146/166 (88%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSA+NYSNL Q HAAENAKSLDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSAINYSNLAQAHAAENAKSLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETP-----PDLILPNNAPKAS  281
            EFEKVL+KK   +DE+ DS+LGVVRETP     PD +LP   PK +
Sbjct  226  EFEKVLQKKFARRDEEYDSMLGVVRETPAEITLPDNVLPGKVPKTA  271



>ref|XP_006425642.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
 gb|ESR38882.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
Length=271

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPA+FLRKLTEEE+AFISQSA+NYSNL + HAAENAKS DE 
Sbjct  166  GALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRKK   +DE+ DS+LGVVRETP +LILP+N
Sbjct  226  EFEKLLRKKFARRDEEYDSMLGVVRETPAELILPDN  261



>ref|XP_006386210.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
 gb|ERP64007.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
Length=285

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  120  VHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  179

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  180  GALVRQNTRIPTGEVWGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEI  239

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRK   KKDE+ DS+LGVVRE PP+LILPNN
Sbjct  240  EFEKVLRKKFAKKDEEYDSMLGVVRELPPELILPNN  275



>ref|XP_006466826.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|KDO70974.1| hypothetical protein CISIN_1g024153mg [Citrus sinensis]
Length=271

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLAGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPA+FLRKLTEEE+AFISQSA+NYSNL + HAAENAKS DE 
Sbjct  166  GALVRQNTKIPCGEVWGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRKK   +DE+ DS+LGVVRETP +LILP+N
Sbjct  226  EFEKLLRKKFARRDEEYDSMLGVVRETPAELILPDN  261



>ref|NP_001241093.1| uncharacterized protein LOC100805278 [Glycine max]
 gb|ACU23511.1| unknown [Glycine max]
 gb|KHN22241.1| Hypothetical protein glysoja_021997 [Glycine soja]
Length=273

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HA+EN+KS DE 
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHASENSKSYDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKYARKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_009371625.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=268

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVG+ ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGVAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA--PKAS  281
            EF+KVLRKK   +DE+ DS+LGV+RETP +  LP+NA  P+A+
Sbjct  226  EFQKVLRKKFARRDEEYDSMLGVIRETPAETTLPDNASPPRAA  268



>ref|XP_010061298.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW68229.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=273

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 8/164 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A 
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAG  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  287
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APK
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  269



>ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52598.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV+PTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVIPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVWGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTKIPAGEVWGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDN  261



>gb|KDP38522.1| hypothetical protein JCGZ_04447 [Jatropha curcas]
Length=272

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 147/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVFVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPAGEVWGGNPAKFLRKLTDEEIAFISQSAANYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLI-----LPNNAPKAS  281
            EFEK+LRKK   +DE+ DS+LGVVRETPP+LI     LPN AP A+
Sbjct  226  EFEKLLRKKFARRDEEYDSMLGVVRETPPELILPDKVLPNKAPLAA  271



>ref|XP_003523810.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Glycine 
max]
 gb|KHN45863.1| Hypothetical protein glysoja_023086 [Glycine soja]
Length=276

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE 
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52599.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 146/165 (88%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMG TLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGTTLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVWGGNPA+FLRKLT+EEIAFI QSA NYSNL Q HA ENAK  DE 
Sbjct  166  GALVRQNTKIPAGEVWGGNPARFLRKLTDEEIAFIMQSATNYSNLAQVHATENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>gb|AFK46651.1| unknown [Lotus japonicus]
Length=273

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT++P GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE 
Sbjct  166  GALVRQNTKVPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DED DS++GVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEDYDSMIGVVREIPPELILPDN  261



>ref|XP_002306878.1| transcription factor APFI family protein [Populus trichocarpa]
 gb|EEE93874.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 146/165 (88%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EE+AFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPTGEVWGGNPAKFLRKLTDEEVAFIAQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNNA-----PKA  284
            EFEKVLRK   KKDE+ DS+LGVVRE PP+LILP N      PKA
Sbjct  226  EFEKVLRKKFAKKDEEYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>gb|AFK48594.1| unknown [Lotus japonicus]
Length=273

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT++P GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE 
Sbjct  166  GALVRQNTKVPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DED DS++GVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEDYDSMIGVVREIPPELILPDN  261



>ref|XP_010931534.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=325

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AA
Sbjct  159  VHVAKSNISGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAA  218

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE 
Sbjct  219  GALVRQNTKIPCGEVWGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEI  278

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N     +PK S
Sbjct  279  EFEKVLRKKYARRDEEYDSMLGVVREVPPELILPDNILPDKSPKPS  324



>ref|XP_008786862.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQN +IPCGEVWGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE 
Sbjct  166  GSLVRQNAKIPCGEVWGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N     +PK S
Sbjct  226  EFEKVLRKKYARRDEEYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|NP_001275071.1| transcription factor APFI-like [Solanum tuberosum]
 gb|ABB86281.1| transcription factor APFI-like [Solanum tuberosum]
Length=268

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 5/162 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLT+EE+ ++     NYSNL Q HA ENAKS D  
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTQEELLYLGSQPANYSNLAQVHAGENAKSFDAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN--APKA  284
            EFEKVLRKK   KDE+ DS+LGVVRETPP+L+LP+N  APKA
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_008338249.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA--PKAS  281
            EFEK LRKK   +DE+ DS+LGV RETP ++ LP+N   PK++
Sbjct  226  EFEKALRKKFGRRDEEYDSMLGVTRETPAEITLPDNVLPPKSA  268



>gb|KEH36170.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  105  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E 
Sbjct  165  GALVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEI  224

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  225  EFEKVLRKKYATKDEEYDSMLGVVREIPPELILPDN  260



>ref|XP_009340721.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=268

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 5/163 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA--PKAS  281
            EFEK LRKK   +DE+ DS+LGV RETP ++ LP+N   PK++
Sbjct  226  EFEKALRKKFGRRDEEYDSMLGVTRETPAEITLPDNVLPPKSA  268



>ref|XP_009391607.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 145/166 (87%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVTVGH+AVLHGCTVEDE FVGMG+ LLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTVGHNAVLHGCTVEDETFVGMGSVLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIAFISQSATNYANLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETP-----PDLILPNNAPKAS  281
            EFEKVLRKK   +DE+ DS+LGVVRE P     PD ILPN +PK S
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREVPQELILPDNILPNKSPKPS  271



>ref|XP_006878532.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
 gb|ERM94677.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
Length=273

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPAKFLRKLTEEEIAFISQSA NY NL Q HAAENAK  +E 
Sbjct  166  GALVRQNTKIPCGEVWGGNPAKFLRKLTEEEIAFISQSATNYMNLAQVHAAENAKPFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE  DS+LG+VRE PP+L+LP+N
Sbjct  226  EFEKVLRKKFARKDEAYDSMLGIVREVPPELVLPDN  261



>ref|XP_011007461.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPTGEVWGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNNA-----PKA  284
            EFEKVLRK   KKDE+ DS+LGVVRE PP+LILP N      PKA
Sbjct  226  EFEKVLRKKFAKKDEEYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>ref|XP_007222873.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
 gb|EMJ24072.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
Length=272

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_008220827.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=272

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 146/164 (89%), Gaps = 8/164 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  287
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N     APK
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREIPPELILPDNVLPDKAPK  269



>gb|KDO84603.1| hypothetical protein CISIN_1g0242241mg, partial [Citrus sinensis]
Length=183

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE++ M+AA
Sbjct  19   VHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAA  78

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAKS DE 
Sbjct  79   GSLVRQNTRIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKSFDEI  138

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRETP ++I+P++
Sbjct  139  EFEKVLRKKFARRDEEYDSMLGVVRETPQEIIVPDS  174



>ref|XP_009590737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSN++G+VLPT IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+M+AA
Sbjct  106  IHVAKSNVSGRVLPTTIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNSMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQ TRIPCGEVWGGNPA+FLRKLTEEEI FISQSA+NYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQKTRIPCGEVWGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   K+E+ DS+LG VR+TPP+L+LP+N     APKAS
Sbjct  226  EFEKVLRKKFIRKEEEYDSMLGGVRDTPPELVLPDNALPDKAPKAS  271



>ref|XP_006383176.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
 gb|ERP60973.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
Length=271

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 147/166 (89%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NV+VGHSAVLHGCTVEDEAFVG GATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVSVGHSAVLHGCTVEDEAFVGTGATLLDGVCVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFISQSALNY+NL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVL KK   +DE+ +S+LGVVRETPP+LILPNN      PKA+
Sbjct  226  EFEKVLHKKFARRDEEYESMLGVVRETPPELILPNNMMPDKMPKAA  271



>ref|XP_004291863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY NL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYVNLAQVHAAENGKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREIPPELILPDN  261



>gb|AFK45344.1| unknown [Medicago truncatula]
 gb|KEH40168.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 145/162 (90%), Gaps = 4/162 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQN+RIP GEVW GNPAKFLR+LT EEI FISQSA+NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNSRIPSGEVWAGNPAKFLRELTAEEILFISQSAINYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA-PKAS  281
            EFEKVLRKK   KDE+ DS+LGVVRE PP+LILP+N  PK +
Sbjct  226  EFEKVLRKKFARKDEEYDSMLGVVREIPPELILPDNVLPKQT  267



>ref|XP_009365039.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNT+IP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GSLVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKALRKKFAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_009399949.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDG VVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGAVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EE+AFIS+SA NY+NL Q HAAEN KS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEVAFISESAANYANLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVREVPPELILPDN  261



>ref|XP_009386943.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHS VLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSVVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLTEEE+AFISQSA NY+NL Q HA ENAKS DE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTEEEVAFISQSATNYTNLAQVHAVENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVL KK   +DE+ DS+LGVVRE PP+LILP+N     +PK S
Sbjct  226  EFEKVLHKKFARRDEEYDSMLGVVREVPPELILPDNVLPDKSPKPS  271



>gb|AFK41197.1| unknown [Medicago truncatula]
Length=272

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+G VLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  105  VHVAKSNLSGMVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E 
Sbjct  165  GALVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEI  224

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  225  EFEKVLRKKYATKDEEYDSMLGVVREIPPELILPDN  260



>ref|XP_009336133.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVV+EK+AM+AA
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVIEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNT+IP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GSLVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKALRKKFAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_008788543.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAVLHGCTVEDE FVGMGA LLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDETFVGMGAVLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IPCGEVWGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ D+ 
Sbjct  166  GALVRQNTKIPCGEVWGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKAFDDI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK LRKK   +DED DS+LGVVRE PP+LILP+N
Sbjct  226  ELEKGLRKKYARRDEDYDSMLGVVREVPPELILPDN  261



>ref|XP_009799511.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=271

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSN++G+VLPT IG NVT+GHSAVLHGCTVEDEAF+G GAT+LDG VVEKN+M+AA
Sbjct  106  IHVAKSNISGRVLPTTIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDGAVVEKNSMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLTEEEI FISQSA+NYSNL Q HAAENAK LD+ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDDI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   K+E+ DS+LG VR+TPP+ +LP+N     APKAS
Sbjct  226  EFEKVLRKKFTRKEEEYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  271



>ref|XP_011074556.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVE+NAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVERNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY NL + HAAENAKS DE 
Sbjct  166  GALVRQNTRIPFGEVWAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGV RETPP+L+LP+N
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVHRETPPELVLPDN  261



>ref|XP_010113421.1| hypothetical protein L484_026755 [Morus notabilis]
 gb|EXC35448.1| hypothetical protein L484_026755 [Morus notabilis]
Length=271

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGH+AVLHGCTVEDEAFVGMGATLLDGV VE++AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHAAVLHGCTVEDEAFVGMGATLLDGVFVERHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEEIAFIS+SA+NY+NL   HAAEN+KS DE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPAKFLRKLTEEEIAFISESAVNYTNLALVHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ D +LGVVRETPP+LILP+N
Sbjct  226  EFEKVLRKKFAHRDEEYDLMLGVVRETPPELILPDN  261



>ref|XP_010538097.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=277

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++GKVLPTIIG+NVT+GHSAVLHGCT+EDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNISGKVLPTIIGDNVTIGHSAVLHGCTIEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT IP GEVWGGNPA+FLRKLT+EEIAFI QSA NYSNL Q HAAENAK  DE 
Sbjct  166  GALVRQNTIIPSGEVWGGNPARFLRKLTDEEIAFICQSATNYSNLAQVHAAENAKPFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDED DS+LG+VRETPP LILP+N
Sbjct  226  EFEKALRKKYARKDEDYDSMLGIVRETPPQLILPDN  261



>ref|XP_008388037.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=272

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNT+IP GEVW GNPAKFLRKLT+EEIAFI+QSA NY+NL Q HAAEN KS DE 
Sbjct  166  GSLVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFITQSATNYTNLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKALRKKFAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_006435021.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
 ref|XP_006473528.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR48261.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
Length=270

