BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017P20

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342637.1|  PREDICTED: polyadenylate-binding protein 8-like    102   2e-22   
ref|XP_004252758.1|  PREDICTED: polyadenylate-binding protein 2-like    101   2e-22   Solanum lycopersicum
ref|XP_011074395.1|  PREDICTED: polyadenylate-binding protein 8-like  99.0    2e-21   Sesamum indicum [beniseed]
ref|XP_011074396.1|  PREDICTED: polyadenylate-binding protein 8-like  99.0    2e-21   Sesamum indicum [beniseed]
gb|AAF66825.1|  poly(A)-binding protein                               95.5    1e-20   Nicotiana tabacum [American tobacco]
ref|XP_009782955.1|  PREDICTED: polyadenylate-binding protein 2-l...  95.9    2e-20   Nicotiana sylvestris
ref|XP_009782956.1|  PREDICTED: polyadenylate-binding protein 2-l...  95.9    2e-20   Nicotiana sylvestris
ref|XP_009606598.1|  PREDICTED: polyadenylate-binding protein 2-l...  95.9    2e-20   Nicotiana tomentosiformis
ref|XP_009606599.1|  PREDICTED: polyadenylate-binding protein 2-l...  95.9    2e-20   Nicotiana tomentosiformis
dbj|BAM15222.1|  poly(A)-binding protein                              95.9    2e-20   Nicotiana tabacum [American tobacco]
emb|CAJ38367.1|  polyA-binding protein                                89.7    3e-19   Plantago major [cart-track plant]
ref|XP_009775186.1|  PREDICTED: polyadenylate-binding protein 2-like  91.3    8e-19   Nicotiana sylvestris
gb|AAK30205.1|AF349964_1  poly(A)-binding protein                     90.5    2e-18   Daucus carota [carrots]
gb|EPS62510.1|  hypothetical protein M569_12280                       87.0    2e-17   Genlisea aurea
ref|XP_008454965.1|  PREDICTED: polyadenylate-binding protein 2       86.3    5e-17   Cucumis melo [Oriental melon]
ref|XP_004136969.1|  PREDICTED: polyadenylate-binding protein 2-like  86.3    5e-17   
gb|AAF63202.1|AF240679_1  poly(A)-binding protein                     86.3    5e-17   Cucumis sativus [cucumbers]
ref|XP_010270544.1|  PREDICTED: polyadenylate-binding protein 2-l...  85.5    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010270536.1|  PREDICTED: polyadenylate-binding protein 2-l...  85.5    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008456143.1|  PREDICTED: polyadenylate-binding protein 8-l...  84.3    2e-16   Cucumis melo [Oriental melon]
ref|XP_003607922.1|  Poly(A)-binding protein                          84.7    2e-16   Medicago truncatula
ref|XP_004161443.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  84.3    2e-16   
ref|XP_004140705.1|  PREDICTED: polyadenylate-binding protein 2-like  84.7    2e-16   Cucumis sativus [cucumbers]
ref|XP_008456142.1|  PREDICTED: polyadenylate-binding protein 2-l...  84.3    2e-16   Cucumis melo [Oriental melon]
ref|XP_002283105.1|  PREDICTED: polyadenylate-binding protein 2       84.3    2e-16   Vitis vinifera
ref|XP_002285190.1|  PREDICTED: polyadenylate-binding protein 2       84.3    3e-16   Vitis vinifera
ref|XP_010107907.1|  Polyadenylate-binding protein 2                  83.6    5e-16   Morus notabilis
ref|XP_003544466.1|  PREDICTED: polyadenylate-binding protein 8-like  82.4    1e-15   Glycine max [soybeans]
ref|XP_007160868.1|  hypothetical protein PHAVU_001G023500g           81.6    2e-15   Phaseolus vulgaris [French bean]
gb|KHG12838.1|  ELAV-like protein 2                                   81.3    3e-15   Gossypium arboreum [tree cotton]
gb|KJB79363.1|  hypothetical protein B456_013G046000                  80.9    4e-15   Gossypium raimondii
gb|KJB79366.1|  hypothetical protein B456_013G046000                  80.9    4e-15   Gossypium raimondii
