BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018B01

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB54835.1|  hypothetical protein B456_009G051100                    319   2e-104   Gossypium raimondii
emb|CDP16167.1|  unnamed protein product                                323   3e-104   Coffea canephora [robusta coffee]
ref|XP_009595011.1|  PREDICTED: eukaryotic translation initiation...    322   7e-104   Nicotiana tomentosiformis
ref|XP_007012063.1|  RNA polymerase I-associated factor PAF67 iso...    322   8e-104   
gb|KDP34205.1|  hypothetical protein JCGZ_07776                         319   1e-102   Jatropha curcas
gb|KJB54836.1|  hypothetical protein B456_009G051100                    318   2e-102   Gossypium raimondii
ref|XP_002516563.1|  conserved hypothetical protein                     318   2e-102   
ref|XP_011019644.1|  PREDICTED: eukaryotic translation initiation...    318   3e-102   Populus euphratica
gb|KCW81539.1|  hypothetical protein EUGRSUZ_C02897                     317   4e-102   Eucalyptus grandis [rose gum]
ref|XP_002308615.2|  hypothetical protein POPTR_0006s25800g             318   4e-102   Populus trichocarpa [western balsam poplar]
gb|KJB65717.1|  hypothetical protein B456_010G110200                    317   5e-102   Gossypium raimondii
ref|XP_010049085.1|  PREDICTED: eukaryotic translation initiation...    318   5e-102   Eucalyptus grandis [rose gum]
ref|XP_007012065.1|  RNA polymerase I-associated factor PAF67 iso...    317   6e-102   
gb|KFK27820.1|  hypothetical protein AALP_AA8G434000                    308   1e-101   Arabis alpina [alpine rockcress]
ref|XP_011081819.1|  PREDICTED: eukaryotic translation initiation...    316   2e-101   Sesamum indicum [beniseed]
gb|KFK27817.1|  hypothetical protein AALP_AA8G433700                    306   2e-101   Arabis alpina [alpine rockcress]
emb|CBI20884.3|  unnamed protein product                                311   3e-101   Vitis vinifera
gb|KHG17679.1|  Eukaryotic translation initiation factor 3 subunit L    315   3e-101   Gossypium arboreum [tree cotton]
ref|XP_011090287.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    315   5e-101   Sesamum indicum [beniseed]
gb|KHN10225.1|  Eukaryotic translation initiation factor 3 subunit L    310   5e-101   Glycine soja [wild soybean]
gb|EYU20458.1|  hypothetical protein MIMGU_mgv1a004619mg                315   6e-101   Erythranthe guttata [common monkey flower]
gb|AFK37130.1|  unknown                                                 303   9e-101   Medicago truncatula
gb|KHN18197.1|  Eukaryotic translation initiation factor 3 subunit L    308   3e-100   Glycine soja [wild soybean]
ref|XP_006394822.1|  hypothetical protein EUTSA_v10003996mg             312   8e-100   Eutrema salsugineum [saltwater cress]
ref|XP_011026651.1|  PREDICTED: eukaryotic translation initiation...    310   9e-100   Populus euphratica
ref|XP_007137185.1|  hypothetical protein PHAVU_009G106900g             311   2e-99    Phaseolus vulgaris [French bean]
ref|XP_002284115.1|  PREDICTED: eukaryotic translation initiation...    310   3e-99    Vitis vinifera
ref|XP_006394821.1|  hypothetical protein EUTSA_v10004012mg             310   3e-99    Eutrema salsugineum [saltwater cress]
ref|XP_002324243.1|  hypothetical protein POPTR_0018s00670g             310   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_006578214.1|  PREDICTED: eukaryotic translation initiation...    309   8e-99    Glycine max [soybeans]
ref|XP_003526476.1|  PREDICTED: eukaryotic translation initiation...    308   2e-98    Glycine max [soybeans]
emb|CDX80534.1|  BnaC07g29100D                                          307   5e-98    
ref|XP_003636390.1|  Eukaryotic translation initiation factor 3 s...    305   2e-97    
ref|XP_010100268.1|  hypothetical protein L484_007265                   306   3e-97    Morus notabilis
ref|XP_004501183.1|  PREDICTED: eukaryotic translation initiation...    305   4e-97    Cicer arietinum [garbanzo]
ref|XP_006366213.1|  PREDICTED: eukaryotic translation initiation...    305   4e-97    Solanum tuberosum [potatoes]
ref|XP_004245267.1|  PREDICTED: eukaryotic translation initiation...    304   6e-97    Solanum lycopersicum
ref|XP_006450640.1|  hypothetical protein CICLE_v10007989mg             304   8e-97    Citrus clementina [clementine]
ref|XP_008220046.1|  PREDICTED: eukaryotic translation initiation...    303   2e-96    Prunus mume [ume]
ref|XP_007222482.1|  hypothetical protein PRUPE_ppa004079mg             303   2e-96    Prunus persica
ref|XP_010519900.1|  PREDICTED: eukaryotic translation initiation...    303   3e-96    Tarenaya hassleriana [spider flower]
emb|CDX88194.1|  BnaA06g27850D                                          302   3e-96    
ref|XP_010668069.1|  PREDICTED: eukaryotic translation initiation...    302   4e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009151095.1|  PREDICTED: eukaryotic translation initiation...    302   4e-96    Brassica rapa
ref|XP_010249694.1|  PREDICTED: eukaryotic translation initiation...    301   8e-96    Nelumbo nucifera [Indian lotus]
gb|EPS61195.1|  hypothetical protein M569_13603                         300   1e-95    Genlisea aurea
ref|XP_008378102.1|  PREDICTED: eukaryotic translation initiation...    301   2e-95    
ref|XP_010421430.1|  PREDICTED: eukaryotic translation initiation...    299   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008466039.1|  PREDICTED: eukaryotic translation initiation...    299   8e-95    Cucumis melo [Oriental melon]
ref|XP_009367906.1|  PREDICTED: eukaryotic translation initiation...    299   8e-95    Pyrus x bretschneideri [bai li]
ref|NP_680222.1|  RNA polymerase I-associated factor PAF67              298   1e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93836.1|  hypothetical protein                                   298   1e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAN31908.1|  unknown protein                                         298   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885738.1|  hypothetical protein ARALYDRAFT_319240             297   2e-94    
ref|XP_004291198.1|  PREDICTED: eukaryotic translation initiation...    298   3e-94    Fragaria vesca subsp. vesca
ref|XP_010493831.1|  PREDICTED: eukaryotic translation initiation...    296   9e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002872179.1|  hypothetical protein ARALYDRAFT_489426             296   1e-93    
ref|XP_010254082.1|  PREDICTED: eukaryotic translation initiation...    291   7e-92    Nelumbo nucifera [Indian lotus]
ref|XP_006287441.1|  hypothetical protein CARUB_v10000647mg             287   4e-90    
ref|XP_008800463.1|  PREDICTED: eukaryotic translation initiation...    286   1e-89    Phoenix dactylifera
ref|XP_006833328.1|  hypothetical protein AMTR_s00109p00071210          282   2e-88    Amborella trichopoda
ref|XP_010925867.1|  PREDICTED: eukaryotic translation initiation...    281   8e-88    Elaeis guineensis
ref|XP_004136214.1|  PREDICTED: eukaryotic translation initiation...    280   2e-87    Cucumis sativus [cucumbers]
emb|CDY05341.1|  BnaC02g40490D                                          269   4e-87    
ref|XP_009419787.1|  PREDICTED: eukaryotic translation initiation...    279   4e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290036.1|  hypothetical protein CARUB_v10003670mg             278   2e-86    
ref|XP_009413816.1|  PREDICTED: eukaryotic translation initiation...    275   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010915834.1|  PREDICTED: eukaryotic translation initiation...    272   2e-84    Elaeis guineensis
ref|XP_004967411.1|  PREDICTED: eukaryotic translation initiation...    265   8e-82    Setaria italica
ref|NP_001145811.1|  uncharacterized protein LOC100279318               264   2e-81    Zea mays [maize]
gb|AFW80484.1|  hypothetical protein ZEAMMB73_715495                    264   2e-81    
ref|XP_002454893.1|  hypothetical protein SORBIDRAFT_03g000920          264   3e-81    Sorghum bicolor [broomcorn]
ref|NP_001054968.1|  Os05g0227700                                       263   5e-81    
gb|ACN33756.1|  unknown                                                 251   5e-81    Zea mays [maize]
ref|XP_008673489.1|  PREDICTED: eukaryotic translation initiation...    263   5e-81    
ref|XP_007012064.1|  RNA polymerase I-associated factor PAF67 iso...    262   7e-81    
ref|XP_006654164.1|  PREDICTED: eukaryotic translation initiation...    262   2e-80    Oryza brachyantha
gb|EEC78744.1|  hypothetical protein OsI_18958                          262   2e-80    Oryza sativa Indica Group [Indian rice]
gb|ADE77547.1|  unknown                                                 252   4e-80    Picea sitchensis
ref|XP_003565952.1|  PREDICTED: eukaryotic translation initiation...    260   7e-80    Brachypodium distachyon [annual false brome]
ref|XP_006643941.1|  PREDICTED: eukaryotic translation initiation...    260   1e-79    Oryza brachyantha
gb|EEC70234.1|  hypothetical protein OsI_01004                          259   2e-79    Oryza sativa Indica Group [Indian rice]
emb|CDM82375.1|  unnamed protein product                                259   2e-79    Triticum aestivum [Canadian hard winter wheat]
gb|EMS61673.1|  hypothetical protein TRIUR3_26846                       257   4e-79    Triticum urartu
ref|NP_001042483.1|  Os01g0229100                                       258   5e-79    
gb|AAT77307.1|  unknown protein                                         254   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EMT29163.1|  hypothetical protein F775_30790                         257   3e-77    
gb|KJB65718.1|  hypothetical protein B456_010G110200                    251   8e-77    Gossypium raimondii
ref|XP_001783486.1|  predicted protein                                  241   2e-72    
ref|XP_008357416.1|  PREDICTED: eukaryotic translation initiation...    239   7e-72    
ref|XP_001777172.1|  predicted protein                                  239   1e-71    
ref|XP_010925868.1|  PREDICTED: eukaryotic translation initiation...    230   1e-68    Elaeis guineensis
ref|XP_007012066.1|  RNA polymerase I-associated factor PAF67 iso...    197   4e-56    
ref|XP_002968842.1|  hypothetical protein SELMODRAFT_146079             198   5e-56    
ref|XP_010421431.1|  PREDICTED: eukaryotic translation initiation...    182   1e-54    Camelina sativa [gold-of-pleasure]
dbj|BAK07615.1|  predicted protein                                      190   3e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010445193.1|  PREDICTED: eukaryotic translation initiation...    177   5e-51    Camelina sativa [gold-of-pleasure]
ref|XP_010925869.1|  PREDICTED: eukaryotic translation initiation...    179   3e-49    
gb|EMS65810.1|  hypothetical protein TRIUR3_05807                       179   3e-48    Triticum urartu
gb|EMT31868.1|  hypothetical protein F775_04668                         171   5e-46    
ref|XP_002199566.2|  PREDICTED: eukaryotic translation initiation...    154   1e-42    
ref|XP_010072245.1|  PREDICTED: eukaryotic translation initiation...    154   1e-42    Pterocles gutturalis
gb|KFU97905.1|  Eukaryotic translation initiation factor 3 subunit L    154   1e-42    Pterocles gutturalis
gb|ABQ22705.1|  eukaryotic translation initiation factor 3 subuni...    152   5e-42    Callithrix jacchus [common marmoset]
gb|AAH11448.2|  EIF3L protein                                           152   1e-41    Homo sapiens [man]
ref|XP_002591162.1|  hypothetical protein BRAFLDRAFT_287258             159   2e-41    Branchiostoma floridae
gb|EPY88367.1|  eukaryotic translation initiation factor 3 subunit L    158   5e-41    Camelus ferus
ref|XP_007939846.1|  PREDICTED: eukaryotic translation initiation...    152   9e-41    Orycteropus afer afer
gb|AAX09926.1|  putative tyrosine-rich heat shock protein               150   1e-40    Aurelia aurita
dbj|BAG51322.1|  unnamed protein product                                151   2e-40    Homo sapiens [man]
ref|NP_001029306.1|  eukaryotic translation initiation factor 3 s...    153   3e-40    Rattus norvegicus [brown rat]
ref|NP_001279102.1|  eukaryotic translation initiation factor 3, ...    155   3e-40    Callorhinchus milii [Australian ghost shark]
dbj|BAC05310.1|  unnamed protein product                                151   3e-40    Homo sapiens [man]
ref|XP_004466265.1|  PREDICTED: eukaryotic translation initiation...    152   3e-40    Dasypus novemcinctus
gb|KFQ24519.1|  Eukaryotic translation initiation factor 3 subunit L    155   4e-40    Merops nubicus
ref|XP_008948320.1|  PREDICTED: eukaryotic translation initiation...    155   4e-40    Merops nubicus
emb|CDQ84343.1|  unnamed protein product                                155   4e-40    Oncorhynchus mykiss
ref|NP_001167411.1|  Eukaryotic translation initiation factor 3 s...    155   4e-40    Salmo salar
ref|XP_001630146.1|  predicted protein                                  154   5e-40    Nematostella vectensis
ref|NP_998293.1|  eukaryotic translation initiation factor 3 subu...    155   5e-40    Danio rerio [leopard danio]
ref|XP_006006932.1|  PREDICTED: eukaryotic translation initiation...    154   8e-40    
ref|XP_007238562.1|  PREDICTED: eukaryotic translation initiation...    154   9e-40    
ref|XP_005488658.1|  PREDICTED: eukaryotic translation initiation...    154   9e-40    
ref|NP_988980.1|  eukaryotic translation initiation factor 3 subu...    154   9e-40    Xenopus tropicalis [western clawed frog]
ref|XP_005039810.1|  PREDICTED: eukaryotic translation initiation...    154   9e-40    
ref|XP_005150418.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Melopsittacus undulatus
ref|XP_009566704.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Cuculus canorus
ref|XP_008118509.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    
gb|EOB03942.1|  Eukaryotic translation initiation factor 3 subuni...    154   1e-39    Anas platyrhynchos [duck]
ref|NP_001080345.1|  eukaryotic translation initiation factor 3 s...    154   1e-39    Xenopus laevis [clawed frog]
gb|KFP56635.1|  Eukaryotic translation initiation factor 3 subunit L    154   1e-39    Cariama cristata
gb|KFM02149.1|  Eukaryotic translation initiation factor 3 subunit L    154   1e-39    Aptenodytes forsteri
ref|XP_010409202.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Corvus cornix cornix
ref|XP_004610559.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    Sorex araneus [Eurasian shrew]
ref|XP_010154288.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Eurypyga helias
ref|XP_007069166.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    
ref|XP_009693369.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Cariama cristata
ref|XP_005016066.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    
ref|XP_009288372.1|  PREDICTED: eukaryotic translation initiation...    154   1e-39    Aptenodytes forsteri
gb|AFK10695.1|  Eukaryotic translation initiation factor 3 subunit L    154   1e-39    Callorhinchus milii [Australian ghost shark]
ref|XP_004589814.1|  PREDICTED: eukaryotic translation initiation...    152   1e-39    Ochotona princeps [southern American pika]
ref|XP_006026014.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    
ref|XP_010291773.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    Phaethon lepturus
ref|XP_009808556.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    Gavia stellata
ref|XP_010303092.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    Balearica regulorum gibbericeps
gb|KFQ20375.1|  Eukaryotic translation initiation factor 3 subunit L    153   1e-39    Mesitornis unicolor
ref|XP_005514772.1|  PREDICTED: eukaryotic translation initiation...    153   1e-39    Columba livia [carrier pigeon]
ref|XP_005421984.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    
gb|KFV68894.1|  Eukaryotic translation initiation factor 3 subunit L    153   2e-39    Picoides pubescens
gb|KFO81701.1|  Eukaryotic translation initiation factor 3 subunit L    153   2e-39    Cuculus canorus
ref|XP_008177541.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Chrysemys picta bellii
ref|XP_005067033.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    
ref|XP_009566703.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Cuculus canorus
ref|XP_010192463.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Mesitornis unicolor
ref|XP_010583751.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Haliaeetus leucocephalus
gb|KFV94330.1|  Eukaryotic translation initiation factor 3 subunit L    153   2e-39    Fulmarus glacialis
ref|NP_001012553.1|  eukaryotic translation initiation factor 3 s...    153   2e-39    Gallus gallus [bantam]
ref|XP_005039809.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Ficedula albicollis
ref|XP_002198918.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Taeniopygia guttata
ref|XP_006119038.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    
ref|XP_005150417.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Melopsittacus undulatus
ref|XP_004312203.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    
ref|XP_005322487.1|  PREDICTED: eukaryotic translation initiation...    151   2e-39    
ref|XP_008325793.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Cynoglossus semilaevis [half-smooth tongue sole]
emb|CAG04740.1|  unnamed protein product                                153   2e-39    Tetraodon nigroviridis
gb|KFO89757.1|  Eukaryotic translation initiation factor 3 subunit L    153   2e-39    Buceros rhinoceros silvestris
ref|XP_006026013.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Alligator sinensis
ref|XP_010134484.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Buceros rhinoceros silvestris
ref|XP_009580499.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Fulmarus glacialis
ref|XP_004610560.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Sorex araneus [Eurasian shrew]
gb|KFP10230.1|  Eukaryotic translation initiation factor 3 subunit L    152   2e-39    Egretta garzetta
ref|XP_008428313.1|  PREDICTED: eukaryotic translation initiation...    153   2e-39    Poecilia reticulata
ref|XP_007579317.1|  PREDICTED: eukaryotic translation initiation...    153   3e-39    Poecilia formosa
ref|XP_003963717.1|  PREDICTED: eukaryotic translation initiation...    153   3e-39    Takifugu rubripes [tiger puffer]
ref|XP_005806164.1|  PREDICTED: eukaryotic translation initiation...    153   3e-39    Xiphophorus maculatus
ref|NP_660121.2|  eukaryotic translation initiation factor 3 subu...    152   3e-39    Mus musculus [mouse]
dbj|BAE40238.1|  unnamed protein product                                152   3e-39    Mus musculus [mouse]
ref|XP_004077546.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Oryzias latipes [Japanese rice fish]
gb|EFB26726.1|  hypothetical protein PANDA_002501                       152   3e-39    Ailuropoda melanoleuca
ref|XP_008061490.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    
ref|XP_009045276.1|  hypothetical protein LOTGIDRAFT_110039             151   3e-39    Lottia gigantea
gb|EDL04675.1|  eukaryotic translation initiation factor 3, subun...    152   3e-39    Mus musculus [mouse]
ref|XP_003510323.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Cricetulus griseus [Chinese hamsters]
ref|XP_003932927.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Saimiri boliviensis boliviensis
ref|XP_003772387.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    
gb|EDM15826.1|  eukaryotic translation initiation factor 3, subun...    152   3e-39    Rattus norvegicus [brown rat]
ref|XP_009646036.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Egretta garzetta
ref|XP_006799034.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Neolamprologus brichardi [lyretail cichlid]
dbj|BAE39691.1|  unnamed protein product                                152   3e-39    Mus musculus [mouse]
emb|CAC84554.1|  67 kDa polymerase-associated factor PAF67              152   3e-39    Mus musculus [mouse]
ref|XP_004437899.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    
ref|XP_007519392.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Erinaceus europaeus [common hedgehog]
ref|XP_010737501.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Larimichthys crocea [croceine croaker]
ref|XP_004373902.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    
ref|XP_006174967.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    
ref|XP_005261682.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    
ref|XP_007974518.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    152   3e-39    Chlorocebus sabaeus
ref|XP_006207132.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    
ref|XP_006638823.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Lepisosteus oculatus
ref|XP_006890193.1|  PREDICTED: eukaryotic translation initiation...    151   3e-39    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008283532.1|  PREDICTED: eukaryotic translation initiation...    152   3e-39    Stegastes partitus
ref|XP_004675725.1|  PREDICTED: eukaryotic translation initiation...    151   4e-39    
ref|XP_002156786.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Hydra vulgaris
ref|XP_010897229.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Esox lucius
gb|KFV39542.1|  Eukaryotic translation initiation factor 3 subunit L    152   4e-39    Tyto alba [Schleiereule]
ref|XP_005927170.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Haplochromis burtoni
ref|XP_004559734.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Maylandia zebra
ref|XP_003441099.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Oreochromis niloticus
ref|XP_009964570.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Tyto alba [Schleiereule]
ref|XP_004410842.1|  PREDICTED: eukaryotic translation initiation...    151   4e-39    
ref|XP_005955682.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004437898.1|  PREDICTED: eukaryotic translation initiation...    152   4e-39    
ref|XP_004007032.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_005681119.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|NP_001229852.1|  eukaryotic translation initiation factor 3 s...    152   5e-39    Homo sapiens [man]
ref|XP_004700302.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005379288.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_004279516.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_003364345.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_005663841.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_005883276.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_004883511.1|  PREDICTED: eukaryotic translation initiation...    151   5e-39    
ref|XP_006890192.1|  PREDICTED: eukaryotic translation initiation...    151   5e-39    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008849507.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    
ref|XP_002743807.2|  PREDICTED: eukaryotic translation initiation...    152   5e-39    Callithrix jacchus [common marmoset]
ref|XP_003989299.1|  PREDICTED: eukaryotic translation initiation...    152   5e-39    Felis catus [cat]
ref|XP_006741022.1|  PREDICTED: eukaryotic translation initiation...    151   5e-39    Leptonychotes weddellii
ref|XP_004373901.1|  PREDICTED: eukaryotic translation initiation...    151   6e-39    
ref|XP_001514662.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    Ornithorhynchus anatinus [duck-billed platypus]
gb|KFW87339.1|  Eukaryotic translation initiation factor 3 subunit L    152   6e-39    Manacus vitellinus
ref|XP_004634660.1|  PREDICTED: eukaryotic translation initiation...    151   6e-39    
ref|XP_010843384.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    Bison bison bison
ref|XP_007519391.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    Erinaceus europaeus [common hedgehog]