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE++ M+AA
Sbjct  106  VHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAKS DE 
Sbjct  166  GSLVRQNTRIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LGVVRETP ++I+P++
Sbjct  226  EFEKVLRKKFARRDEEYDSMLGVVRETPQEIIVPDS  261



>ref|XP_011083204.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=265

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 147/161 (91%), Gaps = 4/161 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLP +IG+NVTVGHSAVLHGCTVEDE+FVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPILIGDNVTVGHSAVLHGCTVEDESFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+EIAFISQSA+NY+NL Q HA+ENAK  D+ 
Sbjct  166  GALVRQNTRIPAGEVWGGNPARFLRKLTEDEIAFISQSAINYANLAQVHASENAKGFDKV  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EFEKVLRKK   +DE+ DS+LGVVR+TPP+L+  NN PKA+
Sbjct  226  EFEKVLRKKFASRDEEYDSMLGVVRQTPPELVHSNN-PKAA  265



>ref|XP_010523601.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=276

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++GKVLPTIIG+NVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNISGKVLPTIIGDNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP  EVWGGNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAENAKS +E 
Sbjct  166  GALVRQNTRIPSREVWGGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENAKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ D+++GVVRE PP LILP+N
Sbjct  226  EFEKALRKKYANKDEEYDAMIGVVREVPPQLILPDN  261



>ref|XP_009365536.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=272

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GK LPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKALPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVW GNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GSLVRQNTRIPSGEVWAGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKALRKKYAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_002890347.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66606.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  130  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  189

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  190  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNAI  249

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  250  EFEKVLRKKHAQKDEEYDSMLGIVRETPPELNLPNN  285



>ref|XP_011011740.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011741.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011742.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NV+VGHSAVLHGCTVED +FVG GATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVSVGHSAVLHGCTVEDASFVGPGATLLDGVCVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFISQSALNY+NL Q HAAENAK  DE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA-----PKAS  281
            EFEKVL KK   +DE+ DS+LG VRETPP+LILPNN      PKA+
Sbjct  226  EFEKVLCKKFARRDEEYDSMLGAVRETPPELILPNNMMPDKIPKAA  271



>gb|AAM61583.1| unknown [Arabidopsis thaliana]
Length=275

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNN  261



>dbj|BAD44607.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNN  261



>ref|NP_564091.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|Q9FWR5.1|GCA1_ARATH RecName: Full=Gamma carbonic anhydrase 1, mitochondrial; Short=AtCA1; 
Short=GAMMA CA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF98404.1|AC024609_5 Unknown protein [Arabidopsis thaliana]
 dbj|BAD44650.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01128.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29870.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=275

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNN  261



>ref|XP_004287879.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 6/164 (4%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLDGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLTE+E+AFISQSA+NY+NL Q HAAENAK LD  
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTEDEMAFISQSAINYANLAQVHAAENAKELDSV  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA---PKAS  281
            EFEKVLRKK   +DED D++  VVR+T P+  LP+N    PKA+
Sbjct  226  EFEKVLRKKFGRRDEDYDTMFEVVRQTSPEATLPDNVGPPPKAA  269



>gb|AAF79435.1|AC025808_17 F18O14.34 [Arabidopsis thaliana]
Length=298

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  129  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  188

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  189  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVI  248

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  249  EFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNN  284



>dbj|BAD43151.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   +DE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKKHALRDEEYDSMLGIVRETPPELNLPNN  261



>ref|XP_011083663.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GK LPTIIGNNVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLGGKELPTIIGNNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTR+P GEVW GNPAKFLRKLT+EEIAFISQSA NY NL + HAAENAKS +E 
Sbjct  166  GSLVRQNTRVPYGEVWAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRKK   +DE+ DS++GVVRETPP+LILP+N
Sbjct  226  EFEKMLRKKFARRDEEYDSMIGVVRETPPELILPDN  261



>ref|XP_008364986.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Malus 
domestica]
Length=272

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLNGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVW GNPAKFLR LT+EE +FISQSA NY+NL Q HAAEN KS DE 
Sbjct  166  GSLVRQNTRIPSGEVWAGNPAKFLRXLTDEEKSFISQSATNYTNLAQVHAAENVKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEK LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  EFEKALRKKYAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_009771198.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Nicotiana 
sylvestris]
Length=273

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++ KVLPTIIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE 
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRK   K+DE+ DS++GVVRETPP+L+LP+N
Sbjct  226  EFEKMLRKKYAKRDEEYDSMIGVVRETPPELVLPDN  261



>ref|XP_009612501.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++ KVLPTIIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE 
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRK   K+DE+ DS++GVVRETPP+L+LP+N
Sbjct  226  EFEKMLRKKYAKRDEEYDSMIGVVRETPPELVLPDN  261



>ref|XP_004232424.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=270

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 146/166 (88%), Gaps = 9/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSN++GKVLPTIIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AA
Sbjct  106  IHVAKSNISGKVLPTIIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GA VRQNTRIP GEVWGGNPA+FLRKLTEEEIAFIS+SA NYSNL Q HAAENAK LD+ 
Sbjct  166  GAHVRQNTRIPFGEVWGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   KDE+ DS+LG V ETPP+L+LP++     APKAS
Sbjct  226  EFEKVLRKKLARKDEEYDSMLG-VSETPPELVLPDSSLPDKAPKAS  270



>ref|XP_010679758.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N+ GKVLPTIIG+NVTVGHSA+LHGCTV+DEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNVAGKVLPTIIGDNVTVGHSAILHGCTVDDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP G+VWGGNPAKFLR LTEEEIAFI++SA NYSNL + HAAEN K  +E 
Sbjct  166  GALVRQNTRIPSGQVWGGNPAKFLRNLTEEEIAFIAESATNYSNLARVHAAENDKGFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS++G+VRETPP+LILP+N
Sbjct  226  EFEKVLRKKYARKDEEYDSMIGIVRETPPELILPDN  261



>ref|XP_006340643.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=270

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 146/166 (88%), Gaps = 9/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSN++GKVLPTIIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AA
Sbjct  106  IHVAKSNISGKVLPTIIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GA VRQNTRIP GEVWGGNPA+FLRKLTEEEIAFIS+SA NYSNL Q HAAENAK LD+ 
Sbjct  166  GAHVRQNTRIPFGEVWGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EFEKVLRKK   KDE+ DS+LG V ETPP+L+LP++     APKAS
Sbjct  226  EFEKVLRKKLARKDEEYDSMLG-VGETPPELVLPDSSLPDKAPKAS  270



>gb|EYU45182.1| hypothetical protein MIMGU_mgv1a011728mg [Erythranthe guttata]
Length=272

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+G VLPTIIGNNVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGNVLPTIIGNNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY NL + HAAEN KS DE 
Sbjct  166  GSLVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENTKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            + EK+LRKK   +DED +S++G+VRE PP+LILP+N
Sbjct  226  QLEKMLRKKFARRDEDYESMIGIVREIPPELILPDN  261



>ref|XP_003562574.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brachypodium 
distachyon]
Length=275

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 144/166 (87%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+KSN++GKVLPTIIGN VTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSKSNISGKVLPTIIGNKVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYFNLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP+N     APKA+
Sbjct  226  ELEKMLRKKFAHKDEEYDSMLGVVREIPPELILPDNILPDKAPKAA  271



>ref|XP_004238283.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Solanum 
lycopersicum]
Length=273

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++ KVLPTIIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALV+QNTRIP GEVW GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE 
Sbjct  166  GALVKQNTRIPSGEVWAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRK   K+DE+ DS++GVVRETPP+L+LP+N
Sbjct  226  EFEKMLRKKYAKRDEEYDSMIGVVRETPPELVLPDN  261



>emb|CDP07494.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 142/163 (87%), Gaps = 10/163 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDG V+EK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDEAFVGMGAALLDGAVLEKHAMVAA  165

Query  574  GALVRQNTRIPCGE-------VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAEN  416
            GALVRQN RIP G+       VWGGNPAKFLRKL++EEIAFISQSA NY NL Q HAAEN
Sbjct  166  GALVRQNMRIPSGQAIILIFRVWGGNPAKFLRKLSDEEIAFISQSATNYCNLAQVHAAEN  225

Query  415  AKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            AKS DE EFEKVLRKK   +DE+ DS+LGV+RETPP+L+LP+N
Sbjct  226  AKSFDEIEFEKVLRKKYSRRDEEYDSMLGVIRETPPELVLPDN  268



>gb|KCW68228.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=269

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 142/164 (87%), Gaps = 12/164 (7%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTV    VLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A 
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTV----VLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAG  161

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE 
Sbjct  162  GALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEI  221

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  287
            EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APK
Sbjct  222  EFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  265



>ref|XP_006341958.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Solanum 
tuberosum]
Length=273

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++ KVLPTIIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNISQKVLPTIIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE 
Sbjct  166  GSLVKQNTRIPSGEVWAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEI  225

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  296
            EFEK+LRK   K+DE+ DS++GVVRETPP+L+LP+N
Sbjct  226  EFEKMLRKKYAKRDEEYDSMIGVVRETPPELVLPDN  261



>ref|XP_009799510.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=284

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 21/179 (12%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLD------------  611
            +HVAKSN++G+VLPT IG NVT+GHSAVLHGCTVEDEAF+G GAT+LD            
Sbjct  106  IHVAKSNISGRVLPTTIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDXEAFIGTGATVL  165

Query  610  -GVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
             G VVEKN+M+AAGALVRQNTRIPCGEVWGGNPA+FLRKLTEEEI FISQSA+NYSNL Q
Sbjct  166  DGAVVEKNSMVAAGALVRQNTRIPCGEVWGGNPARFLRKLTEEEIMFISQSAMNYSNLAQ  225

Query  433  GHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
             HAAENAK LD+ EFEKVLRKK   K+E+ DS+LG VR+TPP+ +LP+N     APKAS
Sbjct  226  AHAAENAKKLDDIEFEKVLRKKFTRKEEEYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  284



>tpg|DAA63887.1| TPA: hypothetical protein ZEAMMB73_753225 [Zea mays]
Length=239

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  72   VHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  131

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE 
Sbjct  132  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEI  191

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP LILP+N
Sbjct  192  ELEKMLRKKYAHKDEEYDSMLGVVREIPPQLILPDN  227



>ref|NP_001066265.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|ABA95932.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29284.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|EAY82406.1| hypothetical protein OsI_37621 [Oryza sativa Indica Group]
 gb|EAZ19787.1| hypothetical protein OsJ_35366 [Oryza sativa Japonica Group]
 dbj|BAG96313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPTIIGNNVT+GHSAVLH CTVEDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVAKANISGKVLPTIIGNNVTIGHSAVLHACTVEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAEN+K+ DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  ELEKMLRKKYAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_006305517.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38415.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=230

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AA
Sbjct  61   VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAA  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HAAENAK L+  
Sbjct  121  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAI  180

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETP +L LPNN
Sbjct  181  EFEKVLRKKHAGKDEEYDSMLGIVRETPSELNLPNN  216



>ref|XP_002463275.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
 gb|EER99796.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
Length=273

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N +GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGV+VEK++M+ A
Sbjct  106  VHVAKANFSGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVLVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  ELEKMLRKKYAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|NP_001169012.1| uncharacterized protein LOC100382844 [Zea mays]
 gb|ACN31405.1| unknown [Zea mays]
Length=273

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP LILP+N
Sbjct  226  ELEKMLRKKYAHKDEEYDSMLGVVREIPPQLILPDN  261



>ref|XP_006305516.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38414.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=275

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETP +L LPNN
Sbjct  226  EFEKVLRKKHAGKDEEYDSMLGIVRETPSELNLPNN  261



>ref|XP_006663861.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Oryza 
brachyantha]
Length=273

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K+N++GKVLPTIIG+NVT+GHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSKANISGKVLPTIIGSNVTIGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEE+AFI+QSA+NY NL Q HAAENAK+ DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEMAFIAQSAMNYINLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  ELEKMLRKKFAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|NP_175159.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|Q9C6B3.1|GCA2_ARATH RecName: Full=Gamma carbonic anhydrase 2, mitochondrial; Short=AtCA2; 
Short=GAMMA CA2; AltName: Full=Transcription factor 
APFI; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52641.1|AC079677_5 unknown protein; 6976-8939 [Arabidopsis thaliana]
 gb|AAK76653.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44984.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32144.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
Length=278

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPT+IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVWGGNPAKF+RKLT+EEI +ISQSA NY NL Q HA+EN+KS ++ 
Sbjct  166  GSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIVYISQSAKNYINLAQIHASENSKSFEQI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+ RETPP+LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGITRETPPELILPDN  261



>emb|CDY47592.1| BnaC08g04620D [Brassica napus]
Length=276

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNLSGKVLPTTIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVR+NTRIP GEVWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS +E 
Sbjct  166  GSLVRENTRIPSGEVWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGIVRETPAELILPDN  261



>ref|XP_002455477.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
 gb|EES00597.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
Length=263