ref|XP_004499044.1|  PREDICTED: polyadenylate-binding protein 2-l...  80.5    5e-15   Cicer arietinum [garbanzo]
ref|XP_003529405.1|  PREDICTED: polyadenylate-binding protein 8-like  80.1    8e-15   Glycine max [soybeans]
gb|KJB32340.1|  hypothetical protein B456_005G236500                  79.3    1e-14   Gossypium raimondii
gb|KHG19377.1|  Polyadenylate-binding protein 1-like 2                79.3    1e-14   Gossypium arboreum [tree cotton]
ref|XP_006574897.1|  PREDICTED: polyadenylate-binding protein 8-like  79.0    2e-14   Glycine max [soybeans]
gb|KHN05826.1|  Polyadenylate-binding protein 2                       79.0    2e-14   Glycine soja [wild soybean]
gb|KHN12798.1|  Polyadenylate-binding protein 2                       78.6    2e-14   Glycine soja [wild soybean]
ref|XP_003550332.1|  PREDICTED: polyadenylate-binding protein 8-like  78.6    3e-14   Glycine max [soybeans]
ref|XP_006855143.1|  hypothetical protein AMTR_s00051p00026490        78.2    3e-14   Amborella trichopoda
ref|XP_009768210.1|  PREDICTED: polyadenylate-binding protein 8-like  77.8    5e-14   Nicotiana sylvestris
ref|XP_009386707.1|  PREDICTED: polyadenylate-binding protein 2-l...  77.0    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386708.1|  PREDICTED: polyadenylate-binding protein 2-l...  77.0    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386705.1|  PREDICTED: polyadenylate-binding protein 2-l...  77.0    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386706.1|  PREDICTED: polyadenylate-binding protein 2-l...  77.0    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB29450.1|  hypothetical protein B456_005G101600                  77.0    8e-14   Gossypium raimondii
gb|EPS61401.1|  hypothetical protein M569_13396                       76.6    9e-14   Genlisea aurea
gb|EMS55649.1|  Polyadenylate-binding protein 2                       76.6    1e-13   Triticum urartu
ref|XP_009600995.1|  PREDICTED: polyadenylate-binding protein 8-like  76.6    1e-13   Nicotiana tomentosiformis
gb|EMT14398.1|  Polyadenylate-binding protein 2                       76.6    1e-13   
gb|AAB38974.1|  poly(A)-binding protein                               76.6    1e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006346392.1|  PREDICTED: polyadenylate-binding protein 8-like  76.6    1e-13   Solanum tuberosum [potatoes]
dbj|BAJ96406.1|  predicted protein                                    76.6    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF66824.1|AF190656_1  poly(A)-binding protein                     74.3    2e-13   Nicotiana tabacum [American tobacco]
gb|AFP74112.1|  poly-A binding protein                                75.5    3e-13   Nicotiana benthamiana
ref|XP_009613515.1|  PREDICTED: polyadenylate-binding protein 2-like  74.3    7e-13   Nicotiana tomentosiformis
emb|CAN61506.1|  hypothetical protein VITISV_011738                   73.2    9e-13   Vitis vinifera
ref|XP_003589160.1|  Polyadenylate-binding protein                    73.6    1e-12   Medicago truncatula
ref|XP_004956317.1|  PREDICTED: polyadenylate-binding protein 2-like  73.6    1e-12   Setaria italica
ref|XP_004230758.1|  PREDICTED: polyadenylate-binding protein 8-like  73.2    2e-12   Solanum lycopersicum
gb|KCW66377.1|  hypothetical protein EUGRSUZ_F00193                   72.4    2e-12   Eucalyptus grandis [rose gum]
dbj|BAJ53195.1|  JHL03K20.4                                           72.8    2e-12   Jatropha curcas
gb|EPS71660.1|  hypothetical protein M569_03099                       69.3    2e-12   Genlisea aurea
ref|XP_010059905.1|  PREDICTED: polyadenylate-binding protein 2-like  72.8    2e-12   Eucalyptus grandis [rose gum]