ref|XP_003772386.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    Sarcophilus harrisii
ref|XP_008929890.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    
ref|XP_001365166.1|  PREDICTED: eukaryotic translation initiation...    152   6e-39    Monodelphis domestica
gb|KFW73179.1|  Eukaryotic translation initiation factor 3 subunit L    151   6e-39    Pygoscelis adeliae
dbj|BAD96216.1|  eukaryotic translation initiation factor 3 subun...    152   6e-39    Homo sapiens [man]
ref|XP_004065481.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    152   6e-39    
ref|XP_003804137.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    152   6e-39    
dbj|BAG60918.1|  unnamed protein product                                151   6e-39    Homo sapiens [man]
gb|KFQ49039.1|  Eukaryotic translation initiation factor 3 subunit L    151   7e-39    Pelecanus crispus
emb|CDQ66978.1|  unnamed protein product                                152   7e-39    Oncorhynchus mykiss
ref|XP_008142863.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Eptesicus fuscus
ref|XP_003905570.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Papio anubis [baboon]
ref|XP_005681118.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    
ref|XP_009491962.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Pelecanus crispus
ref|XP_003821622.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Pan paniscus [bonobo]
ref|XP_007165699.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Balaenoptera acutorostrata scammoni
emb|CAG30322.1|  dJ1014D13.1                                            151   8e-39    Homo sapiens [man]
ref|XP_010611532.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Fukomys damarensis [Damara mole rat]
ref|XP_005955681.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004634659.1|  PREDICTED: eukaryotic translation initiation...    151   8e-39    Octodon degus
ref|XP_006166301.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    
ref|XP_002723576.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004007031.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Ovis aries [domestic sheep]
ref|XP_004700301.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Echinops telfairi [lesser hedgehog tenrec]
gb|AAQ13507.1|AF109359_1  MSTP005                                       151   9e-39    Homo sapiens [man]
ref|NP_057175.1|  eukaryotic translation initiation factor 3 subu...    151   9e-39    Homo sapiens [man]
ref|NP_001128679.1|  eukaryotic translation initiation factor 3 s...    151   9e-39    Pan troglodytes
ref|XP_009880194.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Charadrius vociferus
ref|XP_004883512.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    
ref|NP_001238869.1|  eukaryotic translation initiation factor 3, ...    151   9e-39    Canis lupus familiaris [dogs]
ref|XP_006890191.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001030373.1|  eukaryotic translation initiation factor 3 s...    151   9e-39    Bos taurus [bovine]
ref|XP_005379287.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Chinchilla lanigera
ref|XP_004437897.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004373903.1|  PREDICTED: eukaryotic translation initiation...    151   9e-39    Trichechus manatus latirostris
ref|NP_001231015.1|  eukaryotic translation initiation factor 3 s...    151   1e-38    Sus scrofa [pigs]
ref|XP_005883277.1|  PREDICTED: eukaryotic translation initiation...    151   1e-38    Myotis brandtii
ref|XP_006757481.1|  PREDICTED: eukaryotic translation initiation...    151   1e-38    Myotis davidii
gb|ELK35000.1|  Eukaryotic translation initiation factor 3 subunit L    151   1e-38    Myotis davidii
ref|XP_004743258.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    151   1e-38    
ref|XP_006102473.1|  PREDICTED: eukaryotic translation initiation...    151   1e-38    
ref|XP_004786999.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    151   1e-38    
gb|KFV75696.1|  Eukaryotic translation initiation factor 3 subunit L    150   1e-38    Struthio camelus australis
ref|XP_008634828.1|  PREDICTED: eukaryotic translation initiation...    150   1e-38    
ref|XP_006102474.1|  PREDICTED: eukaryotic translation initiation...    150   1e-38    Myotis lucifugus
gb|EMP27035.1|  Eukaryotic translation initiation factor 3 subunit L    154   1e-38    Chelonia mydas [green seaturtle]
gb|ETE71168.1|  Eukaryotic translation initiation factor 3 subunit L    150   1e-38    
ref|XP_006865333.1|  PREDICTED: eukaryotic translation initiation...    150   1e-38    
ref|XP_007434464.1|  PREDICTED: eukaryotic translation initiation...    150   1e-38    
dbj|BAG63674.1|  unnamed protein product                                150   2e-38    
ref|XP_004650653.1|  PREDICTED: eukaryotic translation initiation...    150   2e-38    
ref|XP_009663621.1|  PREDICTED: eukaryotic translation initiation...    150   2e-38    
gb|EGV94329.1|  Eukaryotic translation initiation factor 3 subunit L    153   2e-38    
ref|XP_010781725.1|  PREDICTED: eukaryotic translation initiation...    150   2e-38    
gb|KFP94178.1|  Eukaryotic translation initiation factor 3 subunit L    149   3e-38    
ref|XP_009917022.1|  PREDICTED: eukaryotic translation initiation...    149   3e-38    
dbj|BAG51631.1|  unnamed protein product                                150   3e-38    
dbj|BAD96249.1|  eukaryotic translation initiation factor 3 subun...    149   5e-38    
gb|AEW30581.1|  eukaryotic translation initiation subunit 6-inter...    139   5e-38    
gb|EHH20219.1|  hypothetical protein EGK_03027                          149   6e-38    
ref|XP_010171584.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    149   7e-38    
gb|ELV11710.1|  Eukaryotic translation initiation factor 3 subunit L    152   7e-38    
ref|XP_003470528.1|  PREDICTED: eukaryotic translation initiation...    148   8e-38    
gb|KJB54834.1|  hypothetical protein B456_009G051100                    147   9e-38    
ref|XP_002736781.1|  PREDICTED: eukaryotic translation initiation...    148   9e-38    
ref|XP_009473560.1|  PREDICTED: eukaryotic translation initiation...    148   1e-37    
ref|XP_003470527.1|  PREDICTED: eukaryotic translation initiation...    148   1e-37    
ref|XP_010003703.1|  PREDICTED: eukaryotic translation initiation...    146   4e-37    
ref|XP_009330944.1|  PREDICTED: eukaryotic translation initiation...    146   5e-37    
ref|XP_006068075.1|  PREDICTED: eukaryotic translation initiation...    147   6e-37    
ref|XP_009074070.1|  PREDICTED: eukaryotic translation initiation...    145   1e-36    
gb|KFU83581.1|  Eukaryotic translation initiation factor 3 subunit L    144   2e-36    
gb|EHH65826.1|  hypothetical protein EGM_02673                          144   3e-36    
gb|ELT93773.1|  hypothetical protein CAPTEDRAFT_152273                  143   6e-36    
ref|XP_003727128.1|  PREDICTED: eukaryotic translation initiation...    142   9e-36    
ref|XP_795841.2|  PREDICTED: eukaryotic translation initiation fa...    142   9e-36    
ref|XP_005232975.1|  PREDICTED: eukaryotic translation initiation...    142   1e-35    
gb|KFR08886.1|  Eukaryotic translation initiation factor 3 subunit L    142   1e-35    
ref|XP_011444762.1|  PREDICTED: eukaryotic translation initiation...    142   1e-35    
ref|XP_010222472.1|  PREDICTED: eukaryotic translation initiation...    141   2e-35    
gb|KGL83796.1|  Eukaryotic translation initiation factor 3 subunit L    141   2e-35    
gb|ESA14939.1|  hypothetical protein GLOINDRAFT_24425                   141   3e-35    
ref|XP_010007524.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    141   3e-35    
ref|XP_010203293.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    140   8e-35    
gb|KFR13278.1|  Eukaryotic translation initiation factor 3 subunit L    140   8e-35    
ref|XP_010127677.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    139   1e-34    
ref|XP_009234283.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    135   2e-34    
gb|KFP91933.1|  Eukaryotic translation initiation factor 3 subunit L    138   2e-34    
ref|XP_007878016.1|  hypothetical protein PFL1_02313                    139   2e-34    
ref|XP_011387162.1|  hypothetical protein UMAG_01228                    139   3e-34    
ref|XP_009874065.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    138   4e-34    
ref|XP_005645053.1|  hypothetical protein COCSUDRAFT_54338              136   1e-33    
gb|KFP38786.1|  Eukaryotic translation initiation factor 3 subunit L    135   3e-33    
gb|KFQ45813.1|  Eukaryotic translation initiation factor 3 subunit L    135   4e-33    
gb|EST06180.1|  hypothetical protein PSEUBRA_SCAF3g03686                135   6e-33    
ref|XP_010497215.1|  PREDICTED: eukaryotic translation initiation...    125   9e-33    
dbj|GAK63125.1|  eukaryotic translation initiation factor 3 subun...    135   1e-32    
gb|ETS60939.1|  hypothetical protein PaG_04865                          135   1e-32    
dbj|GAC72556.1|  hypothetical protein PANT_7d00160                      135   1e-32    
gb|KFO95955.1|  Eukaryotic translation initiation factor 3 subunit L    134   1e-32    
ref|XP_008494724.1|  PREDICTED: eukaryotic translation initiation...    134   1e-32    
gb|KFM78528.1|  Eukaryotic translation initiation factor 3 subunit L    132   2e-32    
emb|CCF54420.1|  uncharacterized protein UHOR_01850                     134   3e-32    
ref|XP_009014305.1|  hypothetical protein HELRODRAFT_185444             132   4e-32    
ref|XP_002872243.1|  hypothetical protein ARALYDRAFT_910758             130   5e-32    
ref|XP_007680033.1|  hypothetical protein BAUCODRAFT_256397             131   7e-32    
dbj|GAC97023.1|  hypothetical protein PHSY_004607                       132   1e-31    
gb|EHJ64982.1|  putative eukaryotic translation initiation factor 3     131   1e-31    
ref|XP_003855782.1|  hypothetical protein MYCGRDRAFT_98959              130   1e-31    
gb|KFO61273.1|  Eukaryotic translation initiation factor 3 subunit L    130   2e-31    
ref|XP_009951253.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    130   2e-31    
emb|CDP16172.1|  unnamed protein product                                122   2e-31    
ref|XP_007920226.1|  hypothetical protein MYCFIDRAFT_61061              129   3e-31    
gb|EME41132.1|  hypothetical protein DOTSEDRAFT_73538                   129   4e-31    
ref|XP_009986435.1|  PREDICTED: eukaryotic translation initiation...    129   6e-31    
ref|XP_002509169.1|  predicted protein                                  129   7e-31    
dbj|BAM18026.1|  eukaryotic translation initiation factor 3 subun...    129   7e-31    
gb|EMF11371.1|  eukaryotic translation initiation factor 3              128   1e-30    
ref|XP_009936110.1|  PREDICTED: eukaryotic translation initiation...    128   1e-30    
emb|CBQ70634.1|  conserved hypothetical protein                         129   1e-30    
emb|CDI52166.1|  related to eIF3l-translation initiation factor 3...    128   3e-30    
ref|XP_007872226.1|  hypothetical protein PNEG_00353                    126   3e-30    
ref|XP_005706478.1|  hypothetical protein Gasu_27420                    127   3e-30    
ref|XP_004932950.1|  PREDICTED: eukaryotic translation initiation...    127   3e-30    
ref|XP_004344304.2|  eukaryotic translation initiation factor 3         127   4e-30    
gb|ADO33009.1|  eukaryotic translation initiation factor 3 subunit L    126   5e-30    
gb|KEQ92836.1|  hypothetical protein AUEXF2481DRAFT_42518               125   6e-30    
ref|XP_003279655.1|  PREDICTED: eukaryotic translation initiation...    123   6e-30    
dbj|GAM88006.1|  hypothetical protein ANO11243_060350                   125   7e-30    
gb|KFX92587.1|  hypothetical protein O988_07202                         125   8e-30    
dbj|GAN05046.1|  eukaryotic translation initiation factor 3 subun...    125   8e-30    
gb|KFY82208.1|  hypothetical protein V500_10728                         125   8e-30    
gb|KFY07526.1|  hypothetical protein V492_07060                         125   9e-30    
gb|KFY69858.1|  hypothetical protein V499_09677                         125   9e-30    
gb|KFY35000.1|  hypothetical protein V494_06290                         125   9e-30    
gb|EPB85480.1|  hypothetical protein HMPREF1544_07753                   125   9e-30    
gb|KFY63943.1|  hypothetical protein V496_03571                         125   9e-30    
gb|KFY20729.1|  hypothetical protein V491_03471                         125   1e-29    
gb|KFX94770.1|  hypothetical protein V490_04175                         125   1e-29    
emb|CEP10774.1|  hypothetical protein                                   125   1e-29    
ref|XP_007291620.1|  eukaryotic translation initiation factor 3 s...    125   1e-29    
ref|XP_003284860.1|  hypothetical protein DICPUDRAFT_53222              125   1e-29    
gb|KFV19153.1|  Eukaryotic translation initiation factor 3 subunit L    125   2e-29    
gb|KFY22828.1|  hypothetical protein V493_06308                         124   2e-29    
ref|XP_645331.1|  proteasome component region PCI  domain-contain...    125   2e-29    
gb|KFQ12757.1|  Eukaryotic translation initiation factor 3 subunit L    124   2e-29    
ref|XP_003843462.1|  hypothetical protein LEMA_P075720.1                124   2e-29    
gb|EYE90457.1|  putative eukaryotic translation initiation factor...    124   2e-29    
ref|XP_007279258.1|  eukaryotic translation initiation factor 3         120   3e-29    
ref|XP_005718965.1|  Translation initiation factor eIF3, subunit L      124   3e-29    
ref|XP_007703272.1|  hypothetical protein COCSADRAFT_174231             123   3e-29    
gb|EKG20022.1|  Translation initiation factor 3 complex subunit L       123   4e-29    
ref|XP_007708597.1|  hypothetical protein COCCADRAFT_86411              123   4e-29    
gb|EMD89131.1|  hypothetical protein COCHEDRAFT_1141011                 123   4e-29    
ref|XP_007686344.1|  hypothetical protein COCMIDRAFT_90888              123   4e-29    
gb|EAW60197.1|  eukaryotic translation initiation factor 3, subun...    118   4e-29    
ref|XP_002120603.1|  PREDICTED: eukaryotic translation initiation...    124   4e-29    
gb|ELR06680.1|  eukaryotic translation initiation factor 3 subunit L    123   5e-29    
ref|XP_008029742.1|  hypothetical protein SETTUDRAFT_165127             123   5e-29    
ref|XP_001938656.1|  eukaryotic translation initiation factor 3         123   5e-29    
gb|EHK98365.1|  putative Eukaryotic translation initiation factor...    123   5e-29    
gb|KIW08461.1|  eukaryotic translation initiation factor 3 subunit L    123   5e-29    
ref|XP_008082870.1|  hypothetical protein GLAREA_12916                  123   6e-29    
gb|KEQ65958.1|  eukaryotic translation initiation factor 3              122   7e-29    
ref|XP_001598481.1|  conserved hypothetical protein                     122   8e-29    
ref|XP_001649423.1|  AAEL014715-PA                                      122   1e-28    
ref|XP_002835919.1|  hypothetical protein                               122   1e-28    
ref|XP_005101846.1|  PREDICTED: eukaryotic translation initiation...    123   1e-28    
gb|KIV89639.1|  eukaryotic translation initiation factor 3 subunit L    122   1e-28    
ref|XP_007832322.1|  Eukaryotic translation initiation factor 3 s...    122   1e-28    
gb|KEQ69898.1|  eukaryotic translation initiation factor 3              122   1e-28    
ref|XP_005101845.1|  PREDICTED: eukaryotic translation initiation...    122   1e-28    
ref|XP_008597732.1|  RNA polymerase I-associated factor PAF67           122   1e-28    
ref|XP_003385511.1|  PREDICTED: eukaryotic translation initiation...    122   1e-28    
ref|XP_001851152.1|  eukaryotic translation initiation factor 3         122   2e-28    
ref|XP_002021092.1|  GL25016                                            122   2e-28    
ref|XP_007600225.1|  eukaryotic translation initiation factor 3 s...    121   2e-28    
ref|XP_001353350.1|  GA19025                                            122   2e-28    
sp|A6S1A3.2|EIF3L_BOTFB  RecName: Full=Eukaryotic translation ini...    121   2e-28    
ref|XP_001555077.1|  conserved hypothetical protein                     121   2e-28    
ref|XP_007780643.1|  eukaryotic translation initiation factor 3 s...    121   2e-28    
ref|XP_971137.1|  PREDICTED: eukaryotic translation initiation fa...    122   2e-28    
gb|KIN06222.1|  hypothetical protein OIDMADRAFT_38558                   121   2e-28    
ref|XP_011318509.1|  hypothetical protein FGSG_02571                    121   2e-28    
ref|XP_009260082.1|  hypothetical protein FPSE_08689                    121   2e-28    
ref|XP_007585666.1|  putative eukaryotic translation initiation f...    121   2e-28    
ref|XP_004519066.1|  PREDICTED: eukaryotic translation initiation...    121   3e-28    
ref|XP_009235099.1|  PREDICTED: eukaryotic translation initiation...    117   3e-28    
gb|EWG49661.1|  eukaryotic translation initiation factor 3 subunit L    120   3e-28    
ref|NP_648553.1|  CG5642                                                121   3e-28    
ref|XP_011204641.1|  PREDICTED: eukaryotic translation initiation...    121   3e-28    
gb|KEQ88950.1|  eukaryotic translation initiation factor 3              120   3e-28    
gb|KDB15394.1|  Eukaryotic translation initiation factor 3 subunit L    120   3e-28    
emb|CEI96427.1|  Putative Eukaryotic translation initiation facto...    120   3e-28    
gb|EIE77654.1|  hypothetical protein RO3G_02358                         121   4e-28    
ref|XP_003351553.1|  hypothetical protein SMAC_00095                    120   4e-28    
ref|XP_011189020.1|  PREDICTED: eukaryotic translation initiation...    121   4e-28    
ref|XP_962883.1|  eukaryotic translation initiation factor 3            120   4e-28    
gb|EFQ25128.1|  RNA polymerase I-associated factor PAF67                120   4e-28    
gb|KFH42502.1|  Eukaryotic translation initiation factor 3 subuni...    120   4e-28    
ref|XP_008714500.1|  eukaryotic translation initiation factor 3 s...    120   5e-28    
gb|KDN67009.1|  putative RNA polymerase I-associated factor PAF67       120   5e-28    
emb|CEG65880.1|  Putative Eukaryotic translation initiation facto...    120   5e-28    
gb|EPQ62037.1|  hypothetical protein BGT96224_5125                      120   5e-28    
emb|CCF47479.1|  eukaryotic translation initiation factor 3 subun...    120   5e-28    
gb|ENH86296.1|  eukaryotic translation initiation factor 3              120   5e-28    
gb|ACN94772.1|  GA19025                                                 120   5e-28    
emb|CCU77373.1|  putative eukaryotic translation initiation facto...    120   6e-28    
gb|EIE89576.1|  hypothetical protein RO3G_14287                         120   6e-28    
ref|XP_010611524.1|  PREDICTED: eukaryotic translation initiation...    120   6e-28    
ref|XP_003071841.1|  eukaryotic translation initiation factor 3 s...    120   7e-28    
gb|EGU80471.1|  hypothetical protein FOXB_09028                         119   8e-28    
gb|EWG49660.1|  eukaryotic translation initiation factor 3 subunit L    119   8e-28    
gb|KID75056.1|  Eukaryotic translation initiation factor 3 subunit L    119   8e-28    
gb|ENH66105.1|  Eukaryotic translation initiation factor 3 subunit L    119   8e-28    
gb|EMT70751.1|  Eukaryotic translation initiation factor 3 subunit L    119   8e-28    
ref|XP_002046733.1|  GJ13043                                            120   8e-28    
ref|XP_002542082.1|  eukaryotic translation initiation factor 3 s...    119   8e-28    
ref|XP_002030238.1|  GM24677                                            120   9e-28    
ref|XP_001972502.1|  GG13851                                            120   9e-28    
ref|XP_002007366.1|  GI12903                                            120   9e-28    
ref|XP_002094551.1|  GE20146                                            120   9e-28    
ref|XP_001956027.1|  GF25000                                            120   9e-28    
ref|XP_006965519.1|  predicted protein                                  119   1e-27    
ref|XP_001244912.1|  conserved hypothetical protein                     119   1e-27    
ref|XP_003045254.1|  predicted protein                                  119   1e-27    
gb|EHK48640.1|  hypothetical protein TRIATDRAFT_298054                  119   1e-27    
ref|XP_009501133.1|  PREDICTED: eukaryotic translation initiation...    119   1e-27    
gb|EQB53298.1|  hypothetical protein CGLO_06989                         119   2e-27    
dbj|GAD93767.1|  eukaryotic translation initiation factor 3 subun...    119   2e-27    
ref|XP_007825091.1|  eukaryotic translation initiation factor 3 s...    119   2e-27    
gb|KID87409.1|  Eukaryotic translation initiation factor 3 subunit L    119   2e-27    
ref|XP_001983909.1|  GH15308                                            119   2e-27    
gb|EHK17622.1|  hypothetical protein TRIVIDRAFT_88697                   119   2e-27    
ref|XP_001260520.1|  eukaryotic translation initiation factor 3 s...    119   2e-27    
ref|XP_755371.1|  eukaryotic translation initiation factor 3 subu...    119   2e-27    
gb|KIW48528.1|  eukaryotic translation initiation factor 3 subunit L    118   2e-27    
ref|XP_002065918.1|  GK20774                                            119   2e-27    
ref|XP_007799459.1|  putative eukaryotic translation initiation f...    118   2e-27    
ref|XP_009217071.1|  eukaryotic translation initiation factor 3         118   2e-27    
gb|KIL95907.1|  eukaryotic translation initiation factor 3 subunit l    118   2e-27    
emb|CCE32492.1|  probable eukaryotic translation initiation facto...    118   2e-27    
gb|KEF59810.1|  eukaryotic translation initiation factor 3 subunit L    118   3e-27    
gb|KEZ45356.1|  Eukaryotic translation initiation factor 3 subunit L    118   3e-27    
ref|XP_003712824.1|  eukaryotic translation initiation factor 3         118   3e-27    
ref|XP_011295894.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    119   3e-27    
ref|XP_001275337.1|  eukaryotic translation initiation factor 3 s...    118   3e-27    
gb|KFA65369.1|  hypothetical protein S40285_00521                       118   3e-27    
ref|XP_007810476.1|  Eukaryotic translation initiation factor 3 s...    118   3e-27    
gb|KEY69043.1|  hypothetical protein S7711_03341                        118   3e-27    
gb|KFH65880.1|  hypothetical protein MVEG_07983                         118   3e-27    
gb|ERT01224.1|  eukaryotic translation initiation factor 3 subunit L    118   3e-27    
gb|KIW55719.1|  eukaryotic translation initiation factor 3 subunit L    117   4e-27    
gb|KEY81461.1|  eukaryotic translation initiation factor 3 subuni...    117   4e-27    
emb|CEJ82676.1|  Putative Eukaryotic translation initiation facto...    117   4e-27    
ref|XP_011147809.1|  PREDICTED: eukaryotic translation initiation...    118   4e-27    
ref|XP_006693151.1|  eukaryotic translation initiation factor 3 s...    117   5e-27    
ref|XP_010497216.1|  PREDICTED: eukaryotic translation initiation...    110   5e-27    
ref|XP_006677453.1|  hypothetical protein BATDEDRAFT_34692              118   5e-27    
gb|EFX02282.1|  eukaryotic translation initiation factor 3 subunit      117   5e-27    
ref|XP_002151951.1|  eukaryotic translation initiation factor 3 s...    117   5e-27    
ref|XP_008567995.1|  PREDICTED: eukaryotic translation initiation...    117   6e-27    
ref|XP_009153474.1|  eukaryotic translation initiation factor 3 s...    117   7e-27    
ref|XP_003176689.1|  eukaryotic translation initiation factor 3         117   7e-27    
gb|EFA79519.1|  proteasome component region PCI domain-containing...    118   7e-27    
ref|XP_006724323.1|  PREDICTED: eukaryotic translation initiation...    118   7e-27    
ref|XP_001090065.1|  PREDICTED: eukaryotic translation initiation...    118   7e-27    