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EIAFI++SA NYS+L + HA ENAK L++ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEIAFIAESAANYSSLSKVHAIENAKPLEKI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVLRKK   +DE+ DS +GV RE PP+L  PN A
Sbjct  226  EFEKVLRKKFAHQDEEYDSSIGVTREAPPELTSPNPA  262



>gb|EMT05784.1| hypothetical protein F775_31542 [Aegilops tauschii]
Length=229

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 141/169 (83%), Gaps = 8/169 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  61   VHVAKTNISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEI FI+QSA NY NL   HA EN+KS DE 
Sbjct  121  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEITFIAQSAANYINLAHVHATENSKSFDEI  180

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS*AQ  272
            E EK LRKK   KDE+ DS+LGVVRE PP LILP+N     APKA+ A 
Sbjct  181  ELEKKLRKKFAHKDEEYDSMLGVVREIPPQLILPDNILPDKAPKAAVAH  229



>ref|XP_003567426.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=260

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  103  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEIAFI++SA NYSNL + HA ENAK L++ 
Sbjct  163  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKI  222

Query  394  EFEKVLRK---KKDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVLRK   ++DE+ DS+LGV RE  P+L  P+ A
Sbjct  223  EFEKVLRKRFARQDEEYDSMLGVTREAHPELTPPSPA  259



>ref|XP_004958498.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Setaria 
italica]
Length=273

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV++SN++ KVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSRSNISRKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAEN+KS DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP+N
Sbjct  226  ELEKMLRKKYAHKDEEYDSMLGVVREIPPELILPDN  261



>ref|XP_010500247.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
 ref|XP_010479124.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
Length=278

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPT+IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVWGGNPAKF+RKLT+EEI +ISQSA NY NL Q HA+EN+KS D+ 
Sbjct  166  GSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIEYISQSAKNYINLAQIHASENSKSFDQI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK LR+K   KDED DS+LG+ RE PP+LILP+N
Sbjct  226  EVEKALRRKYARKDEDYDSMLGITREIPPELILPDN  261



>ref|XP_003612060.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95018.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=270

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 141/165 (85%), Gaps = 7/165 (4%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+G+VLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGRVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKKLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EF KVL KK  + ++ DS+L  V +TPP++  P+N     APKAS
Sbjct  226  EFVKVLGKKFVRPDEVDSVLNAVGDTPPEITPPDNAALDKAPKAS  270



>ref|XP_009107430.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 2, mitochondrial-like 
[Brassica rapa]
Length=276

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL GKVLPT IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNLAGKVLPTTIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVR+NTRIP GEVWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS +E 
Sbjct  166  GSLVRENTRIPSGEVWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  EIERALRKKYARKDEDYDSMLGIVRETPAELILPDN  261



>emb|CDM82924.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 138/158 (87%), Gaps = 3/158 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  103  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEIAFI++SA NYSNL + HA ENAK L++ 
Sbjct  163  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKI  222

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNAP  290
            +FEKVLRKK   +D ++DS+L V RE PP+L  P+  P
Sbjct  223  DFEKVLRKKFAHQDNEHDSMLSVTREVPPELAPPSPTP  260



>gb|AFW79497.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=218

 Score =   246 bits (629),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AA
Sbjct  61   VHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAA  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIPCGEVWGGNPAKFLRKLT++EIAFI++SA NYSNL + HAAENAK L++ 
Sbjct  121  GSLVRQNTRIPCGEVWGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKI  180

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVLRKK   +DE+ DS +G+ R +PP+L  PN A
Sbjct  181  EFEKVLRKKFAHQDEEYDSSIGITRGSPPELTSPNPA  217



>gb|KFK44104.1| hypothetical protein AALP_AA1G216400 [Arabis alpina]
Length=275

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVT+GHSAVLHGCTVEDE  +GMGATLLDGVVVEK++++AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTIGHSAVLHGCTVEDETLIGMGATLLDGVVVEKHSIVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPA+FLRKL E+E  F S SA+ YSN+ Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPAGEIWGGNPARFLRKLKEKEFDFFSTSAITYSNIAQAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKKYGRKDEEYDSMLGIVRETPPELKLPNN  261



>ref|XP_008810436.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 143/166 (86%), Gaps = 8/166 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN++G+VL TIIG+NVTVGHSAVLHGCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNVSGRVLRTIIGDNVTVGHSAVLHGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP  EVWGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK  D+ 
Sbjct  166  GALVRQNTKIPGREVWGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKPFDDI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  281
            EF+KVL KK   +DE+ DS+LGV+ E PP+LILP++     +PK S
Sbjct  226  EFKKVLHKKFARRDEEYDSMLGVIHEVPPELILPDDVMPDKSPKPS  271



>ref|NP_001060439.1| Os07g0642900 [Oryza sativa Japonica Group]
 dbj|BAC16488.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAD30257.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAF22353.1| Os07g0642900 [Oryza sativa Japonica Group]
 gb|EAZ40840.1| hypothetical protein OsJ_25319 [Oryza sativa Japonica Group]
 dbj|BAG87352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K+N++GKVLPTIIGN+VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSKANISGKVLPTIIGNSVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEE+AFI+QSA NY NL Q HAAENAK+ DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEMAFIAQSATNYINLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGVVRE PP+LILP++
Sbjct  226  ELEKMLRKKFAHKDEEYDSMLGVVREIPPELILPDS  261



>ref|XP_008655471.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Zea 
mays]
 gb|AFW79496.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=263

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIPCGEVWGGNPAKFLRKLT++EIAFI++SA NYSNL + HAAENAK L++ 
Sbjct  166  GSLVRQNTRIPCGEVWGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVLRKK   +DE+ DS +G+ R +PP+L  PN A
Sbjct  226  EFEKVLRKKFAHQDEEYDSSIGITRGSPPELTSPNPA  262



>emb|CDY17034.1| BnaA08g03980D [Brassica napus]
Length=276

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 138/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL GKVLPT IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNLAGKVLPTTIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVR+NTRIP GEVWGGNPAKF+RKLT+EE+A+IS+SA NY NL   HAAEN+KS +E 
Sbjct  166  GSLVRENTRIPSGEVWGGNPAKFMRKLTDEEVAYISKSAENYINLAHIHAAENSKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRE P +LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGIVREIPAELILPDN  261



>ref|XP_006393603.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
 gb|ESQ30889.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
Length=276

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 138/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKV PTIIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNLSGKVQPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
             ALV++NTRIP GEVWGGNPAKF+RKLT+EEI +IS+SA NY NL   HAAEN+KS DE 
Sbjct  166  AALVKENTRIPSGEVWGGNPAKFMRKLTDEEIEYISKSAENYINLAHIHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGIVRETPAELILPDN  261



>ref|XP_009110271.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Brassica 
rapa]
Length=269

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 3/155 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AA
Sbjct  106  VHVAKSNLSGKVPPTIIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEIWGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPN  299
            EFEKVLRK+   KDE+ DS+LG+VRETPP+L LPN
Sbjct  226  EFEKVLRKRYAAKDEEYDSMLGIVRETPPELKLPN  260



>gb|AAK28403.1|AF249876_1 transcription factor APFI [Arabidopsis thaliana]
Length=278

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+ ++GKVLPT+IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTTISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVWGGNPAKF+R+LT+EEI +ISQSA NY NL Q HA+EN+KS ++ 
Sbjct  166  GSLVKQNTRIPSGEVWGGNPAKFMRELTDEEIVYISQSAKNYINLAQIHASENSKSFEQI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+ RETPP+LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGITRETPPELILPDN  261



>gb|EAZ04886.1| hypothetical protein OsI_27068 [Oryza sativa Indica Group]
Length=273

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 137/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K+N++GKVLPTIIGN VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  106  VHVSKANISGKVLPTIIGNRVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEE+ FI+QSA NY NL Q HAAENAK+ DE 
Sbjct  166  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEMTFIAQSATNYINLAQVHAAENAKTFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E EK+LRKK   KDE+ DS+LGV+RE PP+LILP+N
Sbjct  226  ELEKMLRKKFAHKDEEYDSMLGVIREIPPELILPDN  261



>gb|EYU31197.1| hypothetical protein MIMGU_mgv1a012119mg [Erythranthe guttata]
Length=261

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 5/160 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPT+IG+NVTVGHSA+LHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  105  VHVAKSNLYGKVLPTLIGDNVTVGHSAILHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKLT++EIAFI+QSA+NYS L Q HAAENAK L++ 
Sbjct  165  GALVRQNTRIPSGEIWGGNPAKFLRKLTDDEIAFIAQSAINYSKLAQAHAAENAKELEKI  224

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EFEKVL KK  +D + D  L VVRE  P+LI    AP AS
Sbjct  225  EFEKVLHKKLHQDAEYDLTLAVVREATPELI---KAPSAS  261



>emb|CDX96658.1| BnaA08g22010D [Brassica napus]
Length=269

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 3/155 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AA
Sbjct  106  VHVAKSNLSGKVPPTIIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEIWGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPN  299
            EFEKVLRK+   KDE+ DS+LG+VRETPP+L LPN
Sbjct  226  EFEKVLRKRYAAKDEEYDSMLGIVRETPPELKLPN  260



>ref|XP_003517218.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
Length=270

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 139/165 (84%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDET  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EF KVL KK   + E+  S+LG V+ETP +L +P+N      PKA
Sbjct  226  EFVKVLYKKFARRGEEYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>ref|XP_006644073.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Oryza 
brachyantha]
Length=263

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIPCGEVWGGNPAKFLRKLT+ EIAFI +SA NYS+L + HAAENAK +++ 
Sbjct  166  GSLVRQNTRIPCGEVWGGNPAKFLRKLTDSEIAFIKESASNYSSLAKAHAAENAKPVEKI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEK+LRKK   +DE++DS++G  RE PP+L  P+ A
Sbjct  226  EFEKLLRKKSAHQDEEHDSVIGATREVPPELAPPSPA  262



>emb|CDX83758.1| BnaC08g18870D [Brassica napus]
Length=269

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV  TIIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AA
Sbjct  106  VHVAKSNLSGKVPATIIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEIWGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            EFEKVLRK+   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  226  EFEKVLRKRYAAKDEEYDSMLGIVRETPPELKLPNN  261



>emb|CDY67628.1| BnaCnng55730D [Brassica napus]
Length=276

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 138/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL GKVLPT IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AA
Sbjct  106  VHVAKTNLGGKVLPTTIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V++NTRIP GEVWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE 
Sbjct  166  GSIVKENTRIPSGEVWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGIVRETPAELILPDN  261



>ref|XP_006304043.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
 gb|EOA36941.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
Length=306

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 139/156 (89%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPT+IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AA
Sbjct  134  VHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAA  193

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GEVWGGNPAKF+RKLT+EE+ +ISQSA NY NL Q HA+EN+KS D+ 
Sbjct  194  GSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEVEYISQSAKNYINLAQIHASENSKSFDQI  253

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+ RE P +LILP+N
Sbjct  254  EVERALRKKYARKDEDYDSMLGITREIPAELILPDN  289



>gb|KHN36089.1| Hypothetical protein glysoja_003212 [Glycine soja]
Length=270

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLL GV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLGGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDET  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EF KVL KK   + E+  S+LG V+ETP +L +P+N      PKA
Sbjct  226  EFVKVLYKKFARRGEEYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>ref|XP_010459631.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010459632.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Camelina sativa]
Length=269

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDL  311
            EFEKVLRKK   KDE+ DS+LG VRETP ++
Sbjct  226  EFEKVLRKKHAQKDEEYDSMLGSVRETPNNI  256



>ref|XP_004512067.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cicer 
arietinum]
Length=269

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 7/164 (4%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPA+FLRKL+E+E+ F SQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPCGEVWGGNPARFLRKLSEDEMTFFSQSALNYSNLAQAHAAENAKKLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EF KVL KK  + +++  I G V ETP ++ LP+N      PKA
Sbjct  226  EFVKVLGKKSVRLDEHGLIQGDVHETPQEINLPDNVVLDKVPKA  269



>gb|KFK36155.1| hypothetical protein AALP_AA4G085200 [Arabis alpina]
Length=276

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 136/156 (87%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+ K LPT IG+NVT+GHSAV+H CTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNLSNKSLPTTIGDNVTIGHSAVIHACTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+ NTRIP GEVWGGNPAKF+RKLT+EEI +IS+SA NY NL Q HAAEN KS +E 
Sbjct  166  GSLVKGNTRIPSGEVWGGNPAKFMRKLTDEEIDYISKSAENYINLAQIHAAENTKSFEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LGVVRETPP+LILP+N
Sbjct  226  EVERALRKKFANKDEDYDSMLGVVRETPPELILPDN  261



>gb|ACU23675.1| unknown [Glycine max]
Length=270

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 137/165 (83%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMG TLLDGV VEK+A +AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGVTLLDGVYVEKHATVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDET  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EF KVL KK   + E+  S+LG V+ETP +L +P+N      PKA
Sbjct  226  EFLKVLYKKFARRGEEYHSVLGGVQETPAELDVPDNVLLDKVPKA  270



>ref|XP_007156970.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
 gb|ESW28964.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
Length=270

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HA ENAK L+E 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHADENAKELEET  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKA  284
            EF KVL KK   + E+ DSILG  +ETP +L L +N     APKA
Sbjct  226  EFVKVLHKKFAPRGEEYDSILGGGQETPAELNLQDNVLLDKAPKA  270



>gb|EPS62312.1| hypothetical protein M569_12479, partial [Genlisea aurea]
Length=267

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 138/156 (88%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSN+ GK LPTIIGNNVTVGHSAV+HGCT++DEAF+GMGATLLDGV VEK++M+ A
Sbjct  106  VHVAKSNIGGKELPTIIGNNVTVGHSAVIHGCTIDDEAFIGMGATLLDGVTVEKHSMVGA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GE+W GNPAKFLRKLT+EEI+FISQSA+NY NL + HAAEN+KS +E 
Sbjct  166  GSLVRQNTRIPYGEIWAGNPAKFLRKLTDEEISFISQSAVNYINLAKVHAAENSKSNEEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            + EK LRKK   +DE+ DS++G++RETP +LILP+N
Sbjct  226  DLEKALRKKFARRDEEYDSMIGIIRETPQELILPDN  261



>gb|ABK26184.1| unknown [Picea sitchensis]
Length=273

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPTIIGN VT+GH AVLHGCTVEDEAFVGMGATLLDGVV+EKNAM+AA
Sbjct  106  VHVAKTNISGKVLPTIIGNKVTIGHGAVLHGCTVEDEAFVGMGATLLDGVVLEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQN RIP GEVW GNPAKFLRKLT+EEI FI QSALNY NL + HA ENAKS DE 
Sbjct  166  GSLVRQNARIPSGEVWAGNPAKFLRKLTDEEIEFILQSALNYQNLAEMHARENAKSYDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPN  299
            E  KVLRKK   + +D DS LGVVRE PP+L++P+
Sbjct  226  EAYKVLRKKLARQSDDYDSHLGVVREFPPELVVPD  260



>ref|XP_003537599.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
 gb|KHN41952.1| Hypothetical protein glysoja_003692 [Glycine soja]
Length=270

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 136/165 (82%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q H+AENAK LDE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDET  225

Query  394  EFEKVLRKKKDEDND---SILGVVRETPPDL-----ILPNNAPKA  284
            EF KVL KK     D   S+LG V+ETP +L     +L +  PKA
Sbjct  226  EFVKVLHKKFARHGDEYHSVLGGVQETPTELKSSDNVLLDKVPKA  270



>ref|XP_010498381.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT IP GEVWGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTTIPSGEVWGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDL  311
            EFEKVLRKK   KDE+ DS+LG VRETP ++
Sbjct  226  EFEKVLRKKHAQKDEEYDSMLGSVRETPNNI  256



>ref|XP_010477178.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
 ref|XP_010477179.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 3/151 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  LHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDL  311
            EFEKVLRKK   KDE+ DS+LG  RETP ++
Sbjct  226  EFEKVLRKKHAQKDEEYDSMLGSARETPNNI  256



>gb|ACU19296.1| unknown [Glycine max]
Length=270

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 136/165 (82%), Gaps = 8/165 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTE+E+ F SQSALNYSNL Q H+AENAK LDE 
Sbjct  166  GALVRQNTRIPYGEVWGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDET  225

Query  394  EFEKVLRKKKDEDND---SILGVVRETPPDL-----ILPNNAPKA  284
            EF KVL KK     D   S+LG V+ETP +L     +L +  PKA
Sbjct  226  EFVKVLHKKFVRHGDEYHSVLGGVQETPTELKFSDNVLLDKVPKA  270



>ref|NP_001042763.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAD82610.1| putative gamma-carbonic anhydrase [Oryza sativa Japonica Group]
 dbj|BAF04677.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAG96503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87611.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54348.1| hypothetical protein OsJ_01333 [Oryza sativa Japonica Group]
Length=263

 Score =   240 bits (612),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI FI +SA NYS L + HAAENAK +++ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKT  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEK+ RKK   +DE++DS++G  RE  P+L   ++A
Sbjct  226  EFEKLFRKKSAHQDEEHDSMIGATREVTPELTPSSSA  262



>ref|XP_009145039.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brassica 
rapa]
Length=276

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL GKV PT IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AA
Sbjct  106  VHVAKTNLGGKVSPTTIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V++NTRIP  EVWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE 
Sbjct  166  GSIVKENTRIPSREVWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  EVERALRKKYARKDEDYDSMLGIVRETPAELILPDN  261



>gb|EEC70424.1| hypothetical protein OsI_01428 [Oryza sativa Indica Group]
Length=263

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI FI +SA NYS L + HA ENAK +++ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHATENAKPVEKT  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEK+ RKK   +DE++DS++G  RE  P+L   ++A
Sbjct  226  EFEKLFRKKSAHQDEEHDSMIGATREVTPELTPSSSA  262



>ref|XP_004967660.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Setaria 
italica]
Length=263

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG NVTVGHSAVL GCT+EDEAFVGMGATLLDGV+VEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGENVTVGHSAVLQGCTIEDEAFVGMGATLLDGVIVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRKLT++EIAFI++SA NY +L + HAAENAK L++ 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKLTDDEIAFIAESAANYFSLSKEHAAENAKPLEKV  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVL KK   +DE+ DS +GV RE PP+L  P  A
Sbjct  226  EFEKVLPKKFAHQDEEYDSTIGVTREAPPELTPPTPA  262



>gb|KJB17751.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=229

 Score =   236 bits (603),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 126/142 (89%), Gaps = 3/142 (2%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            +I    V  GHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGE
Sbjct  78   SIWYGCVLRGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGE  137

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KD  362
            VWGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAEN KS DE EFEK+LRKK   +D
Sbjct  138  VWGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENGKSFDEIEFEKMLRKKFARRD  197

Query  361  EDNDSILGVVRETPPDLILPNN  296
            E+ DS+LGVVRETPP+LILP+N
Sbjct  198  EEYDSMLGVVRETPPELILPDN  219



>emb|CBI17490.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVA+S+L+GKVLPT IG+ VT+GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AM+AA
Sbjct  63   VHVARSSLSGKVLPTTIGDTVTIGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMVAA  122

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G LV Q+TRIPCGEVW GNPA+FLRKLTEEEIAFISQSA+NYSNL Q HA ENA S DE 
Sbjct  123  GVLVLQDTRIPCGEVWAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFDEI  182

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
             +EKVLRKK    + D  +++ V RETPP+LILP+N
Sbjct  183  AYEKVLRKKFAYPETDYAALVSVDRETPPELILPDN  218



>ref|XP_008672301.1| PREDICTED: uncharacterized protein LOC100217184 isoform X2 [Zea 
mays]
 tpg|DAA54234.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=214

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  58   IHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  117

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ 
Sbjct  118  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKI  177

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVL KK    ++ DS +GV    PP+L  PN A
Sbjct  178  EFEKVLGKKFAHQDEYDSSIGVAEGAPPELTSPNPA  213



>gb|ACG33606.1| transcription factor APFI [Zea mays]
Length=250

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  94   IHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  153

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ 
Sbjct  154  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKI  213

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVL KK    ++ DS +GV    PP+L  PN A
Sbjct  214  EFEKVLGKKFAHQDEYDSSIGVTEGAPPELTSPNPA  249



>ref|XP_008672300.1| PREDICTED: uncharacterized protein LOC100217184 isoform X1 [Zea 
mays]
 gb|ACN28454.1| unknown [Zea mays]
 tpg|DAA54232.1| TPA: transcription factor APFI [Zea mays]
Length=262

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  106  IHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKI  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVL KK    ++ DS +GV    PP+L  PN A
Sbjct  226  EFEKVLGKKFAHQDEYDSSIGVAEGAPPELTSPNPA  261



>emb|CDY23649.1| BnaA05g17800D [Brassica napus]
Length=277

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 4/157 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTV-GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIA  578
            VHVAK+NL GKV PT IG+NVTV GHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+A
Sbjct  106  VHVAKTNLGGKVSPTTIGDNVTVAGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVA  165

Query  577  AGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  398
            AG++V++NTRIP  EVWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE
Sbjct  166  AGSIVKENTRIPSREVWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDE  225

Query  397  NEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
             E E+ LRKK   KDED DS+LG+VRETP +LILP+N
Sbjct  226  IEVERALRKKYARKDEDYDSMLGIVRETPAELILPDN  262



>ref|XP_010679759.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=255

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 3/139 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAF+G GATLLDGV+VEK+ M+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFIGTGATLLDGVLVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIPCGEVW GNPAKFLR LTEEE+AFIS SA NYSNL Q HAAENAKS DE 
Sbjct  166  GSLVRQNTRIPCGEVWAGNPAKFLRNLTEEEMAFISLSASNYSNLAQVHAAENAKSFDET  225

Query  394  EFEKVLRKK---KDEDNDS  347
            EF+KVLRK+   KDE+ +S
Sbjct  226  EFQKVLRKRYTPKDEEYNS  244



>gb|ACG35255.1| transcription factor APFI [Zea mays]
Length=262

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTV HSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  106  IHVAKSNLSGKVFPTTIGNNVTVCHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ 
Sbjct  166  GALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKI  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNA  293
            EFEKVL KK    ++ DS +GV    PP+L  PN A
Sbjct  226  EFEKVLGKKFAHQDEYDSSIGVTEGAPPELTSPNPA  261



>dbj|BAB10927.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
Length=213

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  61   VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  121  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEA  180

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  181  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  213



>ref|XP_010444788.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Camelina 
sativa]
Length=258

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        D+ LP N PKA+
Sbjct  226  EFKKLLNKKNARDSEYDSVL-------DDITLPENVPKAA  258



>ref|NP_569036.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 sp|Q94AU7.1|GCA3_ARATH RecName: Full=Gamma carbonic anhydrase 3, mitochondrial; Short=AtCA3; 
Short=GAMMA CA3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76458.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAL85116.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAM64929.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
 gb|AED98222.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=258

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  106  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEA  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  226  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  258



>ref|XP_010484635.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  106  VHVAKSNLSGKVLPTIIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        D+ LP N PKA+
Sbjct  226  EFKKLLNKKNTRDSEYDSLL-------DDVTLPENVPKAA  258



>ref|NP_001078808.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 gb|AED98223.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=269

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  117  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  176

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  177  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEA  236

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  237  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|EPS71345.1| hypothetical protein M569_03414 [Genlisea aurea]
Length=249

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPT+IGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLTGKVLPTVIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GE+WGGNPAKFLRKLT +EIAFI +SA NY+NL + HAAENAK  D+ 
Sbjct  166  GALVRQNTRIPSGEIWGGNPAKFLRKLTADEIAFIPKSADNYANLARIHAAENAKDFDKA  225

Query  394  EFEKVLRKKKDEDNDS  347
            E EKVL+KK    +++
Sbjct  226  ELEKVLQKKFSRQDNT  241



>gb|AFK09616.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. gemmifera]
Length=269

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  117  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  176

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  177  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEA  236

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  237  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|AFK09615.1| gamma carbonic anhydrase 3 [Arabidopsis kamchatica]
 gb|AFK09617.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. halleri]
Length=269

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  117  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  176

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  177  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEA  236

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  237  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>ref|XP_002865062.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41321.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  117  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  176

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  177  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEA  236

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  237  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|AFK09618.1| gamma carbonic anhydrase 3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  116  VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  175

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  176  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEA  235

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  236  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  268



>gb|ACJ85087.1| unknown [Medicago truncatula]
Length=226

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  105  VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E 
Sbjct  165  GALVRQNTKIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEI  224

Query  394  EF  389
            EF
Sbjct  225  EF  226



>dbj|BAK01732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  103  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIPCGEVWGGNPAKFLRKLT+EEI FI +S+ NYSNL + HA E+AK +++ 
Sbjct  163  GALVRQNTRIPCGEVWGGNPAKFLRKLTDEEIGFIGESSANYSNLARAHAVESAKPMEKI  222

Query  394  EFEKVLRKK  368
            +FEKVLRKK
Sbjct  223  DFEKVLRKK  231



>ref|XP_006393845.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
 gb|ABB45859.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31131.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
Length=258

 Score =   220 bits (560),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+A+
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKQAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRK+TEEE AF S SA++YSNL Q HAAEN K+LDE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKVTEEERAFFSSSAVDYSNLAQVHAAENTKNLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            +F+K+L KK  +D + DS L        DL L  N PKA+
Sbjct  226  DFKKLLHKKNSRDAEYDSQLN-------DLALSENVPKAA  258