>gb|KJB54835.1| hypothetical protein B456_009G051100 [Gossypium raimondii]
Length=388

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  219  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  278

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL +YKHKTH+VDSDGKI
Sbjct  279  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILFSYKHKTHAVDSDGKI  338

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KR+GDYFLRQIVKLEGV+ D+DRI+LE
Sbjct  339  ISNADVDFYIDDDMIHVVESKPVKRFGDYFLRQIVKLEGVINDMDRIRLE  388



>emb|CDP16167.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQR+DDE+F LYDELFSYACPKFITPSAPSFE+PLVNYNQDAYRLQLKL
Sbjct  349  LREKYGEKMLRMQRFDDEAFALYDELFSYACPKFITPSAPSFEDPLVNYNQDAYRLQLKL  408

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTIS+GKLA YL+VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  409  FLYEVKQQQLLSGVRTFLKVYSTISMGKLATYLEVDEPTLRTILLTYKHKTHAVDSDGKI  468

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF++DD+MIHV+ESKP+KRYGDYFLRQIVKLEGVMTDVDR+KLE
Sbjct  469  SSNADVDFYVDDDMIHVIESKPAKRYGDYFLRQIVKLEGVMTDVDRVKLE  518



>ref|XP_009595011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L {ECO:0000255|HAMAP-Rule:MF_03011}-like [Nicotiana tomentosiformis]
 ref|XP_009782140.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nicotiana sylvestris]
Length=517

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F LYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  348  LREKYGEKMARMQRYDDEAFALYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  407

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVRT+LKVYSTISLGKLANY++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  408  FLYEVKQQQLLAGVRTFLKVYSTISLGKLANYMEVDEPTLRTILMTYKHKTHAVDSDGKI  467

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+ID++MI VVESKP+K+YGDYFLRQIVKLEG+MTD+DRIKLE
Sbjct  468  TSNADVDFYIDEDMIRVVESKPAKKYGDYFLRQIVKLEGIMTDIDRIKLE  517



>ref|XP_007012063.1| RNA polymerase I-associated factor PAF67 isoform 1 [Theobroma 
cacao]
 gb|EOY29682.1| RNA polymerase I-associated factor PAF67 isoform 1 [Theobroma 
cacao]
Length=520

 Score =   322 bits (825),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILLTYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KRYGDYFLRQ+VKLEGV+ D+DRIKLE
Sbjct  471  ISNADVDFYIDDDMIHVVESKPVKRYGDYFLRQVVKLEGVINDMDRIKLE  520



>gb|KDP34205.1| hypothetical protein JCGZ_07776 [Jatropha curcas]
Length=525

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  356  LREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  415

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  416  FLYEVKQQQLLSGVRTFLKVYSTISLAKLASYMEVDEPTLRTILMTYKHKTHAVDSEGKI  475

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KRYGDYFLRQIVKLEGV+ D+DRIKLE
Sbjct  476  ISNADVDFYIDDDMIHVVESKPLKRYGDYFLRQIVKLEGVINDMDRIKLE  525



>gb|KJB54836.1| hypothetical protein B456_009G051100 [Gossypium raimondii]
Length=520

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL +YKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILFSYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KR+GDYFLRQIVKLEGV+ D+DRI+LE
Sbjct  471  ISNADVDFYIDDDMIHVVESKPVKRFGDYFLRQIVKLEGVINDMDRIRLE  520



>ref|XP_002516563.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45904.1| conserved hypothetical protein [Ricinus communis]
Length=530

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  361  LREKYGEKMIRMQRYDDEAFAMYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTI+L KLANY++VDE TLRTILMTYKHKTH+VDS+GKI
Sbjct  421  FLYEVKQQQLLSGVRTFLKVYSTITLAKLANYMEVDETTLRTILMTYKHKTHAVDSEGKI  480

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KRYGDYFLRQIVKLEGV+ D+DRIKLE
Sbjct  481  ISNADVDFYIDDDMIHVVESKPVKRYGDYFLRQIVKLEGVINDMDRIKLE  530



>ref|XP_011019644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Populus euphratica]
Length=519

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F+LYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  350  LREKYGEKMARMQRYDDEAFSLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  409

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  410  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILMTYKHKTHAVDSEGKI  469

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+ID++MIHVV++KP KRYGDYFLRQIVK EGV+ D+DRIKLE
Sbjct  470  ISNADVDFYIDEDMIHVVDTKPVKRYGDYFLRQIVKFEGVINDMDRIKLE  519



>gb|KCW81539.1| hypothetical protein EUGRSUZ_C02897 [Eucalyptus grandis]
Length=505

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  336  LREKYGEKMLRMQRYDDEAFVIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  395

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL KLANY++VDEPTLRTIL+TYKHKTH++D+DGK+
Sbjct  396  FLYEVKQQQLLSGVRTFLKVYSTISLAKLANYMEVDEPTLRTILITYKHKTHAIDTDGKV  455

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DFF+DD+MIHVVESKP+KRYGDYFLRQIVKLE +M D+DR+KLE
Sbjct  456  ISNADIDFFVDDDMIHVVESKPAKRYGDYFLRQIVKLESMMNDMDRVKLE  505



>ref|XP_002308615.2| hypothetical protein POPTR_0006s25800g [Populus trichocarpa]
 gb|EEE92138.2| hypothetical protein POPTR_0006s25800g [Populus trichocarpa]
Length=519

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F+LYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  350  LREKYGEKMARMQRYDDEAFSLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  409

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  410  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILMTYKHKTHAVDSEGKI  469

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+ID++MIHVV++KP KRYGDYFLRQIVK EGV+ D+DRIKLE
Sbjct  470  ISNADVDFYIDEDMIHVVDTKPVKRYGDYFLRQIVKFEGVINDMDRIKLE  519



>gb|KJB65717.1| hypothetical protein B456_010G110200 [Gossypium raimondii]
Length=520

 Score =   317 bits (813),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFVIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL KLANY++VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLWKLANYMEVDEPTLRTILLTYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVES P KRYGDYFLRQIVKLEGV+ D+DRIKLE
Sbjct  471  ISNADVDFYIDDDMIHVVESMPVKRYGDYFLRQIVKLEGVINDMDRIKLE  520



>ref|XP_010049085.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Eucalyptus grandis]
 gb|KCW81540.1| hypothetical protein EUGRSUZ_C02897 [Eucalyptus grandis]
Length=531

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  362  LREKYGEKMLRMQRYDDEAFVIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL KLANY++VDEPTLRTIL+TYKHKTH++D+DGK+
Sbjct  422  FLYEVKQQQLLSGVRTFLKVYSTISLAKLANYMEVDEPTLRTILITYKHKTHAIDTDGKV  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DFF+DD+MIHVVESKP+KRYGDYFLRQIVKLE +M D+DR+KLE
Sbjct  482  ISNADIDFFVDDDMIHVVESKPAKRYGDYFLRQIVKLESMMNDMDRVKLE  531



>ref|XP_007012065.1| RNA polymerase I-associated factor PAF67 isoform 3 [Theobroma 
cacao]
 gb|EOY29684.1| RNA polymerase I-associated factor PAF67 isoform 3 [Theobroma 
cacao]
Length=519

 Score =   317 bits (813),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 164/170 (96%), Gaps = 1/170 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILLTYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD MIHVVESKP KRYGDYFLRQ+VKLEGV+ D+DRIKLE
Sbjct  471  ISNADVDFYIDD-MIHVVESKPVKRYGDYFLRQVVKLEGVINDMDRIKLE  519



>gb|KFK27820.1| hypothetical protein AALP_AA8G434000 [Arabis alpina]
Length=287

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITP+APSFEEPLVNYNQDAYRLQLK+
Sbjct  118  LREKYGEKMVRMQRYDDEAFGVYDELFSYACPKFITPAAPSFEEPLVNYNQDAYRLQLKM  177

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+RT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSVDSDGKI
Sbjct  178  FLYEVKQQQLLSGLRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVDSDGKI  237

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++M++VVESKP+KRYGD++LRQI KLEGV+ D+DRIKLE
Sbjct  238  ISNADIDFYINNDMVYVVESKPAKRYGDFYLRQIAKLEGVINDIDRIKLE  287



>ref|XP_011081819.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Sesamum indicum]
Length=518

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQRYDDE+F LYDELFSYACPKFITP+ PS+EEPLVNYNQDAYRLQLKL
Sbjct  349  LREKYGEKMLRMQRYDDEAFALYDELFSYACPKFITPAPPSYEEPLVNYNQDAYRLQLKL  408

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGV TYLKVYSTISLGKLA Y++VDEPTLRTILMTYKHKTHSVDSDGKI
Sbjct  409  FLYEVKQQQLLSGVGTYLKVYSTISLGKLAAYMEVDEPTLRTILMTYKHKTHSVDSDGKI  468

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNA+VDF+IDD+MIHV ESKP+KR GDYF+RQIVKLEGVMTD+DRIKLE
Sbjct  469  TSNANVDFYIDDDMIHVFESKPAKRNGDYFMRQIVKLEGVMTDIDRIKLE  518



>gb|KFK27817.1| hypothetical protein AALP_AA8G433700 [Arabis alpina]
Length=239

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITP+APSFEEPLVNYNQDAYRLQLK+
Sbjct  70   LREKYGEKMARMQRYDDEAFGVYDELFSYACPKFITPAAPSFEEPLVNYNQDAYRLQLKM  129

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+RT+LKVYS+ISL KL+NY++VDEPTLRTIL+TYKHKTHSVDSDGKI
Sbjct  130  FLYEVKQQQLLSGLRTFLKVYSSISLAKLSNYMEVDEPTLRTILLTYKHKTHSVDSDGKI  189

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++M+ +VESKP+KRYGD++LRQI KLEGV+ D+DRIKLE
Sbjct  190  ISNADIDFYINNDMVFIVESKPAKRYGDFYLRQIAKLEGVINDIDRIKLE  239