>ref|XP_010465384.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 128/160 (80%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLH CTVEDEA++G  AT+LDG  +EK+AM+A+
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHRCTVEDEAYIGTSATVLDGAHIEKHAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE 
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            EF+K+L KK  +D + DS+L        D+ LP N PKA+
Sbjct  226  EFKKLLNKKNTRDSEYDSVL-------DDITLPENVPKAA  258



>ref|XP_010550419.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Tarenaya 
hassleriana]
Length=265

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 124/159 (78%), Gaps = 10/159 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNLTGKVLPTIIG+NVT+GH AVLHGCT+EDEAF+G  ATLLDG  VEK+AM+A+
Sbjct  106  VHVAKSNLTGKVLPTIIGDNVTIGHGAVLHGCTIEDEAFIGTSATLLDGAYVEKHAMVAS  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRKLTEEE A IS+SAL+YSNL Q HAAE AK  +E 
Sbjct  166  GALVRQNTRIPSGEVWGGNPARFLRKLTEEETALISRSALDYSNLAQVHAAEFAKKYEEV  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNAPK  287
            EF KV+ KK    D + DS       TP +L  P N  K
Sbjct  226  EFMKVVNKKFAHPDGEYDS-------TPTELAPPENVVK  257



>gb|KHN45864.1| Hypothetical protein glysoja_023087, partial [Glycine soja]
Length=203

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 120/145 (83%), Gaps = 9/145 (6%)
 Frame = -3

Query  703  GNNVTVGHSAVLHGCTVEDEAFVGMGATLL-DGVVVEKNAMIAAGALVRQNTRIPCGEVW  527
            G NVTVGHSAVLHGCTVEDEAFVGMGA LL DGV+VEKNAM+A GALVRQNTRIP GEVW
Sbjct  60   GYNVTVGHSAVLHGCTVEDEAFVGMGAILLLDGVIVEKNAMVAVGALVRQNTRIPSGEVW  119

Query  526  GGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK----KDE  359
             GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE EFEKVL +K    KDE
Sbjct  120  AGNPAKFLRKLTDEEIAFISQSAANYTNLAQVHAAENSKSFDEIEFEKVLLRKKFARKDE  179

Query  358  DNDSILGVVRETPPDLILPNNAPKA  284
            + DS+L VV    PD +LP+ A KA
Sbjct  180  EYDSMLDVV----PDNVLPDKAEKA  200



>ref|XP_009103523.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Brassica 
rapa]
Length=253

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 123/158 (78%), Gaps = 9/158 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +
Sbjct  105  VHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVES  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+F+RK+TEEE AF S SA++YSNL Q H AEN K+LDE 
Sbjct  165  GALVRQNTRIPSGEVWGGNPARFMRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDET  224

Query  394  EFEKVLRKKKDEDNDSILGVVRETPPDLILPNNAPKAS  281
            +F+K+L KK   D +           DL L  N PK++
Sbjct  225  DFKKLLYKKNARDAEY---------DDLSLSENVPKSA  253



>emb|CDY45234.1| BnaA07g12560D [Brassica napus]
Length=253

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 123/158 (78%), Gaps = 9/158 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +
Sbjct  105  VHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVES  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNT+IP GEVWGGNPA+FLRK+TEEE AF S SA++YSNL Q H AEN K+LDE 
Sbjct  165  GALVRQNTKIPSGEVWGGNPARFLRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDET  224

Query  394  EFEKVLRKKKDEDNDSILGVVRETPPDLILPNNAPKAS  281
            +F+K+L KK   D +           DL L  N PK++
Sbjct  225  DFKKLLYKKNARDAEY---------DDLSLSENVPKSA  253



>dbj|BAB39954.1| OSJNBa0004B13.8 [Oryza sativa Japonica Group]
Length=257

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 126/157 (80%), Gaps = 9/157 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVFPTIIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GAL+         +VWGGNPAKFLRKLT++EI FI +SA NYS L + HAAENAK +++ 
Sbjct  166  GALLYWI------QVWGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKT  219

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  293
            EFEK+ RKK   +DE++DS++G  RE  P+L   ++A
Sbjct  220  EFEKLFRKKSAHQDEEHDSMIGATREVTPELTPSSSA  256



>gb|ADQ43216.1| GAMMA CA3/carbonate dehydratase [Schrenkiella parvula]
Length=255

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 128/160 (80%), Gaps = 10/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVT+ HSAVLHGCTVED+A++G  AT+LDG  VEK AM+A+
Sbjct  104  VHVAKSNLSGKVLPTVIGDNVTI-HSAVLHGCTVEDKAYIGASATVLDGAHVEKQAMVAS  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+F+RK+TE+E  F S SA++YSNL + H AENAK+LDE 
Sbjct  163  GALVRQNTRIPSGEVWGGNPARFMRKVTEDERTFFSSSAVDYSNLAKVHVAENAKNLDET  222

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            +F+K+L KK  +D + DS+L        DL L  N PKA+
Sbjct  223  DFKKLLYKKNARDAEYDSVLN-------DLNLSENVPKAA  255



>ref|XP_010649292.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Vitis 
vinifera]
Length=173

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = -3

Query  709  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  530
            +I N    GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AM+AAG LV Q+TRIPCGEV
Sbjct  23   MISNLNWTGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMVAAGVLVLQDTRIPCGEV  82

Query  529  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  359
            W GNPA+FLRKLTEEEIAFISQSA+NYSNL Q HA ENA S DE  +EKVLRKK    + 
Sbjct  83   WAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFDEIAYEKVLRKKFAYPET  142

Query  358  DNDSILGVVRETPPDLILPNN  296
            D  +++ V RETPP+LILP+N
Sbjct  143  DYAALVSVDRETPPELILPDN  163



>emb|CDY30772.1| BnaC07g16720D [Brassica napus]
Length=257

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 126/160 (79%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVT+GHSAVLHGCTV+D +++G  AT+LDG  VEK AM+ +
Sbjct  105  VHVAKSNLSGKVLPTLIGDNVTIGHSAVLHGCTVDDGSYIGASATVLDGAHVEKQAMVES  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA+FLRK+TEEE AF S SA++ SNL Q HA EN K+LDE 
Sbjct  165  GALVRQNTRIPSGEVWGGNPARFLRKVTEEEKAFFSSSAVDCSNLAQAHAGENTKNLDET  224

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            +F+K+L KK  +D + DS+L        DL L  + PK++
Sbjct  225  DFKKLLYKKNSRDAEYDSVL-------SDLSLSEHVPKSA  257



>gb|KFK28325.1| hypothetical protein AALP_AA8G501300 [Arabis alpina]
Length=257

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++   AT+LDG  VEK+AM+A 
Sbjct  103  IHVAKSNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYISASATVLDGAHVEKHAMVAP  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVRQNTRIP GEVWGGNPA FLRK+TEEE AF S SA++ S L Q HAAENAK+LDE 
Sbjct  163  GALVRQNTRIPSGEVWGGNPAGFLRKVTEEEKAFFSSSAVDNSKLAQAHAAENAKNLDET  222

Query  394  EFEKVLRKKKDEDND  350
            +F+K+L KK   D +
Sbjct  223  DFKKLLYKKNARDTE  237



>emb|CDY50984.1| BnaC02g48920D [Brassica napus]
Length=260

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 129/160 (81%), Gaps = 9/160 (6%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPT+IG+NVT+G+SAVLHGCT+EDE+++G  AT+LDG  VEK+A++ +
Sbjct  106  VHVAKSNLNGKVLPTLIGDNVTIGNSAVLHGCTLEDESYIGASATVLDGAHVEKHAIVES  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LVRQNTRIP GEVWGGNPA+FLRK+TEEE AF S SA++YSNL Q HAA+N K+LDE 
Sbjct  166  GSLVRQNTRIPSGEVWGGNPARFLRKVTEEERAFFSTSAMDYSNLAQVHAAQNTKNLDET  225

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILP-NNAPKA  284
            +F+K+L KK  +D + DS+L        DL L  N+ PKA
Sbjct  226  DFKKLLYKKNARDAEYDSLLN------DDLTLSENHLPKA  259



>gb|ACU22925.1| unknown [Glycine max]
Length=211

 Score =   199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTIIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
            GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL
Sbjct  166  GALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSATNYTNL  210



>ref|XP_002968991.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
 ref|XP_002990654.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ08286.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ30107.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
Length=266

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 121/160 (76%), Gaps = 2/160 (1%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVA++ ++GKV PTIIG+ VT+GH+AVLH CTV+DE+FVGMGATLLDGV VEK AM+ A
Sbjct  104  VHVARTGMSGKVAPTIIGDAVTIGHNAVLHACTVDDESFVGMGATLLDGVYVEKGAMVGA  163

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV QNTRIP GE+W GNPA+FLR LTEEE +FI++SA NYSNL   HA EN K  DE 
Sbjct  164  GSLVTQNTRIPSGEIWAGNPARFLRNLTEEETSFITKSAENYSNLAIVHAQENEKYSDEI  223

Query  394  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  281
            E +KVLRKK     + D+ LGV+R+ P  +     A K S
Sbjct  224  EEDKVLRKKWCYQLEEDNYLGVMRQAPFQMPFGVKAVKRS  263



>ref|XP_002894036.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70295.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 119/156 (76%), Gaps = 26/156 (17%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPT+IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G+LV+QNTRIP GE                       SA NY NL Q HA+EN+KS D+ 
Sbjct  166  GSLVKQNTRIPSGE-----------------------SAKNYINLAQIHASENSKSFDQI  202

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E E+ LRKK   KDED DS+LG+ RETPP+LILP+N
Sbjct  203  EVERALRKKYARKDEDYDSMLGITRETPPELILPDN  238



>emb|CDY55089.1| BnaA02g34770D [Brassica napus]
Length=258

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL GKVLPT+IG+NVT+ +SA+L GCT+EDE+++G  AT+LDG  VEK+A++ +
Sbjct  103  VHVAKSNLNGKVLPTLIGDNVTIRNSALLLGCTLEDESYIGASATVLDGAHVEKHAIVES  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALVR NTRIP GEVWGGNPA+FLRK+TEEE AF S SA++YSNL Q HAAEN ++LDE 
Sbjct  163  GALVRHNTRIPSGEVWGGNPARFLRKVTEEERAFFSTSAVDYSNLAQVHAAENTENLDET  222

Query  394  EFEKVLRKKKDEDNDSILGVVRETPPDLILP-NNAPKA  284
            +F K+L KKK  D +    ++ +   DL L  N+ PKA
Sbjct  223  DFNKLLYKKKARDAEYDSPLLND---DLTLSENHLPKA  257



>ref|XP_001776500.1| predicted protein [Physcomitrella patens]
 gb|EDQ58633.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++G V PT+IGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AA
Sbjct  106  VHVAKTNVSGNVEPTVIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V Q TR+P G++W G+PAKFLR+LT+EE + +S++A+ Y +L + HA+EN K+  E 
Sbjct  166  GSVVTQRTRVPSGQIWAGSPAKFLRELTDEERSSLSENAILYMDLAEVHASENRKTAGEI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPN  299
            E +K LR+K   + +D DS LG+VR   P++  PN
Sbjct  226  EADKALRRKWEIQSDDYDSHLGIVRSKRPEIHFPN  260



>ref|XP_006279533.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
 gb|EOA12431.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
Length=177

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 9/137 (7%)
 Frame = -3

Query  685  GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKF  506
            GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP GEVWGGNPAKF
Sbjct  48   GHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEVWGGNPAKF  107

Query  505  LRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDEDNDSILGVV  332
            LRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+ +L KK  +D + DS+L   
Sbjct  108  LRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDETEFKTLLNKKNARDTEYDSVL---  164

Query  331  RETPPDLILPNNAPKAS  281
                 DL LP N PKA+
Sbjct  165  ----DDLTLPENVPKAA  177



>ref|XP_010461522.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=132

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = -3

Query  631  MGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALN  452
            MGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEVWGGNPAKF+RKLT+EEI +ISQSA N
Sbjct  1    MGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIEYISQSAKN  60

Query  451  YSNLKQGHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            Y NL Q HA+EN+KS D+ E EK LR+K   KDED DS+LG+ RE PP+LILP+N
Sbjct  61   YINLAQIHASENSKSFDQIEVEKALRRKYARKDEDYDSMLGITREIPPELILPDN  115



>ref|XP_001758123.1| predicted protein [Physcomitrella patens]
 gb|EDQ76945.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            V+V K+N++  + PTIIGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AA
Sbjct  106  VNVPKTNVSSSIEPTIIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V + TR+P G++W G+PAKFLR LT EE + ++ +A  Y++L + HA EN K+  + 
Sbjct  166  GSVVAEKTRVPSGQIWAGSPAKFLRDLTAEERSSLTVNASIYTDLAEVHAFENRKTAGDI  225

Query  394  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  296
            E +K LR+K   + +D DS LG+VR   PD+  PNN
Sbjct  226  EADKALRRKWEIQSDDYDSHLGIVRSKKPDIAFPNN  261



>ref|XP_009149442.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 1, mitochondrial 
[Brassica rapa]
Length=191

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 115/156 (74%), Gaps = 12/156 (8%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKS L GKV PTIIG+NV +GHSA+LHGCTVEDEAF+ MGATLLDGVVVEK+ M+AA
Sbjct  31   VHVAKSYLIGKVPPTIIGDNVIIGHSALLHGCTVEDEAFIRMGATLLDGVVVEKHDMVAA  90

Query  574  GALVRQNTR--IPCGE-VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  404
            GA +   T   +P GE +WGGNP KFLRKL EE   F+ +SA NY NL + HAAENAK L
Sbjct  91   GACLFDKTLEFLPSGEKIWGGNPVKFLRKL-EETDXFLPKSAENYPNLAKAHAAENAKPL  149

Query  403  DENEFEKVLRKKKDEDNDSILGVVRETPPDLILPNN  296
            +  EFEK    +KDE+ D++L      PP+L L +N
Sbjct  150  NAIEFEK---GQKDEEYDAML-----XPPELKLSDN  177



>gb|ACV52585.1| transcription factor APFI-like protein, partial [Nicotiana benthamiana]
Length=152

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSN++G+V PT IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+M+AA
Sbjct  65   IHVAKSNISGRVSPTTIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNSMVAA  124

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLT  491
            GALVRQNTRIPCGEVWGGNPA+FLRKLT
Sbjct  125  GALVRQNTRIPCGEVWGGNPARFLRKLT  152



>ref|XP_002504597.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65855.1| predicted protein [Micromonas sp. RCC299]
Length=254

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 106/145 (73%), Gaps = 3/145 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAK+N+ G   PTIIG+ VTVGH+A+LH CTV+D+AFVGMGAT++DG VVE  AM+AA
Sbjct  103  IHVAKTNVGGVAAPTIIGDRVTVGHNAILHACTVKDDAFVGMGATVMDGAVVESGAMVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALV   T +P G++W G PAKF+R++T EE AF   SA  Y+ +   HAAEN KS +E 
Sbjct  163  GALVTPGTVVPTGQLWAGAPAKFMREMTAEEKAFTVTSAETYAEVGAVHAAENDKSFEEL  222

Query  394  EFEKVLR---KKKDEDNDSILGVVR  329
            E++K  R   +++D D DS LG+ R
Sbjct  223  EYDKAARRMARERDPDYDSHLGIER  247



>ref|XP_003059787.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=255

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N+ G  LPT+IG+ VTVGH+A++H CT++D+AF+GMGAT++DG  VE  AM+AA
Sbjct  103  VHVAKTNVGGVSLPTVIGDRVTVGHNAIIHACTIKDDAFIGMGATVMDGATVEAGAMVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALV   T +P G++W G PA+ +R++T EE AF   SA  Y+ + + HA E  K  +E 
Sbjct  163  GALVTPGTTVPSGQLWAGAPARMMREMTAEEKAFTKTSAETYAAVGEVHAEECGKGFEEI  222

Query  394  EFEKVLRK---KKDEDNDSILGVVR  329
            E +K  R+   ++D D DS LGV R
Sbjct  223  EHDKAARRMALERDPDYDSHLGVRR  247



>ref|XP_001754319.1| predicted protein [Physcomitrella patens]
 gb|EDQ80769.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            V V  S   G   P +IGN VT+GHSAV+H CTVEDEAFVGMGATL+DGVVVEK A +AA
Sbjct  104  VSVGGSRFGGGHAPAVIGNRVTIGHSAVIHACTVEDEAFVGMGATLMDGVVVEKGAFVAA  163

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  404
            G+LV +NTRIP G++W GNPAKFLR+L  +E +FI +S  NYS L   HA  N KS 
Sbjct  164  GSLVTENTRIPAGQIWAGNPAKFLRELKGDETSFIPKSTDNYSELAAAHAEANVKSF  220



>ref|XP_005847553.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
 gb|EFN55451.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
Length=261

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK N+ GK LPT IG+NVT+G  A +H  T+ED   VGMGA ++DG  VE  +++AA
Sbjct  103  VHVAKHNMAGKALPTQIGSNVTIGPGATIHAATIEDCVVVGMGAVIMDGAKVESKSVVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GALV   T IP G+VW G+PAKFLR L E+E+ F+S +A +YS L   HA ENAKS +E 
Sbjct  163  GALVPPGTVIPSGQVWAGSPAKFLRNLIEDEVQFVSAAADSYSQLALLHAEENAKSFEEV  222

Query  394  EFEKVLRK---KKDEDNDSILGVVRE  326
            E +K  R     +D D D   GV R+
Sbjct  223  EADKARRADRISRDPDYDEQQGVARD  248



>gb|EMT05904.1| hypothetical protein F775_31226 [Aegilops tauschii]
Length=108

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 14/117 (12%)
 Frame = -3

Query  631  MGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALN  452
            MGATLLDGVVVEK+ M+AAGALV           WGGNPAKFLRKLT+EEIAFI++SA N
Sbjct  1    MGATLLDGVVVEKHGMVAAGALV-----------WGGNPAKFLRKLTDEEIAFIAESAAN  49

Query  451  YSNLKQGHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNAP  290
            YSNL + HA ENAKSL++ +FEKVLRKK   +D+++DS+L V RE PP+L  P+  P
Sbjct  50   YSNLAKAHAVENAKSLEKIDFEKVLRKKFAHQDDEHDSMLSVTREVPPELAPPSPTP  106



>ref|XP_007204710.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05909.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=190

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEVWGGNP  515
            GALVRQNTRIPCGEV   +P
Sbjct  166  GALVRQNTRIPCGEVCQSSP  185



>ref|XP_007136607.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08601.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
Length=134

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  61   VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAA  120

Query  574  GALVRQNTRIPCGE  533
            GALVRQNTRIP GE
Sbjct  121  GALVRQNTRIPSGE  134



>ref|XP_007136608.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 ref|XP_007136613.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
 gb|ESW08602.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08607.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
Length=179

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  106  VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAA  165

Query  574  GALVRQNTRIPCGE  533
            GALVRQNTRIP GE
Sbjct  166  GALVRQNTRIPSGE  179



>gb|KJB12033.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=194

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPT IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEV  530
            GALVRQNTRIP GEV
Sbjct  166  GALVRQNTRIPAGEV  180



>ref|XP_005644680.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
 gb|EIE20136.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
Length=263

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 3/146 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVA+ N  GKV PT IGNNVTVGH A++H  TVED   VGMGAT+LDGV V+K +++AA
Sbjct  105  VHVARHNPQGKVAPTTIGNNVTVGHGAIIHAATVEDNVLVGMGATILDGVTVQKGSVVAA  164

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GA+V     +P GEVW GNPAK LRKL EEE  FI+Q+A +Y+ L   HAAEN K ++E 
Sbjct  165  GAVVTPGKTVPSGEVWAGNPAKMLRKLEEEEAGFIAQAANDYAALAAVHAAENGKGMEEI  224

Query  394  EFEKVLRK---KKDEDNDSILGVVRE  326
              +   R+   ++  D DS +GV R+
Sbjct  225  LLDNARREDRARRSLDYDSHMGVERD  250



>ref|XP_003612061.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95019.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=201

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+G+VLPTIIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AA
Sbjct  106  VHVAKSNLSGRVLPTIIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEV  530
            GALVRQNTRIPCGEV
Sbjct  166  GALVRQNTRIPCGEV  180



>ref|XP_001696746.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82949.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82950.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAS48197.1| mitochondrial NADH:ubiquinone oxidoreductase 32 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00854.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=312

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHV+K ++ G   PT+IGNNVT+GH+A +H CT+ED   VGMGAT+LDG  V+  +++AA
Sbjct  155  VHVSKYSMDGTARPTVIGNNVTIGHAATVHACTIEDNCLVGMGATVLDGATVKSGSIVAA  214

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            GA+V  NT IP G+VW G+PAKFLR L  EE +FI +SA  Y+ L   H  E +K+ +E 
Sbjct  215  GAVVPPNTTIPSGQVWAGSPAKFLRHLEPEEASFIGKSASCYAELSAIHKFEQSKTFEEQ  274

Query  394  EFEKVLRKKK  365
              E  + K +
Sbjct  275  YTESCIIKDR  284



>gb|AFK37757.1| unknown [Medicago truncatula]
Length=149

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  120

Query  574  GALVRQNTRIPCGEVWGGNPAKFL  503
            GALVRQN+RIP     G   +K L
Sbjct  121  GALVRQNSRIPSRRGLGRQSSKVL  144



>ref|NP_001137016.1| uncharacterized protein LOC100217184 [Zea mays]
 gb|ACF83081.1| unknown [Zea mays]
Length=222

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  106  IHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEV  530
            GALVRQNTRIPCGEV
Sbjct  166  GALVRQNTRIPCGEV  180



>tpg|DAA54233.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=222

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            +HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AA
Sbjct  106  IHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGEV  530
            GALVRQNTRIPCGEV
Sbjct  166  GALVRQNTRIPCGEV  180



>ref|XP_010463232.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=195

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK+N++GKVLPT+IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AA
Sbjct  106  VHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAA  165

Query  574  GALVRQNTRIPCGEV  530
            G+LV+QNTRIP GEV
Sbjct  166  GSLVKQNTRIPSGEV  180



>ref|NP_001185039.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AEE29871.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=220

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AA
Sbjct  106  VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAA  165

Query  574  GALVRQNTRIPCGE  533
            GALVRQNTRIP GE
Sbjct  166  GALVRQNTRIPSGE  179



>ref|WP_025898515.1| carbonic anhydrase [Sneathiella glossodoripedis]
Length=173

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -3

Query  715  PTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCG  536
            P +IG++V VGH+ ++HGCT+EDE+FVGMGAT+LDG VVE  AM+AAGAL+  N R+P G
Sbjct  74   PAVIGDDVLVGHNCIIHGCTLEDESFVGMGATVLDGAVVESGAMVAAGALLTPNKRVPTG  133

Query  535  EVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
            E+WGG+PAKFLRKL++EE+A ++  A +Y+ L Q
Sbjct  134  ELWGGSPAKFLRKLSDEEVANLTSGAKHYAELAQ  167



>ref|XP_002956125.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
 gb|EFJ42865.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
Length=313

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -3

Query  751  HVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAG  572
            HV+K +L G    T IGNNVT+GH A +H CT+ED   VGMGAT+LDG  V+K A++AAG
Sbjct  156  HVSKYSLDGDARTTTIGNNVTIGHGATVHACTIEDNCLVGMGATILDGATVKKGAIVAAG  215

Query  571  ALVRQNTRIPCG-EVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            A+V   T IP G +VW G+PAKFLR L  EE AFI++SA NYS L   H  E +K+ +E 
Sbjct  216  AVVPPKTVIPSGQQVWAGSPAKFLRNLEPEEEAFIARSAANYSELSAIHKFEQSKTFEEQ  275

Query  394  EFEKVLRKKK  365
              E  + + +
Sbjct  276  FVEMAIMRDR  285



>ref|XP_007136612.1| hypothetical protein PHAVU_009G0594001g, partial [Phaseolus vulgaris]
 gb|ESW08606.1| hypothetical protein PHAVU_009G0594001g, partial [Phaseolus vulgaris]
Length=94

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)
 Frame = -3

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KD  362
            VW GNPAKFLRKL+ EEI+FISQSA NY+NL Q HA+EN+KS DE EFEKVLRKK   KD
Sbjct  1    VWAGNPAKFLRKLSNEEISFISQSATNYTNLAQVHASENSKSYDEIEFEKVLRKKFARKD  60

Query  361  EDNDSILGVVRETPPDLILPNN  296
            E+ DS+LGVVRE PP+LILP+N
Sbjct  61   EEYDSMLGVVREIPPELILPDN  82



>ref|XP_007136610.1| hypothetical protein PHAVU_009G0592000g, partial [Phaseolus vulgaris]
 ref|XP_007136611.1| hypothetical protein PHAVU_009G0592000g, partial [Phaseolus vulgaris]
 gb|ESW08604.1| hypothetical protein PHAVU_009G0592000g, partial [Phaseolus vulgaris]
 gb|ESW08605.1| hypothetical protein PHAVU_009G0592000g, partial [Phaseolus vulgaris]
Length=94

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 3/82 (4%)
 Frame = -3

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KD  362
            VW GNPAKFLRKL+ EEI+FISQSA NY+NL Q HA+EN+KS DE EFEKVLRKK   KD
Sbjct  1    VWAGNPAKFLRKLSNEEISFISQSATNYTNLAQVHASENSKSYDEIEFEKVLRKKFARKD  60