>emb|CBI20884.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   311 bits (796),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYG+KM +MQRYDDE+F LYDELFSYACPKFITPSAP +EEPLVNYNQ+AYRLQLKL
Sbjct  209  LKEKYGEKMNRMQRYDDEAFALYDELFSYACPKFITPSAPVYEEPLVNYNQEAYRLQLKL  268

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLA Y++VD+PTLRTILMTYKHKTH+VDSDGKI
Sbjct  269  FLYEVKQQQLLSGVRTFLKVYSTISLGKLATYMEVDDPTLRTILMTYKHKTHAVDSDGKI  328

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHV+ESKP+KRYGDYF+RQ+VKLEG+M D+DR+KL+
Sbjct  329  GSNADVDFYIDDDMIHVIESKPTKRYGDYFMRQVVKLEGLMNDMDRVKLD  378



>gb|KHG17679.1| Eukaryotic translation initiation factor 3 subunit L [Gossypium 
arboreum]
Length=520

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPS+PSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSSPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL+EVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL +YKHKTH+VDSDGKI
Sbjct  411  FLHEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILFSYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVVESKP KR+GDYFLRQIVKLEGV+ D+DRI+LE
Sbjct  471  ISNADVDFYIDDDMIHVVESKPVKRFGDYFLRQIVKLEGVINDMDRIRLE  520



>ref|XP_011090287.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L-like [Sesamum indicum]
Length=510

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F LYDELFSYACPKFITPSAPS+EEPLVNYNQDAYRLQLKL
Sbjct  341  LREKYGEKMSRMQRYDDEAFALYDELFSYACPKFITPSAPSYEEPLVNYNQDAYRLQLKL  400

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTI+LGKLA Y++VDEPTLRTILMTYKHKTH+VD DGKI
Sbjct  401  FLYEVKQQQLLSGVRTFLKVYSTITLGKLAAYMEVDEPTLRTILMTYKHKTHAVDFDGKI  460

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+D+MIHV ESK +KRYGDYF+RQIVKLEGVMTDVDRIKLE
Sbjct  461  TSNADIDFYINDDMIHVAESKSAKRYGDYFMRQIVKLEGVMTDVDRIKLE  510



>gb|KHN10225.1| Eukaryotic translation initiation factor 3 subunit L [Glycine 
soja]
Length=378

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  209  LREKYGEKMVRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  268

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  269  FLYEAKQQQLLSGVRTFLKVYSTISLTKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  328

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+IDD+ IHV+ESKP+KRYGDYFLRQIVKLEGV+ ++D IKLE
Sbjct  329  TSNADLDFYIDDDTIHVMESKPAKRYGDYFLRQIVKLEGVINEMDGIKLE  378



>gb|EYU20458.1| hypothetical protein MIMGU_mgv1a004619mg [Erythranthe guttata]
Length=518

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQ YDD++FTLYDELFSYACPKFITPS+PS+EE LVNYNQDAYRLQLKL
Sbjct  349  LREKYGEKMSRMQGYDDDAFTLYDELFSYACPKFITPSSPSYEETLVNYNQDAYRLQLKL  408

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLA Y++VDEPTLRTILMTYKHKTHSVDSDGKI
Sbjct  409  FLYEVKQQQLLSGVRTFLKVYSTISLGKLAAYMEVDEPTLRTILMTYKHKTHSVDSDGKI  468

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF++DD+MIHV ESKP+KRYGDYF+RQIVKLEG+MTD+DRIKLE
Sbjct  469  TSNADLDFYVDDDMIHVTESKPAKRYGDYFMRQIVKLEGIMTDIDRIKLE  518



>gb|AFK37130.1| unknown [Medicago truncatula]
Length=201

 Score =   303 bits (776),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  32   LREKYGEKMSRMQRYDDEAFAMYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  91

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSG+RT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDS GKI
Sbjct  92   FLYEAKQQQLLSGLRTFLKVYSTISLAKLASYMEVDEPTLRTILMTYKHKTHAVDSAGKI  151

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+ IHVVESKPSK+YGD FLRQ+VKLE V+ ++D IKLE
Sbjct  152  ISNADVDFYIDDDTIHVVESKPSKQYGDCFLRQVVKLEKVINEMDSIKLE  201



>gb|KHN18197.1| Eukaryotic translation initiation factor 3 subunit L [Glycine 
soja]
Length=371

 Score =   308 bits (789),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  202  LREKYGEKMVRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  261

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  262  FLYEAKQQQLLSGVRTFLKVYSTISLTKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  321

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+D+ IHV+ESKP+KRYGDYFLRQIVKLEGV+ ++D IKLE
Sbjct  322  TSNADLDFYINDDTIHVMESKPAKRYGDYFLRQIVKLEGVINEMDGIKLE  371



>ref|XP_006394822.1| hypothetical protein EUTSA_v10003996mg [Eutrema salsugineum]
 gb|ESQ32108.1| hypothetical protein EUTSA_v10003996mg [Eutrema salsugineum]
Length=523

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  354  LREKYGEKMMRMQRYDDEAFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE+KQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSVDSDGKI
Sbjct  414  FLYELKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVDSDGKI  473

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGV+ DVDRIKLE
Sbjct  474  TSNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDVDRIKLE  523



>ref|XP_011026651.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Populus euphratica]
Length=456

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYD+E+F +YDELFSYACPKFI+PSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  287  LREKYGEKMARMQRYDNEAFAIYDELFSYACPKFISPSAPSFEEPLVNYNQDAYRLQLKL  346

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            F+YEVKQQQLLSGVRT+LKVYS IS+GKLANY++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  347  FIYEVKQQQLLSGVRTFLKVYSAISVGKLANYMEVDEPTLRTILMTYKHKTHAVDSEGKI  406

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVV++KP ++YGDYFLRQIVKLEGV+ D+DRI+LE
Sbjct  407  ISNADVDFYIDDDMIHVVDTKPVRQYGDYFLRQIVKLEGVINDMDRIRLE  456



>ref|XP_007137185.1| hypothetical protein PHAVU_009G106900g [Phaseolus vulgaris]
 gb|ESW09179.1| hypothetical protein PHAVU_009G106900g [Phaseolus vulgaris]
Length=513

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  344  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  403

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  404  FLYEAKQQQLLSGVRTFLKVYSTISLAKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  463

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+ IHVVESKP+KRYGDYFLRQIVKLEGV+ ++D IKL+
Sbjct  464  TSNADVDFYIDDDTIHVVESKPAKRYGDYFLRQIVKLEGVINEMDGIKLD  513



>ref|XP_002284115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Vitis vinifera]
Length=517

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYG+KM +MQRYDDE+F LYDELFSYACPKFITPSAP +EEPLVNYNQ+AYRLQLKL
Sbjct  348  LKEKYGEKMNRMQRYDDEAFALYDELFSYACPKFITPSAPVYEEPLVNYNQEAYRLQLKL  407

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLA Y++VD+PTLRTILMTYKHKTH+VDSDGKI
Sbjct  408  FLYEVKQQQLLSGVRTFLKVYSTISLGKLATYMEVDDPTLRTILMTYKHKTHAVDSDGKI  467

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHV+ESKP+KRYGDYF+RQ+VKLEG+M D+DR+KL+
Sbjct  468  GSNADVDFYIDDDMIHVIESKPTKRYGDYFMRQVVKLEGLMNDMDRVKLD  517



>ref|XP_006394821.1| hypothetical protein EUTSA_v10004012mg [Eutrema salsugineum]
 gb|ESQ32107.1| hypothetical protein EUTSA_v10004012mg [Eutrema salsugineum]
Length=516

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  347  LREKYGEKMMRMQRYDDEAFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  406

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE+KQQQLLSGVRT+LKVYS+ISL KLAN+++VDEPTLRTIL+TYKHKTHSVDSDGKI
Sbjct  407  FLYELKQQQLLSGVRTFLKVYSSISLAKLANFMEVDEPTLRTILLTYKHKTHSVDSDGKI  466

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DRIKLE
Sbjct  467  ISNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRIKLE  516



>ref|XP_002324243.1| hypothetical protein POPTR_0018s00670g [Populus trichocarpa]
 gb|EEF02808.1| hypothetical protein POPTR_0018s00670g [Populus trichocarpa]
Length=519

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQR D E+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  350  LREKYGEKMARMQRCDGEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  409

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS IS+GKLANY++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  410  FLYEVKQQQLLSGVRTFLKVYSAISVGKLANYMEVDEPTLRTILMTYKHKTHAVDSEGKI  469

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+MIHVV++KP +RYGDYFLRQIVKLEGV+ D+DRIKLE
Sbjct  470  ISNADVDFYIDDDMIHVVDTKPVRRYGDYFLRQIVKLEGVINDLDRIKLE  519



>ref|XP_006578214.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Glycine max]
Length=514

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  345  LREKYGEKMVRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  404

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  405  FLYEAKQQQLLSGVRTFLKVYSTISLTKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  464

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+IDD+ IHV+ESKP+KRYGDYFLRQIVKLEGV+ ++D IKLE
Sbjct  465  TSNADLDFYIDDDTIHVMESKPAKRYGDYFLRQIVKLEGVINEMDGIKLE  514



>ref|XP_003526476.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Glycine max]
Length=516

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  347  LREKYGEKMVRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  406

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSGVRT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  407  FLYEAKQQQLLSGVRTFLKVYSTISLTKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  466

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+D+ IHV+ESKP+KRYGDYFLRQIVKLEGV+ ++D IKLE
Sbjct  467  TSNADLDFYINDDTIHVMESKPAKRYGDYFLRQIVKLEGVINEMDGIKLE  516



>emb|CDX80534.1| BnaC07g29100D [Brassica napus]
Length=523

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQR DDE F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  354  LREKYGEKMMRMQRCDDEEFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSV SDGK+
Sbjct  414  FLYEVKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVGSDGKV  473

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGVM D+DRIKLE
Sbjct  474  ISNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVMNDMDRIKLE  523



>ref|XP_003636390.1| Eukaryotic translation initiation factor 3 subunit L [Medicago 
truncatula]
 gb|KEH36023.1| RNA polymerase I-associated factor PAF67 [Medicago truncatula]
Length=511

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  342  LREKYGEKMSRMQRYDDEAFAMYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  401

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSG+RT+LKVYSTISL KLA+Y++VDEPTLRTILMTYKHKTH+VDS GKI
Sbjct  402  FLYEAKQQQLLSGLRTFLKVYSTISLAKLASYMEVDEPTLRTILMTYKHKTHAVDSAGKI  461

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+ IHVVESKPSKRYGDYFLRQ+VKLE V+ ++D IKLE
Sbjct  462  ISNADVDFYIDDDTIHVVESKPSKRYGDYFLRQVVKLEKVINEMDSIKLE  511



>ref|XP_010100268.1| hypothetical protein L484_007265 [Morus notabilis]
 gb|EXB82275.1| hypothetical protein L484_007265 [Morus notabilis]
Length=551

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  362  LREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLA+Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  422  FLYEVKQQQLLSGVRTFLKVYSTISLGKLASYMEVDEPTLRTILMTYKHKTHAVDSDGKI  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE*YT  186
             SNADVDF+IDD+MI VV+SK +K+YGDYFLRQIVK EG+M  +D +KL  +T
Sbjct  482  ISNADVDFYIDDDMIFVVDSKSAKKYGDYFLRQIVKFEGLMNSLDAVKLGGFT  534



>ref|XP_004501183.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cicer arietinum]
Length=513

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  344  LREKYGEKMNRMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  403

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYE KQQQLLSG+RT+LKVYSTISL KLA+Y++VDE TLRTILMTYKHKTH+VDS GK+
Sbjct  404  FLYEAKQQQLLSGLRTFLKVYSTISLAKLASYMEVDESTLRTILMTYKHKTHAVDSAGKV  463

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+ IHVVESKP+KRYGDYFLRQIVKLEGV+ ++D IKLE
Sbjct  464  ISNADVDFYIDDDTIHVVESKPAKRYGDYFLRQIVKLEGVINEMDSIKLE  513



>ref|XP_006366213.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Solanum tuberosum]
Length=517

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +M RYD+E+  LYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  348  LREKYGEKMARMLRYDEEASALYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  407

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVRTYLKVYSTIS+GKLANY+ +DEP LR +LMTYKHKTH+VDSDGKI
Sbjct  408  FLYEVKQQQLLAGVRTYLKVYSTISMGKLANYMDLDEPNLRAVLMTYKHKTHAVDSDGKI  467

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+ID++M+ VVESK +K+YGDYFLRQIVKLEG+MTD+DRIKLE
Sbjct  468  ISNADVDFYIDEDMVRVVESKSAKKYGDYFLRQIVKLEGIMTDIDRIKLE  517



>ref|XP_004245267.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Solanum lycopersicum]
Length=517

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +M RYD+E+  LYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  348  LREKYGEKMARMLRYDEEASALYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  407

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVR+YLKVYSTISLGKLANY+ +DEP LR +LMTYKHKTH+VDSDGKI
Sbjct  408  FLYEVKQQQLLAGVRSYLKVYSTISLGKLANYMDLDEPNLRAVLMTYKHKTHAVDSDGKI  467

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+ID++M+ VVESK +K+YGDYFLRQIVKLEG+MTD+DRIKLE
Sbjct  468  ISNADVDFYIDEDMVRVVESKSAKKYGDYFLRQIVKLEGIMTDIDRIKLE  517



>ref|XP_006450640.1| hypothetical protein CICLE_v10007989mg [Citrus clementina]
 ref|XP_006476083.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Citrus sinensis]
 gb|ESR63880.1| hypothetical protein CICLE_v10007989mg [Citrus clementina]
 gb|KDO79737.1| hypothetical protein CISIN_1g009775mg [Citrus sinensis]
Length=526

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F++YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  357  LREKYGEKMIRMQRYDDEAFSIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  416

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVR++LKVYS++ L +LA Y++VDEPTLRTILMTYKHKTH+VDSDGKI
Sbjct  417  FLYEVKQQQLLSGVRSFLKVYSSLYLSELATYMEVDEPTLRTILMTYKHKTHAVDSDGKI  476

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD MIHVVESKP KRYGD+FLRQI KLEG++ D+DR++L+
Sbjct  477  TSNADVDFYIDDNMIHVVESKPVKRYGDFFLRQIAKLEGLINDLDRVRLD  526



>ref|XP_008220046.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Prunus mume]
Length=531

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPS PSFEEPLVNYNQDAYRLQLKL
Sbjct  362  LREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSPPSFEEPLVNYNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+RT+LKVYS+ISL KLA+Y++VDE  LRTIL+TYKHKTH+VD+DGKI
Sbjct  422  FLYEVKQQQLLSGIRTFLKVYSSISLAKLASYMEVDESKLRTILLTYKHKTHAVDTDGKI  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD++I+VVESKP+KRYGDYFLRQIVKLEGV+ D+DR+KL+
Sbjct  482  ISNADVDFYIDDDLIYVVESKPAKRYGDYFLRQIVKLEGVINDMDRVKLD  531



>ref|XP_007222482.1| hypothetical protein PRUPE_ppa004079mg [Prunus persica]
 gb|EMJ23681.1| hypothetical protein PRUPE_ppa004079mg [Prunus persica]
Length=531

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPS PSFEEPLVNYNQDAYRLQLKL
Sbjct  362  LREKYGEKMIRMQRYDDEAFAIYDELFSYACPKFITPSPPSFEEPLVNYNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+RT+LKVYS+ISL KLA+Y++VDE  LRTIL+TYKHKTH+VD+DGKI
Sbjct  422  FLYEVKQQQLLSGIRTFLKVYSSISLAKLASYMEVDESKLRTILLTYKHKTHAVDTDGKI  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD++I+VVESKP+KRYGDYFLRQIVKLEGV+ D+DR+KL+
Sbjct  482  ISNADVDFYIDDDLIYVVESKPAKRYGDYFLRQIVKLEGVINDMDRVKLD  531



>ref|XP_010519900.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Tarenaya hassleriana]
Length=527

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM+KMQRYDDE+F LYDELFSYACPKFITPSAPSF EPLVNYNQDAYRLQLK+
Sbjct  357  LREKYGEKMMKMQRYDDEAFGLYDELFSYACPKFITPSAPSFREPLVNYNQDAYRLQLKM  416

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGK-  348
            FLYEVKQQQLLSG+RT+LKVYSTISL KLANY++VDEPTLRTIL+TYKHKTH+VDS+G+ 
Sbjct  417  FLYEVKQQQLLSGIRTFLKVYSTISLAKLANYMEVDEPTLRTILLTYKHKTHAVDSEGRV  476

Query  347  IFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            I SNAD+DF+I+++MIHVVESKP K YGD+FLRQ+ KLEGV+ D+DR+KLE
Sbjct  477  IISNADIDFYINNDMIHVVESKPVKHYGDFFLRQVAKLEGVINDLDRVKLE  527



>emb|CDX88194.1| BnaA06g27850D [Brassica napus]
Length=523

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQR DDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  354  LREKYGEKMMRMQRCDDEAFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS IS+ KL+NY++VDEPTLRTIL+TYKHKTHSV SDGK+
Sbjct  414  FLYEVKQQQLLSGVRTFLKVYSAISIDKLSNYMEVDEPTLRTILLTYKHKTHSVGSDGKV  473

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DRIKLE
Sbjct  474  ISNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRIKLE  523



>ref|XP_010668069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F LYDELFSYACPKFITPSAP+++EPL+NYNQDAYRLQLKL
Sbjct  350  LREKYGEKMSRMQRYDDEAFALYDELFSYACPKFITPSAPNYDEPLINYNQDAYRLQLKL  409

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVRT+LKVYSTISLGKLA Y++VDE TLRTILMTYKHKTHSVD++GKI
Sbjct  410  FLYEVKQQQLLAGVRTFLKVYSTISLGKLATYMEVDEVTLRTILMTYKHKTHSVDAEGKI  469

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             SNAD+DF+IDD+M+H+VESK  KRYGDYF+RQI KLEGVM D+DRIK+
Sbjct  470  ISNADIDFYIDDDMVHIVESKAPKRYGDYFMRQIAKLEGVMNDMDRIKI  518



>ref|XP_009151095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Brassica rapa]
Length=523

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQR DDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  354  LREKYGEKMMRMQRCDDEAFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS IS+ KL+NY++VDEPTLRTIL+TYKHKTHSV SDGK+
Sbjct  414  FLYEVKQQQLLSGVRTFLKVYSAISIDKLSNYMEVDEPTLRTILLTYKHKTHSVGSDGKV  473

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DRIKLE
Sbjct  474  ISNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRIKLE  523



>ref|XP_010249694.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nelumbo nucifera]
Length=525

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQRYD+E+F LYDELFSYACPKFITPSAP +EEPLVNYNQDAYRLQLKL
Sbjct  356  LREKYGEKMLRMQRYDEEAFALYDELFSYACPKFITPSAPIYEEPLVNYNQDAYRLQLKL  415

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+RT+LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHKTH+VDS+GKI
Sbjct  416  FLYEVKQQQLLSGIRTFLKLYSTISIGKLATYMEVDEPTLRTILMTYKHKTHAVDSEGKI  475

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            FSNADVDF+I+D+MI+VVESK +KRYGDYFLRQIVKLE  + ++DR KLE
Sbjct  476  FSNADVDFYINDDMIYVVESKSAKRYGDYFLRQIVKLEETINEMDRAKLE  525



>gb|EPS61195.1| hypothetical protein M569_13603, partial [Genlisea aurea]
Length=497

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F LYDELFS+ACPKFITPS PSFEEPLVNYNQ+AYRLQLKL
Sbjct  329  LREKYGEKMTRMQRYDDEAFALYDELFSFACPKFITPSPPSFEEPLVNYNQEAYRLQLKL  388

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRTYLK+YSTIS+ KLA+YL+VDEPT+RTILMTYKHKTH VDSDGKI
Sbjct  389  FLYEVKQQQLLSGVRTYLKLYSTISIAKLASYLEVDEPTVRTILMTYKHKTHPVDSDGKI  448

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             SNADV+F++DD+MIH VES+ +KRYGD+F+RQIVKLE +M+DVDRIKL
Sbjct  449  ASNADVNFYVDDDMIHAVESRAAKRYGDFFMRQIVKLEEMMSDVDRIKL  497



>ref|XP_008378102.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Malus domestica]
Length=530

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPS PSFEEPLVNYNQDAYRLQLKL
Sbjct  361  LREKYGEKMNRMQRYDDEAFAIYDELFSYACPKFITPSPPSFEEPLVNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+IS GKLA+Y++VDE  LRTIL+TYKHKTHSVD++GK+
Sbjct  421  FLYEVKQQQLLSGVRTFLKVYSSISXGKLASYMEVDEAKLRTILLTYKHKTHSVDTEGKV  480

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD++I VVESKP+KRYGDYFLRQIVKLEGV+ D+DR+KL+
Sbjct  481  ISNADVDFYIDDDLISVVESKPAKRYGDYFLRQIVKLEGVINDMDRVKLD  530



>ref|XP_010421430.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=516

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQR+DDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  347  LREKYGEKMMRMQRFDDEAFGIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  406

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISL KLA Y++VDE TLRTIL+TYKHKTHSVDS+G I
Sbjct  407  FLYEVKQQQLLSGVRTFLKVYSSISLAKLAKYMEVDESTLRTILLTYKHKTHSVDSNGGI  466

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+++++MI+VVESKP KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  467  ISNADIDFYMNNDMIYVVESKPVKRYGDFFLRQIAKLEGVINDMDRVKLE  516



>ref|XP_008466039.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis melo]
Length=528

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYD+E+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  359  LREKYGEKMIRMQRYDEEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  418

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL +LA Y++VDE TLRTIL+TYKHKTH+VDS GKI
Sbjct  419  FLYEVKQQQLLSGVRTFLKVYSTISLSQLAIYMEVDESTLRTILLTYKHKTHAVDSVGKI  478

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD++IHVVESKP  RYGD+FLRQIVKLEG++ D+DR+KL+
Sbjct  479  MSNADVDFYIDDDIIHVVESKPVNRYGDFFLRQIVKLEGMINDLDRVKLD  528



>ref|XP_009367906.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Pyrus x bretschneideri]
Length=530

 Score =   299 bits (766),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPS PSFEEPLVNYNQDAYRLQLKL
Sbjct  361  LREKYGEKMNRMQRYDDEAFAIYDELFSYACPKFITPSPPSFEEPLVNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+L+VYS+IS+GKLA+Y++VDE  LRTIL+TYKHKTH+VD++GK+
Sbjct  421  FLYEVKQQQLLSGVRTFLQVYSSISVGKLASYMEVDESKLRTILLTYKHKTHAVDTEGKV  480

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD++I VVESKP+KRYGDYFLRQIVKLEGV+ D+DR+KL+
Sbjct  481  ISNADVDFYIDDDLISVVESKPAKRYGDYFLRQIVKLEGVINDMDRVKLD  530



>ref|NP_680222.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 ref|NP_680223.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 gb|AED93480.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
 gb|AED93481.1| RNA polymerase I-associated factor PAF67 [Arabidopsis thaliana]
Length=514

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAP-SFEEPLVNYNQDAYRLQLK  528
            LR+KYG+KM++M R DDE+F +YDELFSYACPKFITPSAP +FEEPLVNYNQDAYRLQLK
Sbjct  344  LRDKYGEKMMRMLRSDDEAFGIYDELFSYACPKFITPSAPPTFEEPLVNYNQDAYRLQLK  403

Query  527  LFLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGK  348
            +FLYEVKQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSVDSDG+
Sbjct  404  MFLYEVKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVDSDGR  463

Query  347  IFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            I SNAD+DFFI+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  464  IISNADIDFFINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRVKLE  514



>dbj|BAD93836.1| hypothetical protein [Arabidopsis thaliana]
Length=514

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAP-SFEEPLVNYNQDAYRLQLK  528
            LR+KYG+KM++M R DDE+F +YDELFSYACPKFITPSAP +FEEPLVNYNQDAYRLQLK
Sbjct  344  LRDKYGEKMMRMLRSDDEAFGIYDELFSYACPKFITPSAPPTFEEPLVNYNQDAYRLQLK  403

Query  527  LFLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGK  348
            +FLYEVKQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSVDSDG+
Sbjct  404  MFLYEVKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVDSDGR  463

Query  347  IFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            I SNAD+DFFI+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  464  IISNADIDFFINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRVKLE  514



>gb|AAN31908.1| unknown protein [Arabidopsis thaliana]
Length=514

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAP-SFEEPLVNYNQDAYRLQLK  528
            LR+KYG+KM++M R DDE+F +YDELFSYACPKFITPSAP +FEEPLVNYNQDAYRLQLK
Sbjct  344  LRDKYGEKMMRMLRSDDEAFGIYDELFSYACPKFITPSAPPTFEEPLVNYNQDAYRLQLK  403

Query  527  LFLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGK  348
            +FLYEVKQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTHSVDSDG+
Sbjct  404  MFLYEVKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHSVDSDGR  463

Query  347  IFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            I SNAD+DFFI+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  464  IISNADIDFFINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRVKLE  514



>ref|XP_002885738.1| hypothetical protein ARALYDRAFT_319240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61997.1| hypothetical protein ARALYDRAFT_319240 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KYG+KM++M RYDDE+F +YDELFSYACPKFITPS P  EEPLVNYNQDAYRLQLK+
Sbjct  324  LQDKYGEKMMRMLRYDDEAFGIYDELFSYACPKFITPSPPCLEEPLVNYNQDAYRLQLKM  383

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISL KLANY++VDEPTLRTIL+TYKHKTH+VDSDG+I
Sbjct  384  FLYEVKQQQLLSGVRTFLKVYSSISLAKLANYMEVDEPTLRTILLTYKHKTHAVDSDGRI  443

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  444  ISNADIDFYINNDMIYVVESKPAKRYGDFFLRQIAKLEGVINDMDRVKLE  493



>ref|XP_004291198.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+FT+YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  354  LREKYGEKMIRMQRYDDEAFTIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISLG LA Y++VDE  LRTIL+TYKHKTHSVD+DGK 
Sbjct  414  FLYEVKQQQLLSGVRTFLKVYSSISLGNLAKYMEVDESKLRTILLTYKHKTHSVDTDGKT  473

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF++DD+ ++V +SKP KRYGDYFLRQIVKLE  + D+DRIKL+
Sbjct  474  ISNADVDFYMDDDWVYVTDSKPPKRYGDYFLRQIVKLEAAINDLDRIKLD  523



>ref|XP_010493831.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=516

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSF+EPLVNYNQDAYRLQLK+
Sbjct  347  LREKYGEKMMRMQRYDDEAFGIYDELFSYACPKFITPSAPSFDEPLVNYNQDAYRLQLKM  406

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISL KLA Y++VDE TLRTIL+TYKHKTHSVDS+G I
Sbjct  407  FLYEVKQQQLLSGVRTFLKVYSSISLAKLAKYMEVDESTLRTILLTYKHKTHSVDSNGGI  466

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+++++MI+VVE KP+KRYGD+FLRQI KLEGV+ D+DR+KL+
Sbjct  467  ISNADIDFYMNNDMIYVVEPKPAKRYGDFFLRQIAKLEGVINDMDRVKLD  516



>ref|XP_002872179.1| hypothetical protein ARALYDRAFT_489426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48438.1| hypothetical protein ARALYDRAFT_489426 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LR+KYG+KM++M RYDDE+F +YDELFSYACPKFITPS P FEEPLVNYNQDAYRLQLK+
Sbjct  352  LRDKYGEKMMRMLRYDDEAFGIYDELFSYACPKFITPSPPCFEEPLVNYNQDAYRLQLKM  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+ISL KLAN ++VDEPTLRTIL+TYKHKTHSVDSDG+I
Sbjct  412  FLYEVKQQQLLSGVRTFLKVYSSISLAKLANCMEVDEPTLRTILLTYKHKTHSVDSDGRI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+I+++MI+VVESKP+KRYGD+ LRQI KL+GV+ D+DR+KLE
Sbjct  472  ISNADIDFYINNDMIYVVESKPAKRYGDFLLRQIAKLDGVINDMDRVKLE  521



>ref|XP_010254082.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Nelumbo nucifera]
Length=524

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KML+MQRYDDE++ LYDELFSYACPKFITPSAP FEEPLVNYNQDAYRLQLKL
Sbjct  355  LREKYGEKMLRMQRYDDEAYALYDELFSYACPKFITPSAPIFEEPLVNYNQDAYRLQLKL  414

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGV+++LK++STIS+GKLA YL+VDE TLRTILMTYKHKTH+VDSDG+I
Sbjct  415  FLYEVKQQQLLSGVQSFLKLHSTISIGKLATYLEVDESTLRTILMTYKHKTHTVDSDGRI  474

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              N DVDF+I++++IHV+ESK +K+YGDYF+RQIVKLE  + D+DRIKLE
Sbjct  475  ICNVDVDFYINNDVIHVIESKSAKQYGDYFMRQIVKLEETINDMDRIKLE  524



>ref|XP_006287441.1| hypothetical protein CARUB_v10000647mg, partial [Capsella rubella]
 gb|EOA20339.1| hypothetical protein CARUB_v10000647mg, partial [Capsella rubella]
Length=544

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKY DKM +MQ YD+++F ++DELF+YACPKFITPSAPSFEEPLVNYNQDAY LQLK+
Sbjct  375  LREKYEDKMGRMQSYDNDAFIVFDELFTYACPKFITPSAPSFEEPLVNYNQDAYTLQLKM  434

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQ+LL+GVRT+LKVYS+ISL KLA Y++VDE TLRTIL+TYKHKTHSVDSDG+I
Sbjct  435  FLYEVKQQELLAGVRTFLKVYSSISLAKLAKYMEVDESTLRTILLTYKHKTHSVDSDGRI  494

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD+DF+++D+MI+VVE+KP+KRYGD+FLRQI KLEGV+ D+DR+KLE
Sbjct  495  VSNADIDFYVNDDMIYVVETKPAKRYGDFFLRQIAKLEGVINDMDRVKLE  544



>ref|XP_008800463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Phoenix dactylifera]
Length=524

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KY +KMLKMQRYDDE++ +YDELFSYACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  355  LKDKYSEKMLKMQRYDDEAYAVYDELFSYACPKFITPSAPVLEEPLTNYNQDAYRLQLKL  414

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVR++LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHK H+VDSDGKI
Sbjct  415  FLYEVKQQQLLAGVRSFLKLYSTISIGKLATYMEVDEPTLRTILMTYKHKMHAVDSDGKI  474

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              NADVDF+ID+++IHVVESK +KRYGDYFLRQI+K E +++++DR+KL+
Sbjct  475  IPNADVDFYIDEDIIHVVESKSAKRYGDYFLRQILKFEEMISELDRVKLD  524



>ref|XP_006833328.1| hypothetical protein AMTR_s00109p00071210 [Amborella trichopoda]
 gb|ERM98606.1| hypothetical protein AMTR_s00109p00071210 [Amborella trichopoda]
Length=521

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQRYDDE+++LYDE FSYACPKFITPSAP +EEPLVNYNQD YRLQLKL
Sbjct  352  LREKYGDKMLRMQRYDDEAYSLYDEAFSYACPKFITPSAPIYEEPLVNYNQDGYRLQLKL  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R++LK+Y+TIS+ KLA++++VDEPTLRTILMTYKHKTHSVD+DGKI
Sbjct  412  FLYEVKQQQLLSGIRSFLKLYTTISISKLASFMEVDEPTLRTILMTYKHKTHSVDNDGKI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNAD++F+++++++HVVESK +K+YGD+F+RQI+K E ++ ++DR+K++
Sbjct  472  VSNADIEFYVNEDIVHVVESKSAKQYGDHFMRQIIKFEEIIGELDRVKMD  521



>ref|XP_010925867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X1 [Elaeis guineensis]
Length=524

 Score =   281 bits (719),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KY +KMLKMQRYDDE++ +YDELFSYACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  355  LKDKYSEKMLKMQRYDDEAYAVYDELFSYACPKFITPSAPILEEPLTNYNQDAYRLQLKL  414

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVR++LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHK H+VDSDGKI
Sbjct  415  FLYEVKQQQLLAGVRSFLKLYSTISIGKLATYMEVDEPTLRTILMTYKHKMHAVDSDGKI  474

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              N DVDF+ID+++I+VVESK +KRYGDYFLRQI+K E +++++DR+KL+
Sbjct  475  IPNVDVDFYIDEDIIYVVESKSTKRYGDYFLRQILKFEEMISELDRVKLD  524



>ref|XP_004136214.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis sativus]
 ref|XP_004163195.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Cucumis sativus]
 gb|KGN60334.1| hypothetical protein Csa_3G895800 [Cucumis sativus]
Length=528

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYD+E+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  359  LREKYGEKMIRMQRYDEEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  418

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLG+LA Y++VDE TLRTIL+TYKHKTH+VDS GKI
Sbjct  419  FLYEVKQQQLLSGVRTFLKVYSTISLGQLAIYMEVDESTLRTILLTYKHKTHAVDSAGKI  478

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDFFIDD++IHVVESKP  RYGD+FLRQIVKLEG++ D+DR+KL+
Sbjct  479  MSNADVDFFIDDDVIHVVESKPVNRYGDFFLRQIVKLEGMINDLDRVKLD  528



>emb|CDY05341.1| BnaC02g40490D [Brassica napus]
Length=205

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 156/180 (87%), Gaps = 10/180 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPL---VNYN-------  555
            LREKYG+KM++MQR++DE+F +YDELF YACPK ITPSAPS    L   +++N       
Sbjct  26   LREKYGEKMMRMQRFNDEAFGVYDELFFYACPKSITPSAPSLRSLLSITISFNFFGGGVS  85

Query  554  QDAYRLQLKLFLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK  375
            QDAYRL LK+FLYEVKQQQLLSGVRT+LKVYS+ISLGKLANY++VDEPTLRTIL+TYKHK
Sbjct  86   QDAYRLHLKMFLYEVKQQQLLSGVRTFLKVYSSISLGKLANYMEVDEPTLRTILLTYKHK  145

Query  374  THSVDSDGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            THSV SDGKI SNAD+DF I+D+M+ VVE+KP+K+YGD+FLRQI KLEGV+ D+DRIKLE
Sbjct  146  THSVGSDGKIISNADIDFDINDDMMDVVETKPTKQYGDFFLRQIAKLEGVINDMDRIKLE  205



>ref|XP_009419787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Musa acuminata subsp. malaccensis]
Length=530

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LR+KY +KM KM RYDDE++ +YDELF+YACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  361  LRDKYNEKMTKMLRYDDEAYAVYDELFTYACPKFITPSAPVLEEPLTNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVR++LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHK H+VD DGKI
Sbjct  421  FLYEVKQQQLLSGVRSFLKLYSTISIGKLAAYMEVDEPTLRTILMTYKHKMHAVDGDGKI  480

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              NADVDF+I ++++HVVESKP+KRYGDYFLRQI+K E ++ ++DRIK++
Sbjct  481  IPNADVDFYISEDIVHVVESKPTKRYGDYFLRQILKFEEMIGELDRIKMD  530



>ref|XP_006290036.1| hypothetical protein CARUB_v10003670mg [Capsella rubella]
 gb|EOA22934.1| hypothetical protein CARUB_v10003670mg [Capsella rubella]
Length=523

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F ++DELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLK+
Sbjct  352  LREKYGEKMMRMQRYDDEAFVIFDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKM  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVRT+LKVYS+ISL KLA Y++VDE TLRTIL+TYKHKTHSVDSDG+I
Sbjct  412  FLYEVKQQQLLAGVRTFLKVYSSISLAKLAKYMEVDESTLRTILLTYKHKTHSVDSDGRI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGV  225
             SNAD+DF+++++ I+VVE+KP+KR+GD+FLRQI K + V
Sbjct  472  ISNADIDFYVNNDKIYVVETKPAKRHGDFFLRQIAKFDAV  511



>ref|XP_009413816.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Musa acuminata subsp. malaccensis]
Length=530

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LR+KY +KM KM RYDDE++ +YDELF+YACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  361  LRDKYNEKMTKMLRYDDEAYAVYDELFTYACPKFITPSAPVLEEPLTNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVR++LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHK H+VDSDGKI
Sbjct  421  FLYEVKQQQLLSGVRSFLKLYSTISIGKLAAYMEVDEPTLRTILMTYKHKMHAVDSDGKI  480

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              NAD+D++I ++++HVVESKP KRY DYFLRQ++K E +++++DRIKL+
Sbjct  481  IPNADLDYYISEDIVHVVESKPIKRYSDYFLRQVLKFEEMISELDRIKLD  530



>ref|XP_010915834.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Elaeis guineensis]
Length=525

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KY +KMLKMQRYDDE+F +YDELFSYACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  356  LKDKYNEKMLKMQRYDDEAFAVYDELFSYACPKFITPSAPVLEEPLTNYNQDAYRLQLKL  415

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+ VR++L +YSTIS+GKLA Y++VDEPTLRT LM YKHK HSVDSDGKI
Sbjct  416  FLYEVKQQQLLAAVRSFLNLYSTISVGKLAAYMEVDEPTLRTNLMAYKHKMHSVDSDGKI  475