Query  361  EDNDSILGVVRETPPDLILPNN  296
            E+ DS+LGVVRE PP+LILP+N
Sbjct  61   EEYDSMLGVVREIPPELILPDN  82



>gb|KHN22240.1| hypothetical protein glysoja_021996 [Glycine soja]
Length=131

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 11/128 (9%)
 Frame = -3

Query  658  TVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEI  479
             V+ +AFV   A+++ G+     + I  G ++R    I   +VW GNPAKFLRKL +E+ 
Sbjct  9    VVDKDAFVAPSASVI-GI----GSSIWYGYVLRD---ILSSKVWAGNPAKFLRKLADEQK  60

Query  478  AFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKK---DEDNDSILGVVRETPPDLI  308
            AFISQSA NY+NL Q HAAEN+K  DE +FEKVLRKK    DE+ DS+LGVVRE PP+L+
Sbjct  61   AFISQSATNYTNLAQVHAAENSKPFDEIDFEKVLRKKFARIDEEYDSMLGVVREIPPELM  120

Query  307  LPNNAPKA  284
            LP+ A KA
Sbjct  121  LPDKAEKA  128



>ref|WP_011384197.1| carbonic anhydrase [Magnetospirillum magneticum]
 dbj|BAE50596.1| Carbonic anhydrase/acetyltransferase [Magnetospirillum magneticum 
AMB-1]
Length=172

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++TG  L T IG+++T+GH A+LH CT+ED  FVGMGA +LDGVVVE  AM+AAGA+V  
Sbjct  67   HVTGGKLGTYIGSDITIGHGAILHACTLEDACFVGMGAVVLDGVVVESGAMVAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
              R+  GE+WGGNPAK LR+L++EEIAF   SA  Y  L
Sbjct  127  GKRVKAGELWGGNPAKLLRRLSDEEIAFFPVSAEKYVEL  165



>ref|XP_005649920.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25376.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
Length=219

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            V  +K+ L G    T IGN+VTVGHS +L   T+EDEA +GMGATLL+GV VEK A +AA
Sbjct  103  VRTSKAFLGGHAGATSIGNSVTVGHSVLLDTVTIEDEALIGMGATLLEGVKVEKGAQVAA  162

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENA  413
            GA+V   T IP GE+WGGNPAK LR L  EE AFIS+SA  Y+ L   H  E +
Sbjct  163  GAVVSPGTVIPSGELWGGNPAKLLRPLKPEEAAFISKSAQTYAELGAKHLKETS  216



>ref|WP_021132357.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum]
 gb|EPY01605.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum MGU-K5]
Length=174

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++T K   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AM+AAGA+V  
Sbjct  67   HVTRKTFGTFIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMVAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
              R+  GE+WGGNPA+ LR LTE++ A    SA NY+ L +
Sbjct  127  GKRVKSGELWGGNPARLLRPLTEQDRAHFPVSAANYTELAR  167



>ref|XP_005703463.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
 gb|EME26943.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
Length=280

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            T+IG+ V++GH A++HG  ++DE  VGMGA LL+G  + K+A++ +GA+V +   IP GE
Sbjct  126  TVIGSRVSIGHGAIIHGAHIQDECMVGMGAILLEGCKISKHAIVGSGAVVPRKAIIPTGE  185

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDE  359
            +W G+PA+F+RKL  EEI  I QSA +Y+NL   HA E +KSL+E E +K+ RK + E
Sbjct  186  LWAGSPARFVRKLLTEEIDAILQSAEDYTNLAAAHAVECSKSLEEIESDKIARKLRSE  243



>gb|EME71085.1| carbonic anhydrase/acetyltransferase [Magnetospirillum sp. SO-1]
Length=172

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++TG  L T IG+++T+GH A+LH CT+ED  FVGMGA +LDG VVE  AM+AAGA+V  
Sbjct  67   HVTGGKLGTYIGSDITIGHGAILHACTLEDACFVGMGAVVLDGAVVESGAMVAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
              R+  GE+WGGNPAK LR+L++EEIAF   SA  Y  L
Sbjct  127  GKRVKAGELWGGNPAKLLRRLSDEEIAFFPVSAEKYVEL  165



>ref|WP_040475708.1| carbonic anhydrase [Magnetospirillum sp. SO-1]
Length=176

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++TG  L T IG+++T+GH A+LH CT+ED  FVGMGA +LDG VVE  AM+AAGA+V  
Sbjct  71   HVTGGKLGTYIGSDITIGHGAILHACTLEDACFVGMGAVVLDGAVVESGAMVAAGAVVTP  130

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
              R+  GE+WGGNPAK LR+L++EEIAF   SA  Y  L
Sbjct  131  GKRVKAGELWGGNPAKLLRRLSDEEIAFFPVSAEKYVEL  169



>ref|WP_002727628.1| carbonic anhydrase [Phaeospirillum molischianum]
 emb|CCG40950.1| Protein yrdA [Phaeospirillum molischianum DSM 120]
Length=174

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++T +   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AMIAAGA+V  
Sbjct  67   HVTRRTFGTNIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMIAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAEN  416
              RI  GE+WGGNPA+ LR LTE++ A    SA NY+ L + H  +N
Sbjct  127  GKRIRTGELWGGNPARLLRPLTEQDRAHFPISAANYTELSR-HYRDN  172



>ref|XP_006581202.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Glycine max]
Length=100

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = -3

Query  535  EVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKK---  365
            +VW GNPAKFLRKL +E+ AFISQSA NY+NL Q HAAEN+K  DE +FEKVLRKK    
Sbjct  11   KVWAGNPAKFLRKLADEQKAFISQSATNYTNLAQVHAAENSKPFDEIDFEKVLRKKFARI  70

Query  364  DEDNDSILGVVRETPPDLILPNNAPKA  284
            DE+ DS+LGVVRE PP+LILP+ A KA
Sbjct  71   DEEYDSMLGVVREIPPELILPDKAEKA  97



>gb|AFK40628.1| unknown [Lotus japonicus]
Length=193

 Score =   105 bits (262),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  587
            VHVAKSNL GKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK  
Sbjct  106  VHVAKSNLGGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKKC  161


 Score = 54.7 bits (130),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  602  CREKCHDCCWCSCETEYKDSLWRGLGRKSCQVLKETH  492
              +KCH CCW  CETEYK S+WRG+GR+S +V ++ H
Sbjct  157  VEKKCHGCCWSPCETEYKGSIWRGMGRQSSKVPEKAH  193



>ref|WP_024080899.1| putative hexapeptide repeat acetyltransferase [Magnetospirillum 
gryphiswaldense]
 emb|CDK99943.1| putative hexapeptide repeat acetyltransferase [Magnetospirillum 
gryphiswaldense MSR-1 v2]
Length=175

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++TG  L T IG+++T+GH AVLH CT+ED  F+GMGA +LDG V+E  AM+AAGA+V  
Sbjct  67   HVTGGKLGTYIGSDITIGHGAVLHACTLEDGCFIGMGAVVLDGAVIESGAMVAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
              R+  GE+W GNPAK +R L E EIAF  +SA NY  L
Sbjct  127  GKRVAAGELWSGNPAKLMRPLKEAEIAFFPKSAANYRTL  165



>ref|XP_011398885.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
 gb|KFM25989.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
Length=237

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            T IG NVT+GH   +HG T+EDE  VGMGA L  G VV K AM+AAGA+V   T IP G+
Sbjct  125  TTIGANVTIGHQVSMHGVTLEDEVLVGMGAVLSHGTVVRKGAMVAAGAVVPPGTEIPAGQ  184

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLD  401
            +WGGNPA+FLR L + E +F+++SA +Y N+ + H  EN+ SL+
Sbjct  185  IWGGNPARFLRDLKDNESSFLAESAEHYVNVAKNHIKENSGSLE  228



>ref|WP_007091625.1| MULTISPECIES: carbonic anhydrase [Thalassospira]
 gb|KEO58829.1| carbonic anhydrase [Thalassospira permensis NBRC 106175]
 gb|AJD51718.1| carbonic anhydrase/acetyltransferase [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=177

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GHSAV+H CT+ED +FVGM AT++DG V+E+ AM+ A
Sbjct  63   VHVAKGKFG-----TYIGDDVTIGHSAVIHACTLEDRSFVGMSATVMDGCVIEQGAMLGA  117

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
            GAL+    RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q
Sbjct  118  GALLAPGKRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQ  164



>ref|WP_044828700.1| carbonic anhydrase [Thalassospira sp. HJ]
 gb|KJE35273.1| carbonic anhydrase [Thalassospira sp. HJ]
Length=175

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A
Sbjct  63   VHVAKGKFG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGA  117

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
             AL+    RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q    E  KS+ E+
Sbjct  118  NALLAPGKRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQ----EYVKSIPED  173



>ref|WP_041046278.1| carbonic anhydrase [Wolbachia endosymbiont of Cimex lectularius]
 dbj|BAP00364.1| hexapeptide transferase family protein [Wolbachia endosymbiont 
of Cimex lectularius]
Length=171

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            TIIGN VTVGH  +LH CTV D+AFVGMG+T++D  VVE  AM+AAG+LV     I  GE
Sbjct  75   TIIGNMVTVGHFCMLHACTVHDKAFVGMGSTVMDHAVVESEAMVAAGSLVTHGKVIKSGE  134

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
            VW G PAKFL+K+++EEI +I+QSA NY  L +
Sbjct  135  VWAGRPAKFLKKMSDEEIKYITQSAQNYVMLMR  167



>gb|EKF07893.1| carbonic anhydrase/acetyltransferase [Thalassospira profundimaris 
WP0211]
Length=175

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A
Sbjct  63   VHVAKGKFG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGA  117

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
             AL+    RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q    E  KS+ E+
Sbjct  118  NALLAPGKRIPAGELWAGVPARKVRNLTQEEIEFFKVSADRYADLAQ----EYVKSVPED  173



>gb|ETI49161.1| hypothetical protein F443_06919 [Phytophthora parasitica P1569]
 gb|ETK89052.1| hypothetical protein L915_06794 [Phytophthora parasitica]
 gb|ETL42459.1| hypothetical protein L916_06736 [Phytophthora parasitica]
 gb|ETL95631.1| hypothetical protein L917_06603 [Phytophthora parasitica]
 gb|ETM48826.1| hypothetical protein L914_06698 [Phytophthora parasitica]
 gb|ETO77896.1| hypothetical protein F444_06984 [Phytophthora parasitica P1976]
 gb|ETP18931.1| hypothetical protein F441_06922 [Phytophthora parasitica CJ01A1]
Length=251

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 15/150 (10%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK +   K +PT IG+NVTVG +A++H CT++D   +G GA +LDG VV   ++I A
Sbjct  101  VHVAKIH---KDIPTKIGSNVTVGPAAIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITA  157

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V +  ++P G++W G PA++LR LT EE  F+ Q +  Y+ L + HA E AK+ +E 
Sbjct  158  GSIVTKGKQVPSGQLWSGVPARYLRDLTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEY  217

Query  394  EFE----KVLR--------KKKDEDNDSIL  341
            E +    K+LR        +K DE  D+ L
Sbjct  218  EADTERYKILRDVGETGLPQKGDEREDTGL  247



>ref|XP_008903478.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETN10960.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETP46878.1| hypothetical protein F442_06954 [Phytophthora parasitica P10297]
Length=251

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 15/150 (10%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK +   K +PT IG+NVTVG +A++H CT++D   +G GA +LDG VV   ++I A
Sbjct  101  VHVAKIH---KDIPTKIGSNVTVGPAAIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITA  157

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V +  ++P G++W G PA++LR LT EE  F+ Q +  Y+ L + HA E AK+ +E 
Sbjct  158  GSIVTKGKQVPSGQLWSGVPARYLRDLTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEY  217

Query  394  EFE----KVLR--------KKKDEDNDSIL  341
            E +    K+LR        +K DE  D+ L
Sbjct  218  EADTERYKILRDVGETGLPQKGDEREDTGL  247



>ref|WP_040823796.1| carbonic anhydrase [Thalassospira profundimaris]
Length=184

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A
Sbjct  72   VHVAKGKFG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGA  126

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
             AL+    RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q    E  KS+ E+
Sbjct  127  NALLAPGKRIPAGELWAGVPARKVRNLTQEEIEFFKVSADRYADLAQ----EYVKSVPED  182



>ref|WP_033067257.1| carbonic anhydrase [Thalassospira australica]
Length=187

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 5/117 (4%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A
Sbjct  75   VHVAKGKFG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGA  129

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  404
             AL+    RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q +     K L
Sbjct  130  NALLAPGKRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQEYVQSIPKDL  186



>ref|XP_009821152.1| hypothetical protein H257_00264 [Aphanomyces astaci]
 gb|ETV88752.1| hypothetical protein H257_00264 [Aphanomyces astaci]
Length=249

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VH AK        PTIIGNNVT+G +A++H   + ++  +G GA +LDG VV +N+++ A
Sbjct  99   VHAAK---IANDFPTIIGNNVTIGPNAIIHAAKISNQCIIGTGAQVLDGAVVGENSIVTA  155

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V Q   +P G++W G PA+ +R LT EEI FI Q +L+Y  L + HA E AKS +E 
Sbjct  156  GSIVTQGKNVPAGQLWSGIPARAVRDLTSEEIEFIKQCSLDYVELSEAHAVEAAKSFEEI  215

Query  394  EFEKVLRKKKD  362
            E +K  RK  D
Sbjct  216  EADKEKRKILD  226



>ref|XP_009516211.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
 gb|EGZ28936.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
Length=251

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 87/131 (66%), Gaps = 7/131 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK +   + +PT IGNNVTVG +A++H CT++D   +G GA +LDG VV   +++ A
Sbjct  101  VHVAKIH---QDIPTKIGNNVTVGPNAIVHACTIQDHCIIGTGAQVLDGAVVGAKSIVTA  157

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V    ++P G++W G PA++LR LT EE+ F+ Q +  Y+ L + HA E AKS +E 
Sbjct  158  GSIVTMGKQVPSGQLWSGVPARYLRDLTAEEMQFMQQCSAEYTQLAEQHAEECAKSFEEY  217

Query  394  EFE----KVLR  374
            E +    K+LR
Sbjct  218  EADTERFKILR  228



>ref|WP_028794944.1| carbonic anhydrase [Thalassobaculum salexigens]
Length=173

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++T    PT+IG+ +T+GH A++H CT+ED++FVGMGAT++DG VV+++AM+AAGALV  
Sbjct  67   HITSDRFPTVIGSGITIGHGAIIHACTLEDDSFVGMGATVMDGAVVQRHAMVAAGALVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGH  428
               +P GE+W G+PAK +R LTE +   I +SA +Y  L + +
Sbjct  127  GKLVPTGELWAGSPAKKMRDLTEADFDQIHRSAEHYCELARSY  169



>ref|XP_002673591.1| gamma carbonic dehydratase [Naegleria gruberi]
 gb|EFC40847.1| gamma carbonic dehydratase [Naegleria gruberi]
Length=257

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  730  TGKV---LPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  560
            TGKV    PTIIGNNVTV   A+LH CT+EDE+++G GAT+LDG VV + AMIA GA+V 
Sbjct  110  TGKVGHEKPTIIGNNVTVESGAILHACTLEDESYIGFGATVLDGAVVGRGAMIAPGAVVT  169

Query  559  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  398
              T +P GE+W G PAK LR+LT EE   I +SA   S L Q H  E  K  +E
Sbjct  170  PGTIVPGGEIWAGVPAKKLRELTPEEQESIKKSAAELSELAQVHKQEQDKEFEE  223



>ref|WP_009867839.1| COG0663: Carbonic anhydrases/acetyltransferases, isoleucine patch 
superfamily [Magnetospirillum magnetotacticum]
 gb|KIL99545.1| carbonic anhydrase family 3 [Magnetospirillum magnetotacticum 
MS-1]
Length=172

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++TG  L T IG+++T+GH A+LH CT+ED  FVGMGA +LDG VVE   M+AAGA+V  
Sbjct  67   HVTGGKLGTYIGSDITIGHGAILHACTLEDGCFVGMGAVVLDGAVVETGGMVAAGAVVTP  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNL  440
              R+  GE+WGGNPA+ LR L++EE+AF   SA  Y+ L
Sbjct  127  GKRVKKGELWGGNPARMLRSLSDEEMAFFPVSAEKYAEL  165



>ref|XP_002997211.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69573.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=251

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 94/150 (63%), Gaps = 15/150 (10%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK +   K +PT IGNNVTVG +A++H CT++D   +G GA +LDG VV   ++I A
Sbjct  101  VHVAKIH---KDIPTKIGNNVTVGPAAIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITA  157

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V +  ++P G++W G PA++LR LT EE  F+ Q +  Y+ L + +A E AK+ +E 
Sbjct  158  GSIVTKGKQVPSGQLWSGVPARYLRDLTAEETQFMQQCSSEYAQLAEQYADECAKTFEEY  217

Query  394  EFE----KVLR--------KKKDEDNDSIL  341
            E +    K+LR        +K DE  D+ L
Sbjct  218  EADTERYKILRDVGETGLPQKGDEREDTGL  247



>ref|WP_012459916.1| acetyltransferase [Sulfurihydrogenibium sp. YO3AOP1]
 gb|ACD66853.1| conserved hypothetical protein [Sulfurihydrogenibium sp. YO3AOP1]
Length=174

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -3

Query  724  KVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRI  545
            K  PTIIGNNVTVGH  +LH CT+ED   +GM AT++DGV+V K +++AAGALV     I
Sbjct  70   KRYPTIIGNNVTVGHKVMLHACTIEDYCLIGMSATVMDGVIVGKYSIVAAGALVTPGKVI  129

Query  544  PCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  419
                +W G PAKF+RKLTEEEIA++ +SA NY   K  +  E
Sbjct  130  EPYSLWAGVPAKFVRKLTEEEIAWLEKSAENYVKYKNSYLEE  171



>ref|XP_008610617.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
 gb|EQC35855.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
Length=249

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = -3

Query  718  LPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPC  539
             PT+IGNNVT+G SAV+H C + ++  +G GA +LDG  V +N++I AG++V    ++P 
Sbjct  108  FPTVIGNNVTIGPSAVIHACKISNQCIIGTGAQVLDGAEVGENSIITAGSIVTMGKKVPA  167

Query  538  GEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKD  362
            G++W G PA+ +R LT +EI FI Q +L+Y  L + HA E AK+  + E EK  RK  D
Sbjct  168  GQLWSGIPARPVRDLTSDEIEFIKQCSLDYVQLSEVHAGETAKTFAQIELEKENRKIMD  226



>ref|WP_007547159.1| acetyltransferase [Sulfurihydrogenibium yellowstonense]
 gb|EEP60422.1| hexapeptide transferase family protein [Sulfurihydrogenibium 
yellowstonense SS-5]
Length=174

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -3

Query  724  KVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRI  545
            K  PTIIGNNVTVGH  +LH CT+ED   +GM AT++DGV+V K +++AAGALV     I
Sbjct  70   KRYPTIIGNNVTVGHKVMLHACTIEDYCLIGMSATVMDGVIVGKYSIVAAGALVTPGKVI  129

Query  544  PCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  419
                +W G PAKF+RKLTEEEIA++ +SA NY   K  +  E
Sbjct  130  EPYSLWAGVPAKFVRKLTEEEIAWLEKSAENYVKYKNSYLEE  171



>ref|WP_028791231.1| carbonic anhydrase [Thalassospira lucentensis]
Length=175

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VHVAK         T IG++VT+GH+A++H CT+ED +FVGMGAT++DG V+E+  M+ A
Sbjct  63   VHVAKGKFG-----TYIGDDVTIGHAAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGA  117

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  434
             AL+    RIP GE+W G PA+ +R+LT+EEI F   SA  Y++L Q
Sbjct  118  NALLAPGKRIPAGELWAGVPARKVRELTQEEIEFFKVSADRYADLAQ  164



>ref|XP_008862851.1| hypothetical protein H310_01513 [Aphanomyces invadans]
 gb|ETW09046.1| hypothetical protein H310_01513 [Aphanomyces invadans]
Length=249

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -3

Query  754  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  575
            VH AK        PTIIGNNVT+G  A++H   + ++  +G GA +LDG VV +N++I A
Sbjct  99   VHAAK---IANDFPTIIGNNVTIGPKAIIHAAKISNQCIIGTGAQVLDGAVVGENSIITA  155

Query  574  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  395
            G++V Q   +P G++W G PA+ +R LT EEI FI Q +L+Y  L + H+ E +KS +E 
Sbjct  156  GSIVTQGKSVPAGQLWSGIPARAVRDLTTEEIEFIKQCSLDYVELSEAHSVEASKSFEEI  215

Query  394  EFEKVLRKKKD  362
            E +K  RK  D
Sbjct  216  EADKEKRKILD  226



>ref|WP_008944647.1| carbonic anhydrase [Oceanibaculum indicum]
 gb|EKE75585.1| hexapeptide transferase family protein [Oceanibaculum indicum 
P24]
Length=177

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++ G+ L   +G+ VTVGH+A+LH CT+ D +FVGM A  +DG V+E NAM+AAGAL+  
Sbjct  69   HVQGRGLGCFVGDEVTVGHTAILHACTLHDRSFVGMQACAMDGSVIESNAMLAAGALLTP  128

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  419
              RIP G++W G PA++LR LTE +IA I+ SA  Y+   + H A 
Sbjct  129  GKRIPTGQLWAGRPARYLRDLTEADIAEIADSARRYAETAKAHHAS  174



>gb|KIY95938.1| transferase [Monoraphidium neglectum]
Length=283

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 7/140 (5%)
 Frame = -3

Query  754  VHVAKS-NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIA  578
            +HVA+    T     T+IG+NVTV H A++H  T+ D   VGMGATLLDGV +E  +++A
Sbjct  126  IHVARHVPSTAAPRATVIGSNVTVAHGALVHAATIGDGCLVGMGATLLDGVTLEPGSVVA  185

Query  577  AGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  398
            AGA+V     I  G++W G PAK LR ++ EE +F+ QSA NY+ L Q H  EN K  +E
Sbjct  186  AGAVVPPGAVIKTGQIWAGAPAKLLRTVSAEEASFLVQSADNYAKLAQAHKTENGKVFEE  245

Query  397  NEF------EKVLRKKKDED  356
                     E+  R+K D D
Sbjct  246  LVLDATIAGERAWREKTDSD  265



>ref|WP_029013145.1| carbonic anhydrase [Niveispirillum irakense]
Length=182

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            TIIG++VTVGH A+LHGC VED AF+GM A ++DGVVVE  AM+AAGALV    R+  GE
Sbjct  79   TIIGDHVTVGHMALLHGCVVEDNAFIGMKACVMDGVVVESGAMVAAGALVTPGKRVKAGE  138

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  419
            +WGG+PA+FLR LT+E+    ++   +Y+++ + + AE
Sbjct  139  LWGGSPARFLRPLTDEDRLMQTRITPSYADMAEIYLAE  176



>ref|WP_044578399.1| hypothetical protein [Rickettsiales bacterium Ac37b]
 gb|AIL65550.1| Gamma carbonic anhydrase-like protein [Rickettsiales bacterium 
Ac37b]
Length=180

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++T K  PT IG+ VTVGH  +LH CT++D AF+GMGAT++D  +VE NAM+AAG++V Q
Sbjct  70   HVTRKTGPTNIGSGVTVGHKCLLHACTIQDSAFIGMGATVIDRTIVETNAMVAAGSMVTQ  129

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  404
               I  GE+W GNPAKFLR L ++EI +   S  NYS     HA E  + L
Sbjct  130  GKVIKTGEIWAGNPAKFLRLLRQDEIDYFKVSEKNYSK----HAEEYIEIL  176



>ref|WP_014857207.1| acetyltransferase [Melioribacter roseus]
 gb|AFN75777.1| CysE/LacA/LpxA/NodL family acetyltransferase [Melioribacter roseus 
P3M-2]
Length=179

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = -3

Query  736  NLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQ  557
            ++T +  P II NNVTVGH+AVLHG  ++  +FVGMGA LLDG  +E ++M+AAG+LV+Q
Sbjct  67   HVTNRKFPLIIENNVTVGHAAVLHGAILKKNSFVGMGAILLDGATLEPDSMVAAGSLVKQ  126

Query  556  NTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENE  392
               +P G++  G PAK +R LT+EEI  I QSALNY+     +A  +A+SL  N+
Sbjct  127  GFVVPSGKLVAGVPAKIIRDLTDEEIETIRQSALNYAE----YARISAESLKNND  177



>ref|WP_028096230.1| carbonic anhydrase [Dongia sp. URHE0060]
Length=178

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            T IG++VTVGH A+LH CT+ED +FVGM A ++DGVVVE  AM+AAGALV    R+  GE
Sbjct  80   TTIGSDVTVGHMALLHACTLEDGSFVGMKACVMDGVVVESGAMVAAGALVTPGKRVKKGE  139

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGH  428
            +W G+PAK +R L E+EIA+ + SA +Y++L   +
Sbjct  140  LWAGSPAKLMRPLMEKEIAYFTYSAQHYADLAASY  174



>ref|WP_044564502.1| carbonic anhydrase [Azospirillum sp. B4]
Length=183

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -3

Query  712  TIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  533
            T+IG+NVTVGH A+LHGC +ED AF+GM A ++DG VVE  AM+AAGALV    R+  GE
Sbjct  84   TVIGDNVTVGHMALLHGCVIEDGAFIGMKACVMDGAVVEAGAMVAAGALVTPGKRVKAGE  143

Query  532  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  419
            +WGG+PA+ LR LTE++ A +  +A +Y  L + +  E
Sbjct  144  LWGGSPARLLRPLTEQDKATLPLTAPHYVRLSRQYLGE  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260