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
              NADV+F+I++++IHVVE K  KRYGDYFLRQI+K E +++++DR+KL+
Sbjct  476  IPNADVEFYINEDVIHVVEPKSIKRYGDYFLRQILKFEEMISELDRVKLD  525



>ref|XP_004967411.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Setaria italica]
Length=520

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  351  LKEKYNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++GKLA Y++VDE TL++ILMTYKHK H+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGIRSYLKLYSTITIGKLAQYMEVDEATLKSILMTYKHKMHAVDSDGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHVVESKP+K +GDYFLRQI+K E +M ++++++L+
Sbjct  471  VSSADFDFYIVEDIIHVVESKPTKSHGDYFLRQILKFEEMMGELEKVQLD  520



>ref|NP_001145811.1| uncharacterized protein LOC100279318 [Zea mays]
 gb|ACG29834.1| eukaryotic translation initiation factor 3 subunit 6-interacting 
protein [Zea mays]
 gb|ACL52635.1| unknown [Zea mays]
 gb|AFW80485.1| eukaryotic translation initiation factor 3 subunit 6-interacting 
protein [Zea mays]
Length=521

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  352  LKEKYNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VDSDGK+
Sbjct  412  FLYEVKQQQLLSGIRSYLKLYSTITISKLAQYMEVDEATLRSILMTYKHKMHAVDSDGKM  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHVVESKP+KR+GDYFLRQI+K E ++  +D+++L+
Sbjct  472  VSSADFDFYIVEDVIHVVESKPTKRHGDYFLRQILKFEEMIGGLDKVQLD  521



>gb|AFW80484.1| hypothetical protein ZEAMMB73_715495 [Zea mays]
Length=522

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  353  LKEKYNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  412

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VDSDGK+
Sbjct  413  FLYEVKQQQLLSGIRSYLKLYSTITISKLAQYMEVDEATLRSILMTYKHKMHAVDSDGKM  472

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHVVESKP+KR+GDYFLRQI+K E ++  +D+++L+
Sbjct  473  VSSADFDFYIVEDVIHVVESKPTKRHGDYFLRQILKFEEMIGGLDKVQLD  522



>ref|XP_002454893.1| hypothetical protein SORBIDRAFT_03g000920 [Sorghum bicolor]
 gb|EES00013.1| hypothetical protein SORBIDRAFT_03g000920 [Sorghum bicolor]
Length=521

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  352  LKEKYNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y+++DE TLR+ILMTYKHK H+VDSDGKI
Sbjct  412  FLYEVKQQQLLSGIRSYLKLYSTITISKLAQYMEMDEATLRSILMTYKHKMHAVDSDGKI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHVVESKP+KR+GDYFLRQI+K E ++ ++++++L+
Sbjct  472  VSSADFDFYIVEDVIHVVESKPTKRHGDYFLRQILKFEEMIGELEKVQLD  521



>ref|NP_001054968.1| Os05g0227700 [Oryza sativa Japonica Group]
 dbj|BAF16882.1| Os05g0227700 [Oryza sativa Japonica Group]
 dbj|BAG90475.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62812.1| hypothetical protein OsJ_17615 [Oryza sativa Japonica Group]
Length=529

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYGDKM KM RYDDE++ +YDELFSYACPKFIT S P   EP  NYNQDAYRLQLKL
Sbjct  360  LKEKYGDKMTKMHRYDDEAYAIYDELFSYACPKFITASPPVLREPYTNYNQDAYRLQLKL  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++GKLA Y+ VDE TLRTILMTYKHK HS+DSDGK+
Sbjct  420  FLYEVKQQQLLSGIRSYLKLYSTITIGKLAKYMDVDEVTLRTILMTYKHKMHSIDSDGKV  479

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+ID+++IHVVESK +K +GDYFLRQI+K E ++T +D+++ +
Sbjct  480  ISSADFDFYIDEDIIHVVESKLTKNHGDYFLRQILKFEEMITQLDKVQFD  529



>gb|ACN33756.1| unknown [Zea mays]
Length=162

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  680  MLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKLFLYEVKQQ  501
            M KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKLFLYEVKQQ
Sbjct  1    MTKMQRYDDEAYAAYDELFSYACPKFITPSPPILDQPLTNYNQDAYRLQLKLFLYEVKQQ  60

Query  500  QLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKIFSNADVDF  321
            QLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VDS+GKI S+AD DF
Sbjct  61   QLLSGIRSYLKLYSTITISKLAQYMEVDEATLRSILMTYKHKMHAVDSEGKIVSSADFDF  120

Query  320  FIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            +I +++IHVVESKP+KR+GDYFLRQI+K E ++ ++++++L+
Sbjct  121  YIVEDVIHVVESKPTKRHGDYFLRQILKFEEMIGELEKVQLD  162



>ref|XP_008673489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Zea mays]
 tpg|DAA52773.1| TPA: hypothetical protein ZEAMMB73_316507 [Zea mays]
Length=522

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQRYDDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  353  LKEKYNDKMTKMQRYDDEAYAAYDELFSYACPKFITPSPPILDQPLTNYNQDAYRLQLKL  412

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VDS+GKI
Sbjct  413  FLYEVKQQQLLSGIRSYLKLYSTITISKLAQYMEVDEATLRSILMTYKHKMHAVDSEGKI  472

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHVVESKP+KR+GDYFLRQI+K E ++ ++++++L+
Sbjct  473  VSSADFDFYIVEDVIHVVESKPTKRHGDYFLRQILKFEEMIGELEKVQLD  522



>ref|XP_007012064.1| RNA polymerase I-associated factor PAF67 isoform 2, partial [Theobroma 
cacao]
 gb|EOY29683.1| RNA polymerase I-associated factor PAF67 isoform 2, partial [Theobroma 
cacao]
Length=497

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 7/147 (5%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLRTILLTYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDD-------EMIHVVES  285
             SNADVDF+IDD       +MIHVVES
Sbjct  471  ISNADVDFYIDDSHSTLLQDMIHVVES  497



>ref|XP_006654164.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Oryza brachyantha]
Length=522

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYGDKM KM RYDDE++ +YDELFSYACPKFIT S P   EPL+NYNQDAYRLQLKL
Sbjct  353  LKEKYGDKMTKMHRYDDEAYAMYDELFSYACPKFITASHPVPGEPLINYNQDAYRLQLKL  412

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++GKLA Y+ VDE TLRTILMTYKHK HS++SDGK+
Sbjct  413  FLYEVKQQQLLSGIRSYLKLYSTITIGKLAKYMDVDEVTLRTILMTYKHKMHSINSDGKV  472

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+ID+++IHVVESK +K +GDYFLRQI+K E +++ +D+++ +
Sbjct  473  ISSADFDFYIDEDIIHVVESKLTKNHGDYFLRQILKFEEMISQLDKVQFD  522



>gb|EEC78744.1| hypothetical protein OsI_18958 [Oryza sativa Indica Group]
Length=529

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYGDKM KM RYDDE++ +YDELFSYACPKFIT S P   EP  NYNQDAYRLQLKL
Sbjct  360  LKEKYGDKMTKMHRYDDEAYAIYDELFSYACPKFITASPPVLREPYTNYNQDAYRLQLKL  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++GKLA Y+ VDE TLRTILMTYKHK HS+DSDGK+
Sbjct  420  FLYEVKQQQLLSGIRSYLKLYSTITIGKLAKYMDVDEVTLRTILMTYKHKMHSIDSDGKV  479

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+ID+++IHVVES  +K +GDYFLRQI+K E ++T +D+++ +
Sbjct  480  ISSADFDFYIDEDIIHVVESNLTKNHGDYFLRQILKFEEMITQLDKVQFD  529



>gb|ADE77547.1| unknown [Picea sitchensis]
Length=233

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 149/170 (88%), Gaps = 3/170 (2%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYG+KM +MQR D+    +YDELFSYACPKFITPS P+++EPLVNYNQDAYRLQLKL
Sbjct  67   LKEKYGEKMARMQRSDE---AVYDELFSYACPKFITPSVPNYDEPLVNYNQDAYRLQLKL  123

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL EV+QQQLLSG+R++LK+Y++IS+ KLAN++ +DE TLRT LMTYKHKTH++D DG+I
Sbjct  124  FLSEVRQQQLLSGLRSFLKLYTSISMEKLANFMDIDESTLRTTLMTYKHKTHAIDHDGRI  183

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+I+++++H++ESK +K Y D F+R I+K E +++D+DR+KLE
Sbjct  184  ISNADVDFYIEEDIVHIIESKSAKLYADNFMRHIIKCEEIISDLDRVKLE  233



>ref|XP_003565952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Brachypodium distachyon]
Length=521

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+DDE+++ YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  352  LKEKYNDKMTKMQRFDDEAYSAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YS I++ KLA Y+++DE TLR+IL+TYKHK H+VDS+GKI
Sbjct  412  FLYEVKQQQLLSGIRSYLKLYSAITISKLAQYMEMDEATLRSILLTYKHKMHAVDSNGKI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I++++IHVVESKP+KR+GDYFLRQI+K E  + ++++++L+
Sbjct  472  VSSADFDFYINEDIIHVVESKPTKRHGDYFLRQILKFEETIAELEKVQLD  521



>ref|XP_006643941.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Oryza brachyantha]
Length=525

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+D+E++  YDELFSYACPKFITPS P+ ++PL NYNQDAYRLQLKL
Sbjct  356  LKEKYNDKMTKMQRFDEEAYAAYDELFSYACPKFITPSPPALDQPLTNYNQDAYRLQLKL  415

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA YL+VDE TLR+ILMTYKHK H+VD++GKI
Sbjct  416  FLYEVKQQQLLSGIRSYLKLYSTINIAKLAQYLEVDEATLRSILMTYKHKMHAVDNNGKI  475

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHV+ESKP KR+GDYFLRQI+K E ++ ++D+++ +
Sbjct  476  ISSADFDFYIKEDVIHVMESKPIKRHGDYFLRQILKFEEMIGELDKVQFD  525



>gb|EEC70234.1| hypothetical protein OsI_01004 [Oryza sativa Indica Group]
Length=528

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+DDE++  YDELFSYACPKFITPS P+ ++PL NYNQDAYRLQLKL
Sbjct  359  LKEKYNDKMTKMQRFDDEAYAAYDELFSYACPKFITPSPPALDQPLTNYNQDAYRLQLKL  418

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VD++GKI
Sbjct  419  FLYEVKQQQLLSGIRSYLKLYSTITIAKLAQYMEVDEATLRSILMTYKHKMHAVDNNGKI  478

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHV+ESKP KR+GDYFLRQI+K E ++ ++++++ +
Sbjct  479  VSSADFDFYIKEDVIHVMESKPIKRHGDYFLRQILKFEEMIGELEKVQFD  528



>emb|CDM82375.1| unnamed protein product [Triticum aestivum]
Length=522

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+DDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  353  LKEKYNDKMTKMQRFDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  412

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YS I++ KLA Y+++DE TLR+ILMTYKHK H+VDS+GKI
Sbjct  413  FLYEVKQQQLLSGIRSYLKLYSAITITKLAQYMEMDEATLRSILMTYKHKMHAVDSNGKI  472

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I++++IHVVESK +KR+GDYFLRQI+K E  + ++D+++L+
Sbjct  473  VSSADFDFYINEDVIHVVESKSTKRHGDYFLRQILKFEETIAELDKVQLD  522



>gb|EMS61673.1| hypothetical protein TRIUR3_26846 [Triticum urartu]
Length=486

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+DDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  219  LKEKYNDKMTKMQRFDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  278

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YS I++ KLA Y+++DE TLR+ILMTYKHK H+VDS+GKI
Sbjct  279  FLYEVKQQQLLSGIRSYLKLYSAITITKLAQYMEMDEATLRSILMTYKHKMHAVDSNGKI  338

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             S+AD DF+I++++IHVVESK +KR+GDYFLRQI+K E  + ++D++ +
Sbjct  339  VSSADFDFYINEDVIHVVESKSTKRHGDYFLRQILKFEETIAELDKLTV  387



>ref|NP_001042483.1| Os01g0229100 [Oryza sativa Japonica Group]
 dbj|BAD81320.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
 dbj|BAD82419.1| putative eukaryotic translation initiation factor 3 subunit 6 
interacting protein [Oryza sativa Japonica Group]
 dbj|BAF04397.1| Os01g0229100 [Oryza sativa Japonica Group]
 gb|EEE54164.1| hypothetical protein OsJ_00976 [Oryza sativa Japonica Group]
Length=521

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+D+E++  YDELFSYACPKFITPS P+ ++PL NYNQDAYRLQLKL
Sbjct  352  LKEKYNDKMTKMQRFDEETYAAYDELFSYACPKFITPSPPALDQPLTNYNQDAYRLQLKL  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++ KLA Y++VDE TLR+ILMTYKHK H+VD++GKI
Sbjct  412  FLYEVKQQQLLSGIRSYLKLYSTITIAKLAQYMEVDEATLRSILMTYKHKMHAVDNNGKI  471

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S+AD DF+I +++IHV+ESKP KR+GDYFLRQI+K E ++ ++++++ +
Sbjct  472  VSSADFDFYIKEDVIHVMESKPIKRHGDYFLRQILKFEEMIGELEKVQFD  521



>gb|AAT77307.1| unknown protein [Oryza sativa Japonica Group]
Length=541

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 147/182 (81%), Gaps = 12/182 (7%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKYGDKM KM RYDDE++ +YDELFSYACPKFIT S P   EP  NYNQDAYRLQLKL
Sbjct  360  LKEKYGDKMTKMHRYDDEAYAIYDELFSYACPKFITASPPVLREPYTNYNQDAYRLQLKL  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YSTI++GKLA Y+ VDE TLRTILMTYKHK HS+DSDGK+
Sbjct  420  FLYEVKQQQLLSGIRSYLKLYSTITIGKLAKYMDVDEVTLRTILMTYKHKMHSIDSDGKV  479

Query  344  FSNADVDFFIDDEM------------IHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIK  201
             S+AD DF+ID+ M            IHVVESK +K +GDYFLRQI+K E ++T +D+++
Sbjct  480  ISSADFDFYIDECMQQPLVWFPAEDIIHVVESKLTKNHGDYFLRQILKFEEMITQLDKVQ  539

Query  200  LE  195
             +
Sbjct  540  FD  541



>gb|EMT29163.1| hypothetical protein F775_30790 [Aegilops tauschii]
Length=677

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EKY DKM KMQR+DDE++  YDELFSYACPKFITPS P  ++PL NYNQDAYRLQLKL
Sbjct  325  LKEKYNDKMTKMQRFDDEAYAAYDELFSYACPKFITPSPPVLDQPLTNYNQDAYRLQLKL  384

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSG+R+YLK+YS I++ KLA Y+++DE TLR+ILMTYKHK H+VDS+GKI
Sbjct  385  FLYEVKQQQLLSGIRSYLKLYSAITITKLAQYMEMDEATLRSILMTYKHKMHAVDSNGKI  444

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRI  204
             S+AD DF+I++++IHVVESK +KR+GDYFLRQI+K E  + ++D++
Sbjct  445  LSSADFDFYINEDVIHVVESKSTKRHGDYFLRQILKFEETIAELDKL  491



>gb|KJB65718.1| hypothetical protein B456_010G110200 [Gossypium raimondii]
Length=489

 Score =   251 bits (642),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFVIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYSTISL KLANY++VDEPTLRTIL+TYKHKTH+VDSDGKI
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLWKLANYMEVDEPTLRTILLTYKHKTHAVDSDGKI  470

Query  344  FSNADVDFFIDD  309
             SNADVDF+IDD
Sbjct  471  ISNADVDFYIDD  482



>ref|XP_001783486.1| predicted protein [Physcomitrella patens]
 gb|EDQ51676.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKY +KML+MQR D+    ++DELFSYACPKFITPS P+++EPLVN+NQDAYRLQLKL
Sbjct  365  LREKYAEKMLRMQRNDE---AMFDELFSYACPKFITPSPPNYDEPLVNFNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL EV+QQQLLS +R++LK+Y+TIS+ KLA+++ VDEPTLR  L+TYKHKTH +++DG +
Sbjct  422  FLSEVRQQQLLSSIRSFLKLYTTISISKLASFMDVDEPTLRVALLTYKHKTHVINNDGSV  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF+IDD+M+H+ ++K +KR+GDYF+R I K + ++ ++DR +LE
Sbjct  482  LSNADVDFYIDDDMVHIADTKVTKRFGDYFIRHIQKFDEIINELDRTQLE  531



>ref|XP_008357416.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Malus domestica]
Length=508

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPS PSFEEPLVNYNQDAYRLQLKL
Sbjct  361  LREKYGEKMNRMQRYDDEAFAIYDELFSYACPKFITPSPPSFEEPLVNYNQDAYRLQLKL  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLLSGVRT+LKVYS+IS+GKLA+Y++VDE  LRTIL+TYKHKTHSVD++GK+
Sbjct  421  FLYEVKQQQLLSGVRTFLKVYSSISIGKLASYMEVDEAKLRTILLTYKHKTHSVDTEGKV  480

Query  344  FSNADVDFFIDD  309
             SNADVDF+IDD
Sbjct  481  ISNADVDFYIDD  492



>ref|XP_001777172.1| predicted protein [Physcomitrella patens]
 gb|EDQ58057.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKY +KML+MQR D+    ++DELFSYACPKFITPS P+++EPL+N+NQDAYRLQLKL
Sbjct  365  LREKYAEKMLRMQRSDE---AMFDELFSYACPKFITPSPPNYDEPLINFNQDAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL EV+QQQLLS +R++LK+Y+TIS+ KLA+++ VDEPTLR  L+TYKHKTH ++ DG +
Sbjct  422  FLSEVRQQQLLSSIRSFLKLYTTISIAKLASFMDVDEPTLRVALLTYKHKTHVINYDGTV  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             SNADVDF++DD+MIH+ ++K +KR+GDYF+R I K + ++ ++DR +LE
Sbjct  482  LSNADVDFYVDDDMIHIADTKVTKRFGDYFIRHIQKFDEIVNELDRTQLE  531



>ref|XP_010925868.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X2 [Elaeis guineensis]
Length=499

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KY +KMLKMQRYDDE++ +YDELFSYACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  355  LKDKYSEKMLKMQRYDDEAYAVYDELFSYACPKFITPSAPILEEPLTNYNQDAYRLQLKL  414

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FLYEVKQQQLL+GVR++LK+YSTIS+GKLA Y++VDEPTLRTILMTYKHK H+VDSDGKI
Sbjct  415  FLYEVKQQQLLAGVRSFLKLYSTISIGKLATYMEVDEPTLRTILMTYKHKMHAVDSDGKI  474

Query  344  FSNADVDFFIDD  309
              N DVDF+ID+
Sbjct  475  IPNVDVDFYIDE  486



>ref|XP_007012066.1| RNA polymerase I-associated factor PAF67 isoform 4 [Theobroma 
cacao]
 gb|EOY29685.1| RNA polymerase I-associated factor PAF67 isoform 4 [Theobroma 
cacao]
Length=463

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM +MQRYDDE+F +YDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL
Sbjct  351  LREKYGEKMARMQRYDDEAFAIYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLR  402
            FLYEVKQQQLLSGVRT+LKVYSTISLGKLANY++VDEPTLR
Sbjct  411  FLYEVKQQQLLSGVRTFLKVYSTISLGKLANYMEVDEPTLR  451



>ref|XP_002968842.1| hypothetical protein SELMODRAFT_146079 [Selaginella moellendorffii]
 ref|XP_002974131.1| hypothetical protein SELMODRAFT_149527 [Selaginella moellendorffii]
 gb|EFJ25086.1| hypothetical protein SELMODRAFT_149527 [Selaginella moellendorffii]
 gb|EFJ29958.1| hypothetical protein SELMODRAFT_146079 [Selaginella moellendorffii]
Length=531

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+EK G+K+ KM + D+ +F   DE FSYACPKFI+PS P   +   NY+Q+AYRLQLKL
Sbjct  365  LKEKRGEKLSKMHKNDEAAF---DECFSYACPKFISPSLPDLSDTSGNYSQEAYRLQLKL  421

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL EV+QQQLL+ +R Y+K+Y+TIS+ KLA+ ++VDE TLR  LMTYKHKTH +D DG +
Sbjct  422  FLSEVRQQQLLNKIRNYVKLYTTISIAKLASLVEVDEATLRMALMTYKHKTHYIDDDGSV  481

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             S ADV+F+ID++++H+ E K +KR+ + F+R I+K + ++ D++R+ LE
Sbjct  482  ASTADVEFYIDEDVVHIAEPKVTKRFSEIFVRHILKFDELVGDLERVALE  531



>ref|XP_010421431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=111

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  527  LFLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGK  348
            +FLYEVKQQQLLSGVRT+LKVYS+ISL KLA Y++VDE TLRTIL+TYKHKTHSVDS+G 
Sbjct  1    MFLYEVKQQQLLSGVRTFLKVYSSISLAKLAKYMEVDESTLRTILLTYKHKTHSVDSNGG  60

Query  347  IFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
            I SNAD+DF+++++MI+VVESKP KRYGD+FLRQI KLEGV+ D+DR+KL+
Sbjct  61   IISNADIDFYMNNDMIYVVESKPVKRYGDFFLRQIAKLEGVINDMDRVKLD  111



>dbj|BAK07615.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+ KYG +M KM R D  ++  +DELFS+ACPKFI    P  EEP  +YNQD YRLQLKL
Sbjct  353  LKGKYGTEMEKMLRCDGVAY--HDELFSFACPKFIAAWPPVLEEPFTDYNQDVYRLQLKL  410

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDSDGKI  345
            FL EVKQ Q L  +R++LKV+S I++GKLA +++++E +LRTIL+ Y  KTH+VD+ GKI
Sbjct  411  FLDEVKQHQFLGDIRSFLKVFSAITIGKLAQHMKLNEDSLRTILLAYTRKTHAVDNYGKI  470

Query  344  FSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             S+AD DF+ID+E+IH  ESK SK + DYFL  I KLE V+ ++ +++ 
Sbjct  471  TSSADFDFYIDEEIIHATESKSSKHHRDYFLTHISKLEEVIGELGKVQF  519



>ref|XP_010445193.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Camelina sativa]
Length=233

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYG+KM++MQRYDDE+F +YDELFSYACPKFITPSAPSF+EPLVNYNQDAY+LQLK+
Sbjct  133  LREKYGEKMMRMQRYDDEAFGIYDELFSYACPKFITPSAPSFDEPLVNYNQDAYKLQLKM  192

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLR  402
            FLYEV QQQLLS VRT+LKVYS+ISL KLA Y++VD+ TLR
Sbjct  193  FLYEVMQQQLLSEVRTFLKVYSSISLAKLAKYMEVDKSTLR  233



>ref|XP_010925869.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like isoform X3 [Elaeis guineensis]
Length=477

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L++KY +KMLKMQRYDDE++ +YDELFSYACPKFITPSAP  EEPL NYNQDAYRLQLKL
Sbjct  355  LKDKYSEKMLKMQRYDDEAYAVYDELFSYACPKFITPSAPILEEPLTNYNQDAYRLQLKL  414

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILM  390
            FLYEVKQQQLL+GVR++LK+YSTIS+GKLA Y++VDEPTLR   M
Sbjct  415  FLYEVKQQQLLAGVRSFLKLYSTISIGKLATYMEVDEPTLRISYM  459



>gb|EMS65810.1| hypothetical protein TRIUR3_05807 [Triticum urartu]
Length=746

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 118/175 (67%), Gaps = 13/175 (7%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+ KYG +M +M R D E+   YDELFS ACPKFI    P  +EP  NYNQD YRLQLKL
Sbjct  451  LKGKYGTEMEEMLRGDGEAH--YDELFSVACPKFIAAWPPVLKEPFTNYNQDVYRLQLKL  508

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTL-----------RTILMTYKH  378
            FL EVKQQ  L  +R++LKV+S I++G+LA ++++DE  L           R IL+ Y  
Sbjct  509  FLDEVKQQLFLGDIRSFLKVFSVITIGRLAQHMRLDENALRVFRDSNLYMDRAILLAYTR  568

Query  377  KTHSVDSDGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDV  213
            KTH+VD+ GKI S+AD DF+ID+E IH  ESK SK + DYFL  I KLE VM ++
Sbjct  569  KTHAVDNYGKITSSADFDFYIDEETIHATESKSSKHHHDYFLTHISKLEEVMGEL  623



>gb|EMT31868.1| hypothetical protein F775_04668 [Aegilops tauschii]
Length=579

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 112/167 (67%), Gaps = 13/167 (8%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            L+ KYG +M KM R D ++   YDELFS ACPKFI    P  +EP  NYNQD YRLQLKL
Sbjct  284  LKGKYGTEMEKMLRGDGQAH--YDELFSLACPKFIAAWPPVLKEPFTNYNQDVYRLQLKL  341

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTL-----------RTILMTYKH  378
            FL EVKQQ  L  +R++LKV+S I++G+LA ++++DE  L           R IL+ Y  
Sbjct  342  FLDEVKQQLFLGDIRSFLKVFSVITIGRLAQHMRLDENALRVFRDSNLYMDRAILLAYTR  401

Query  377  KTHSVDSDGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVK  237
            KTH+VD+ GKI S+AD DF+ID+E IH  ESK SK + DYFL  I K
Sbjct  402  KTHAVDNYGKITSSADFDFYIDEETIHATESKSSKHHHDYFLTHISK  448



>ref|XP_002199566.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Taeniopygia guttata]
Length=188

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  14   LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  70

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  71   FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  130

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  131  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  175



>ref|XP_010072245.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Pterocles gutturalis]
Length=198

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  24   LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  80

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  81   FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  140

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  141  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  185



>gb|KFU97905.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pterocles gutturalis]
Length=205

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  31   LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  87

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  88   FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  147

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  148  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  192



>gb|ABQ22705.1| eukaryotic translation initiation factor 3 subunit 6-interacting 
protein-like protein [Callithrix jacchus]
Length=185

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  11   LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  67

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  68   FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  127

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  128  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  172



>gb|AAH11448.2| EIF3L protein [Homo sapiens]
Length=188

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  14   LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  70

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  71   FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  130

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  131  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  175



>ref|XP_002591162.1| hypothetical protein BRAFLDRAFT_287258 [Branchiostoma floridae]
 gb|EEN47173.1| hypothetical protein BRAFLDRAFT_287258 [Branchiostoma floridae]
Length=546

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 119/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREK G+KM++MQ+ D ++F   ++ FS+ACPKF++P AP++E P  NY+++A+  QLK+
Sbjct  372  LREKCGEKMIRMQKGDMQAF---EDSFSFACPKFLSPVAPNYEAPPANYHKEAFMAQLKV  428

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSVDS----  357
            F+ EV+QQ  L  VR+YLK+Y+T+ + KLA +L + E   RT L+ +KHK  +V S    
Sbjct  429  FIDEVQQQIALPVVRSYLKLYTTMPVSKLAGFLDMTEEEFRTHLLCFKHKMSNVTSSKGT  488

Query  356  ---DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
               DG+  S ++VDFFID +M+H+ ++K ++RYGD+F+RQI K E
Sbjct  489  GGLDGEFQSASEVDFFIDKDMVHIADTKVARRYGDFFIRQIHKFE  533



>gb|EPY88367.1| eukaryotic translation initiation factor 3 subunit L [Camelus 
ferus]
Length=604

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 124/173 (72%), Gaps = 10/173 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDR  207
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +++++DR
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELLSNLDR  559



>ref|XP_007939846.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Orycteropus afer afer]
Length=297

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 121/174 (70%), Gaps = 10/174 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  123  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  179

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  180  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  239

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRI  204
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + +I
Sbjct  240  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKI  293



>gb|AAX09926.1| putative tyrosine-rich heat shock protein [Aurelia aurita]
Length=224

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 118/171 (69%), Gaps = 10/171 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREK+ DKM +MQ+ D + F   ++ F++ CPKF++P  P+++ P  N N   + LQLK+
Sbjct  49   LREKFADKMNRMQKGDKQCF---EDCFAFGCPKFVSPVPPNYDAPPANTNLVPFNLQLKM  105

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  +  +R++LK+Y+T+ + KLA +L+VDE TLRT L+ YKHK      T   
Sbjct  106  FKTEVEQQIDIPVIRSFLKLYTTMPISKLAAFLEVDEETLRTKLLCYKHKQRNMVWTKGT  165

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDV  213
            D+ +G+  S+++VDF+++ +MIH+ ++K ++RYGD+F+R I K+E +   V
Sbjct  166  DALEGEFQSSSEVDFYLNQDMIHIADTKVARRYGDFFIRHIGKIEDLNRSV  216



>dbj|BAG51322.1| unnamed protein product [Homo sapiens]
 dbj|BAG62872.1| unnamed protein product [Homo sapiens]
Length=297

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  123  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  179

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  180  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  239

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  240  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  284



>ref|NP_001029306.1| eukaryotic translation initiation factor 3 subunit L [Rattus 
norvegicus]
 gb|AAI00265.1| Eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Rattus norvegicus]
Length=382

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  208  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  264

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  265  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  324

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  325  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  369



>ref|NP_001279102.1| eukaryotic translation initiation factor 3, subunit L [Callorhinchus 
milii]
 gb|AFM88048.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Callorhinchus milii]
Length=579

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 123/174 (71%), Gaps = 10/174 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKM++MQ+ D +   +++ELFS+ACPKF++P  P+++    NY+++ +  QLK+
Sbjct  406  LREKYGDKMIRMQKGDPQ---IFEELFSFACPKFLSPVVPNYDAVHANYHKEPFLQQLKV  462

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F+ EV+QQ +LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  V
Sbjct  463  FMDEVQQQSVLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRINLLVFKHKMKNLVWTSGV  522

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRI  204
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + +I
Sbjct  523  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNKSLKKI  576



>dbj|BAC05310.1| unnamed protein product [Homo sapiens]
Length=297

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  123  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  179

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  180  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  239

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+I+ +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  240  SALDGEFQSASEVDFYINKDMIHIADTKAARRYGDFFIRQIHKFE  284



>ref|XP_004466265.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Dasypus novemcinctus]
Length=328

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  154  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  210

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  211  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  270

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  271  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  315



>gb|KFQ24519.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Merops nubicus]
Length=553

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P++E    NY+++ +  QLK+
Sbjct  379  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYENVHPNYHKEPFLQQLKV  435

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  436  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  495

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  496  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  540



>ref|XP_008948320.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Merops nubicus]
Length=555

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P++E    NY+++ +  QLK+
Sbjct  381  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYENVHPNYHKEPFLQQLKV  437

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  438  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  497

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  498  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  542



>emb|CDQ84343.1| unnamed protein product [Oncorhynchus mykiss]
Length=576

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++  L NY+++ ++ QLK+
Sbjct  387  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVLPNYHKEPFQQQLKV  443

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  444  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  503

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  504  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  548



>ref|NP_001167411.1| Eukaryotic translation initiation factor 3 subunit E-interacting 
protein [Salmo salar]
 gb|ACN11021.1| Eukaryotic translation initiation factor 3 subunit E-interacting 
protein [Salmo salar]
Length=576

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++  L NY+++ ++ QLK+
Sbjct  387  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVLPNYHKEPFQQQLKV  443

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  444  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  503

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  504  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  548



>ref|XP_001630146.1| predicted protein [Nematostella vectensis]
 sp|A7SDW5.1|EIF3L_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l [Nematostella vectensis]
 gb|EDO38083.1| predicted protein [Nematostella vectensis]
Length=525

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 115/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREK  +KM K+Q+ D     +++E FSY+CPKF++P  P+F+ P  NYN++ + LQLK+
Sbjct  355  LREKCTEKMQKLQKGD---LQMFEECFSYSCPKFVSPVPPNFDAPPANYNREPFNLQLKV  411

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F+ EV QQ ++  +R+YLK+Y+T+ + KLA +L +DE T R  L+ YKHK      T   
Sbjct  412  FMNEVAQQSMIPVIRSYLKLYTTMPIAKLAAFLDMDEATFRNQLLCYKHKQRNLVWTKGT  471

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
            D  DG+  S+++VDF+ID +MIH+ ++K  +RYG++F+RQI K +
Sbjct  472  DGLDGEQQSSSEVDFYIDRDMIHIADTKVDRRYGEFFMRQIYKFD  516



>ref|NP_998293.1| eukaryotic translation initiation factor 3 subunit L [Danio rerio]
 sp|Q7T2A5.1|EIF3L_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6-interacting protein; AltName: Full=Eukaryotic 
translation initiation factor 3 subunit E-interacting 
protein [Danio rerio]
 gb|AAH54626.1| Eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Danio rerio]
Length=576

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P++E    NY+++ ++ QLK+
Sbjct  389  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYENVHPNYHKEPFQQQLKV  445

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  446  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  505

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + ++ L
Sbjct  506  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMPL  561



>ref|XP_006006932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Latimeria chalumnae]
Length=566

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +Y+ELFS+ACPKF++P  P+++    NY+++ +  QLK+
Sbjct  392  LREKYGDKMLRMQKGD---LQVYEELFSFACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  448

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSV------  363
            F+ EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK  ++      
Sbjct  449  FMEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWISGI  508

Query  362  -DSDGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
               DG+  S ++VDFFID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  509  SALDGEFQSASEVDFFIDKDMIHIADTKVARRYGDFFIRQIHKFE  553



>ref|XP_007238562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Astyanax mexicanus]
Length=574

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P++E    NY+++ ++ QLK+
Sbjct  388  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYENVHPNYHKEPFQQQLKV  444

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  445  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  504

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  505  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  549



>ref|XP_005488658.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Zonotrichia albicollis]
 ref|XP_005527659.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Pseudopodoces humilis]
 ref|XP_009084741.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Serinus canaria]
 ref|XP_009900799.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Picoides pubescens]
Length=516

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|NP_988980.1| eukaryotic translation initiation factor 3 subunit L [Xenopus 
(Silurana) tropicalis]
 sp|Q6P878.1|EIF3L_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6-interacting protein; AltName: Full=Eukaryotic 
translation initiation factor 3 subunit E-interacting 
protein [Xenopus (Silurana) tropicalis]
 gb|AAH61351.1| eukaryotic translation initiation factor 3, subunit L [Xenopus 
(Silurana) tropicalis]
Length=562

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELF+YACPKF++P  P+++    NY+++ Y  QLK+
Sbjct  388  LREKYGDKMLRMQKGDAQ---IYEELFNYACPKFLSPVVPNYDNVHPNYHKEPYLQQLKV  444

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            FL EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  445  FLDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLPEQEFRIQLLVFKHKMKNLVWTSGI  504

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + +G+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  505  SALEGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  549



>ref|XP_005039810.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Ficedula albicollis]
Length=516

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_005150418.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Melopsittacus undulatus]
Length=516

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_009566704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Cuculus canorus]
Length=516

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_008118509.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Anolis carolinensis]
Length=551

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  377  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNMHPNYHKEPFLQQLKV  433

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  434  FAGEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  493

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  494  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  538



>gb|EOB03942.1| Eukaryotic translation initiation factor 3 subunit E-interacting 
protein, partial [Anas platyrhynchos]
Length=537

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  363  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  420  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  479

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  480  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  524



>ref|NP_001080345.1| eukaryotic translation initiation factor 3 subunit L [Xenopus 
laevis]
 sp|Q8AVJ0.1|EIF3L_XENLA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6-interacting protein; AltName: Full=Eukaryotic 
translation initiation factor 3 subunit E-interacting 
protein [Xenopus laevis]
 gb|AAH42253.1| Eif3s6ip-prov protein [Xenopus laevis]
Length=562

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 118/165 (72%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELF+YACPKF++P  P+++    NY+++ Y  QLK+
Sbjct  388  LREKYGDKMLRMQKGDAQ---IYEELFNYACPKFLSPVVPNYDNVNPNYHKEPYLQQLKV  444

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            FL EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  445  FLDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLPEQEFRIQLLVFKHKMKNLVWTSGI  504

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + +G+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  505  SALEGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  549



>gb|KFP56635.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Cariama cristata]
Length=540

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  366  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  422

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  423  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  482

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  483  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  527



>gb|KFM02149.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Aptenodytes forsteri]
 gb|KFO05336.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Balearica regulorum gibbericeps]
 gb|KFQ76170.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Phoenicopterus ruber ruber]
 gb|KFQ81279.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Phaethon lepturus]
 gb|KFV39733.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Gavia stellata]
 gb|KFV95043.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Eurypyga helias]
 gb|KFZ51203.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Podiceps cristatus]
Length=538

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>ref|XP_010409202.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Corvus cornix cornix]
Length=543

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  369  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  425

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  426  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  485

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  486  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  530



>ref|XP_004610559.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Sorex araneus]
Length=516

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLSEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_010154288.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Eurypyga helias]
Length=541

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  367  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  423

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  424  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  483

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  484  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  528



>ref|XP_007069166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chelonia mydas]
Length=540

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  366  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  422

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  423  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  482

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  483  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  527



>ref|XP_009693369.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Cariama cristata]
Length=542

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  368  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  424

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  425  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  484

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  485  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  529



>ref|XP_005016066.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Anas platyrhynchos]
Length=542

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  368  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  424

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  425  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  484

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  485  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  529



>ref|XP_009288372.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Aptenodytes forsteri]
Length=553

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  379  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  435

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  436  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  495

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  496  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  540



>gb|AFK10695.1| Eukaryotic translation initiation factor 3 subunit L [Callorhinchus 
milii]
Length=579

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 123/174 (71%), Gaps = 10/174 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKM++MQ+ D +   +++ELFS+ACPKF++P  P+++    NY+++ +  +LK+
Sbjct  406  LREKYGDKMIRMQKGDPQ---IFEELFSFACPKFLSPVVPNYDAVHANYHREPFLQRLKV  462

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F+ EV+QQ +LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  V
Sbjct  463  FMDEVQQQSVLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRINLLVFKHKMKNLVWTSGV  522

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRI  204
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + +I
Sbjct  523  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNKSLKKI  576



>ref|XP_004589814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ochotona princeps]
Length=400

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  226  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  282

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  283  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  342

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  343  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  387



>ref|XP_006026014.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Alligator sinensis]
Length=516

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_010291773.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Phaethon lepturus]
Length=549

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  375  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  431

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  432  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  491

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  492  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  536



>ref|XP_009808556.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Gavia stellata]
Length=554

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  380  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  436

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  437  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  496

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  497  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  541



>ref|XP_010303092.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Balearica regulorum gibbericeps]
Length=553

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  379  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  435

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  436  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  495

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  496  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  540



>gb|KFQ20375.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Mesitornis unicolor]
Length=552

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  378  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  434

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  435  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  494

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  495  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  539



>ref|XP_005514772.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Columba livia]
Length=550

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  376  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  432

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  433  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  492

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  493  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  537



>ref|XP_005421984.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Geospiza fortis]
Length=562

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  388  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  444

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  445  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  504

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  505  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  549



>gb|KFV68894.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Picoides pubescens]
Length=567

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  393  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  449

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  450  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  509

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  510  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  554



>gb|KFO81701.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Cuculus canorus]
Length=565

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  391  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  447

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  448  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  507

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  508  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  552



>ref|XP_008177541.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Chrysemys picta bellii]
Length=561

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  387  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  443

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  444  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  503

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  504  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  548



>ref|XP_005067033.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Mesocricetus auratus]
 ref|XP_005354271.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Microtus ochrogaster]
Length=516

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_009566703.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Cuculus canorus]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_010192463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Mesitornis unicolor]
Length=559

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  385  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_010583751.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Haliaeetus leucocephalus]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>gb|KFV94330.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Fulmarus glacialis]
Length=538

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>ref|NP_001012553.1| eukaryotic translation initiation factor 3 subunit L [Gallus 
gallus]
 ref|XP_010709447.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Meleagris gallopavo]
 sp|Q5F428.1|EIF3L_CHICK RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l [Gallus gallus]
 emb|CAH65106.1| hypothetical protein RCJMB04_3l6 [Gallus gallus]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_005039809.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Ficedula albicollis]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_002198918.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Taeniopygia guttata]
 ref|XP_005488657.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Zonotrichia albicollis]
 ref|XP_005527658.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Pseudopodoces humilis]
 ref|XP_009084740.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Serinus canaria]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_006119038.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Pelodiscus sinensis]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_005150417.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Melopsittacus undulatus]
Length=564

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_004312203.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tursiops truncatus]
Length=607

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKLE  195
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E V    +R   E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEEVRGLRERCAFE  563



>ref|XP_005322487.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ictidomys tridecemlineatus]
Length=410

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  236  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  292

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  293  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  352

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  353  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  397



>ref|XP_008325793.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cynoglossus semilaevis]
Length=571

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  384  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  440

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  441  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  500

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  501  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  545



>emb|CAG04740.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=587

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  403  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  459

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  460  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  519

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + ++ L
Sbjct  520  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMPL  575



>gb|KFO89757.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Buceros rhinoceros silvestris]
Length=538

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  FSDEVQQQAHLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>ref|XP_006026013.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Alligator sinensis]
 ref|XP_006259021.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Alligator mississippiensis]
Length=564

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_010134484.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Buceros rhinoceros silvestris]
Length=537

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  363  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  420  FSDEVQQQAHLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  479

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  480  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  524



>ref|XP_009580499.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Fulmarus glacialis]
Length=546

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  372  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  428

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  429  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  488

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  489  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  533



>ref|XP_004610560.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Sorex araneus]
Length=564

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLSEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>gb|KFP10230.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Egretta garzetta]
Length=467

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  293  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  349

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV++Q  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  350  FADEVQRQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  409

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  410  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  454



>ref|XP_008428313.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Poecilia reticulata]
Length=566

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  381  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  437

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  438  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  497

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  498  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  542



>ref|XP_007579317.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Poecilia formosa]
Length=566

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  381  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  437

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  438  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  497

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  498  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  542



>ref|XP_003963717.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Takifugu rubripes]
Length=569

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGVMTDVDRIKL  198
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E +   + ++ L
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMPL  557



>ref|XP_005806164.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Xiphophorus maculatus]
Length=570

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|NP_660121.2| eukaryotic translation initiation factor 3 subunit L [Mus musculus]
 sp|Q8QZY1.1|EIF3L_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
L; Short=eIF3l; AltName: Full=66 kDa tyrosine-rich heat 
shock protein; AltName: Full=67 kDa polymerase-associated factor; 
AltName: Full=Eukaryotic translation initiation factor 
3 subunit 6-interacting protein; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit E-interacting protein; 
AltName: Full=HSP-66Y; AltName: Full=PAF67 [Mus musculus]
 dbj|BAB85122.1| tyrosine-rich heat shock protein [Mus musculus]
 gb|AAH24463.1| Eukaryotic translation initiation factor 3, subunit L [Mus musculus]
 dbj|BAC28090.1| unnamed protein product [Mus musculus]
 dbj|BAC35837.1| unnamed protein product [Mus musculus]
 dbj|BAE29941.1| unnamed protein product [Mus musculus]
 dbj|BAE30177.1| unnamed protein product [Mus musculus]
 dbj|BAE39996.1| unnamed protein product [Mus musculus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>dbj|BAE40238.1| unnamed protein product [Mus musculus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_004077546.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Oryzias latipes]
 ref|XP_011483061.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Oryzias latipes]
Length=581

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  396  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHSNYHKEPFQQQLKV  452

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  453  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  512

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  513  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  557



>gb|EFB26726.1| hypothetical protein PANDA_002501 [Ailuropoda melanoleuca]
Length=526

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 118/167 (71%), Gaps = 10/167 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  363  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  419

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  420  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  479

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGV  225
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E V
Sbjct  480  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEEV  526



>ref|XP_008061490.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tarsius syrichta]
Length=439

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  265  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  321

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  322  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  381

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  382  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  426



>ref|XP_009045276.1| hypothetical protein LOTGIDRAFT_110039, partial [Lottia gigantea]
 gb|ESP03794.1| hypothetical protein LOTGIDRAFT_110039, partial [Lottia gigantea]
Length=435

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 117/167 (70%), Gaps = 10/167 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREK  DKML+MQ+ D   F   ++ F++ACPKF++P  P++E    N++++ + LQL++
Sbjct  268  LREKCADKMLRMQKGDVNEF---EQSFAFACPKFLSPVPPNYESLGANFHKEPFGLQLRV  324

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHKTHSV------  363
            FL EV QQ L+  +R+YLK+Y+T+ + KLA ++ VDE TL+T LM +KHK  +V      
Sbjct  325  FLDEVAQQILVPTIRSYLKLYTTLPIYKLAAFMDVDEDTLKTQLMCFKHKMKNVVWTKGT  384

Query  362  -DSDGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGV  225
               DG+  S ++VDF+ID +MIHV ++K ++RYGD+F+RQI K + V
Sbjct  385  SGLDGEFQSASEVDFYIDKDMIHVADTKVARRYGDFFIRQIHKFDEV  431



>gb|EDL04675.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Mus musculus]
Length=565

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  391  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  447

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  448  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  507

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  508  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  552



>ref|XP_003510323.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cricetulus griseus]
 ref|XP_005067032.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Mesocricetus auratus]
 ref|XP_005354270.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Microtus ochrogaster]
 ref|XP_006979194.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Peromyscus maniculatus bairdii]
 ref|XP_007622836.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Cricetulus griseus]
 gb|ERE85142.1| eukaryotic translation initiation factor 3 subunit L-like protein 
[Cricetulus griseus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_003932927.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Saimiri boliviensis boliviensis]
Length=516

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_003772387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Sarcophilus harrisii]
Length=516

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>gb|EDM15826.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein [Rattus norvegicus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_009646036.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Egretta garzetta]
Length=484

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  310  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  366

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV++Q  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  367  FADEVQRQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  426

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  427  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  471



>ref|XP_006799034.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Neolamprologus brichardi]
Length=570

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>dbj|BAE39691.1| unnamed protein product [Mus musculus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>emb|CAC84554.1| 67 kDa polymerase-associated factor PAF67 [Mus musculus]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_004437899.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 3 [Ceratotherium simum simum]
Length=466

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDHVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_007519392.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Erinaceus europaeus]
Length=516

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  V
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGV  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_010737501.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Larimichthys crocea]
Length=572

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_004373902.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Trichechus manatus latirostris]
Length=466

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_006174967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X4 [Camelus ferus]
Length=466

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_005261682.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Homo sapiens]
 gb|EAW60195.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein, isoform CRA_a [Homo sapiens]
 gb|EAW60196.1| eukaryotic translation initiation factor 3, subunit 6 interacting 
protein, isoform CRA_a [Homo sapiens]
 dbj|BAG52737.1| unnamed protein product [Homo sapiens]
Length=466

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_007974518.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L [Chlorocebus sabaeus]
Length=586

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 118/167 (71%), Gaps = 10/167 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  408  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  464

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  465  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  524

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLEGV  225
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E V
Sbjct  525  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEEV  571



>ref|XP_006207132.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X4 [Vicugna pacos]
Length=466

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_006638823.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Lepisosteus oculatus]
Length=578

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  388  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDTVHPNYHKEPFQQQLKV  444

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  445  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMSEQEFRIQLLVFKHKMKNLVWTSGI  504

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  505  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  549



>ref|XP_006890193.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X3 [Elephantulus edwardii]
Length=466

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_008283532.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Stegastes partitus]
Length=572

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_004675725.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Condylura cristata]
Length=466

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_002156786.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Hydra vulgaris]
Length=512

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 120/165 (73%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREK  DKMLKMQ+ D    ++++E FSY+CPKFI+P  P+++    N + D + LQL++
Sbjct  338  LREKMLDKMLKMQKGDT---SVFEECFSYSCPKFISPIPPNYDSSPANSHLDPFNLQLRM  394

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F+ EV+QQ ++  +R+YLK+Y+T+SL KLA+  ++DE TL+T L+ +KHK      T   
Sbjct  395  FMVEVQQQSIIPVIRSYLKLYTTMSLSKLASLSELDEGTLQTALLCFKHKQRTLVWTKGN  454

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
            D+ +G+  S+ + DFFI ++MIH+ ++K ++RYGD+F+RQI+K++
Sbjct  455  DALNGEFQSSPETDFFIGNDMIHIADTKVARRYGDFFIRQILKID  499



>ref|XP_010897229.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Esox lucius]
Length=577

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  387  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  443

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  444  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  503

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  504  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  548



>gb|KFV39542.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Tyto alba]
Length=538

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  E +QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  FADECQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>ref|XP_005927170.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Haplochromis burtoni]
Length=570

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_004559734.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Maylandia zebra]
 ref|XP_005742422.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Pundamilia nyererei]
Length=570

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_003441099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L-like [Oreochromis niloticus]
Length=570

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  385  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  441

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  442  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  501

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  502  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  546



>ref|XP_009964570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Tyto alba]
Length=545

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  371  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  427

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  E +QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  428  FADECQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  487

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  488  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  532



>ref|XP_004410842.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Odobenus rosmarus divergens]
Length=466

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  292  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  348

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  349  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  408

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  409  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  453



>ref|XP_005955682.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Pantholops hodgsonii]
Length=516

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_004437898.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Ceratotherium simum simum]
Length=516

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDHVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_004007032.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Ovis aries]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_005681119.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Capra hircus]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|NP_001229852.1| eukaryotic translation initiation factor 3 subunit L isoform 
2 [Homo sapiens]
 ref|XP_004088481.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Nomascus leucogenys]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_004700302.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Echinops telfairi]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_005379288.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Chinchilla lanigera]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_004279516.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Orcinus orca]
 ref|XP_005895285.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Bos mutus]
 ref|XP_006174966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X3 [Camelus ferus]
 ref|XP_006207131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X3 [Vicugna pacos]
 ref|XP_006071435.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Bubalus bubalis]
 ref|XP_007454103.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Lipotes vexillifer]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_003364345.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 2 [Equus caballus]
 ref|XP_004410841.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 1 [Odobenus rosmarus divergens]
 ref|XP_005625742.1| PREDICTED: eukaryotic translation initiation factor 3, subunit 
L isoform X1 [Canis lupus familiaris]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_005663841.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Sus scrofa]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_005883276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Myotis brandtii]
 ref|XP_008142862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Eptesicus fuscus]
Length=516

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_004883511.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Heterocephalus glaber]
 ref|XP_004845694.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Heterocephalus glaber]
Length=516

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_006890192.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Elephantulus edwardii]
Length=517

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  343  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  399

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  400  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  459

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  460  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  504



>ref|XP_008849507.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Nannospalax galili]
 ref|XP_011217121.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Ailuropoda melanoleuca]
Length=540

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  366  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  422

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  423  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  482

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  483  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  527



>ref|XP_002743807.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Callithrix jacchus]
Length=564

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_003989299.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Felis catus]
 ref|XP_007079456.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Panthera tigris altaica]
Length=564

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_006741022.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Leptonychotes weddellii]
Length=530

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  356  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  412

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  413  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  472

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  473  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  517



>ref|XP_004373901.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 1 [Trichechus manatus latirostris]
Length=516

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  342  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  398

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  399  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  458

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  459  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  503



>ref|XP_001514662.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Ornithorhynchus anatinus]
Length=564

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>gb|KFW87339.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Manacus vitellinus]
Length=553

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  379  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  435

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  E++QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  436  FADELQQQAQLSPIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  495

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  496  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  540



>ref|XP_004634660.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Octodon degus]
Length=512

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  338  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  394

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  395  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  454

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  455  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  499



>ref|XP_010843384.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Bison bison bison]
Length=540

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  366  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  422

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  423  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  482

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  483  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  527



>ref|XP_007519391.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Erinaceus europaeus]
Length=564

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  V
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGV  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_003772386.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform 1 [Sarcophilus harrisii]
Length=564

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_008929890.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Manacus vitellinus]
Length=558

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  384  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  440

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  E++QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  441  FADELQQQAQLSPIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  500

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  501  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  545



>ref|XP_001365166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Monodelphis domestica]
Length=564

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNMHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>gb|KFW73179.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pygoscelis adeliae]
 gb|KGL90715.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Charadrius vociferus]
Length=538

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  E +QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  FADEFQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>dbj|BAD96216.1| eukaryotic translation initiation factor 3 subunit 6 interacting 
protein variant [Homo sapiens]
Length=564

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVYPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_004065481.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L [Gorilla gorilla gorilla]
Length=613

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  439  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  495

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  496  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  555

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  556  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  600



>ref|XP_003804137.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit L [Otolemur garnettii]
Length=616

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  442  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  498

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  499  FADEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  558

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  559  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  603



>dbj|BAG60918.1| unnamed protein product [Homo sapiens]
Length=531

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  357  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  413

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  414  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  473

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  474  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  518



>gb|KFQ49039.1| Eukaryotic translation initiation factor 3 subunit L, partial 
[Pelecanus crispus]
Length=538

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  364  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  420

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
               EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  421  VADEVRQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  480

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  481  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  525



>emb|CDQ66978.1| unnamed protein product [Oncorhynchus mykiss]
Length=706

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D     +++ELFS+ACPKF++P  P+++    NY+++ ++ QLK+
Sbjct  520  LREKYGDKMLRMQKGD---LQVFEELFSFACPKFLSPVVPNYDNVHPNYHKEPFQQQLKV  576

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  577  FAEEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDMTEQEFRIQLLVFKHKMKNLVWTSGI  636

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  637  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  681



>ref|XP_008142863.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X2 [Eptesicus fuscus]
Length=553

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  379  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  435

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  436  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  495

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  496  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  540



>ref|XP_003905570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Papio anubis]
Length=608

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  434  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  490

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  491  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  550

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  551  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  595



>ref|XP_005681118.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L isoform X1 [Capra hircus]
Length=564

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>ref|XP_009491962.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L, partial [Pelecanus crispus]
Length=544

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSYACPKF++P  P+++    NY+++ +  QLK+
Sbjct  370  LREKYGDKMLRMQKGDAQ---VYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  426

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
               EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  427  VADEVRQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  486

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  487  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  531



>ref|XP_003821622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Pan paniscus]
Length=607

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  433  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  489

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  490  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  549

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  550  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  594



>ref|XP_007165699.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
L [Balaenoptera acutorostrata scammoni]
Length=564

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  390  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  446

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  447  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  506

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  507  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  551



>emb|CAG30322.1| dJ1014D13.1 [Homo sapiens]
 emb|CAK54466.1| EIF3S6IP [synthetic construct]
 emb|CAK54765.1| EIF3S6IP [synthetic construct]
 dbj|BAG72548.1| eukaryotic translation initiation factor 3, subunit E interacting 
protein [synthetic construct]
Length=607

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  704  LREKYGDKMLKMQRYDDESFTLYDELFSYACPKFITPSAPSFEEPLVNYNQDAYRLQLKL  525
            LREKYGDKML+MQ+ D +   +Y+ELFSY+CPKF++P  P+++    NY+++ +  QLK+
Sbjct  433  LREKYGDKMLRMQKGDPQ---VYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKV  489

Query  524  FLYEVKQQQLLSGVRTYLKVYSTISLGKLANYLQVDEPTLRTILMTYKHK------THSV  363
            F  EV+QQ  LS +R++LK+Y+T+ + KLA +L + E   R  L+ +KHK      T  +
Sbjct  490  FSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGI  549

Query  362  DS-DGKIFSNADVDFFIDDEMIHVVESKPSKRYGDYFLRQIVKLE  231
             + DG+  S ++VDF+ID +MIH+ ++K ++RYGD+F+RQI K E
Sbjct  550  SALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFE  594



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350