gb|KCW66375.1|  hypothetical protein EUGRSUZ_F00193                   72.8    2e-12   Eucalyptus grandis [rose gum]
gb|ADE76290.1|  unknown                                               70.9    3e-12   Picea sitchensis
ref|XP_003576878.1|  PREDICTED: polyadenylate-binding protein 2-like  72.4    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_006434727.1|  hypothetical protein CICLE_v10000537mg           71.2    8e-12   Citrus clementina [clementine]
ref|XP_009415843.1|  PREDICTED: polyadenylate-binding protein 2-like  71.2    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE61291.1|  hypothetical protein OsJ_15377                        70.9    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007201197.1|  hypothetical protein PRUPE_ppa002607mg           70.5    1e-11   Prunus persica
ref|XP_008236485.1|  PREDICTED: polyadenylate-binding protein 8       70.5    1e-11   Prunus mume [ume]
ref|XP_008651618.1|  PREDICTED: uncharacterized protein LOC100381...  70.5    1e-11   
ref|NP_001053248.1|  Os04g0504800                                     70.1    2e-11   
ref|NP_001167831.1|  uncharacterized protein LOC100381531             67.8    2e-11   
gb|EEC77593.1|  hypothetical protein OsI_16552                        70.1    2e-11   Oryza sativa Indica Group [Indian rice]
emb|CAE02947.3|  OSJNBa0014K14.19                                     70.1    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395913.1|  PREDICTED: polyadenylate-binding protein 2-like  70.1    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168063.1|  uncharacterized protein LOC100381794             66.6    3e-11   
ref|XP_006374904.1|  hypothetical protein POPTR_0014s02550g           69.3    3e-11   Populus trichocarpa [western balsam poplar]
gb|KDO84108.1|  hypothetical protein CISIN_1g006282mg                 69.3    4e-11   Citrus sinensis [apfelsine]
gb|KDO84110.1|  hypothetical protein CISIN_1g006282mg                 68.9    4e-11   Citrus sinensis [apfelsine]
ref|XP_011029544.1|  PREDICTED: polyadenylate-binding protein 2-like  69.3    4e-11   Populus euphratica
ref|XP_010093503.1|  Polyadenylate-binding protein 2                  69.3    4e-11   Morus notabilis
gb|KDO84109.1|  hypothetical protein CISIN_1g006282mg                 69.3    4e-11   Citrus sinensis [apfelsine]
ref|XP_003573691.1|  PREDICTED: polyadenylate-binding protein 2-like  69.3    4e-11   Brachypodium distachyon [annual false brome]
ref|XP_006473293.1|  PREDICTED: polyadenylate-binding protein 8-like  68.9    5e-11   Citrus sinensis [apfelsine]
gb|AAB61594.1|  poly(A)-binding protein                               66.2    5e-11   Mesembryanthemum crystallinum
gb|KDO84107.1|  hypothetical protein CISIN_1g006282mg                 68.9    5e-11   Citrus sinensis [apfelsine]
ref|XP_002510185.1|  polyadenylate-binding protein, putative          68.6    7e-11   Ricinus communis
tpg|DAA39543.1|  TPA: hypothetical protein ZEAMMB73_983793            65.9    8e-11   
ref|NP_564554.1|  poly(A) binding protein 8                           68.2    9e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EEC83349.1|  hypothetical protein OsI_28748                        65.5    1e-10   Oryza sativa Indica Group [Indian rice]
gb|AAQ56324.1|  putative poly(A)-binding protein                      65.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE68458.1|  hypothetical protein OsJ_26852                        65.5    1e-10   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA39542.1|  TPA: hypothetical protein ZEAMMB73_983793            67.8    1e-10   
ref|XP_009408013.1|  PREDICTED: polyadenylate-binding protein 2-like  67.8    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA39541.1|  TPA: hypothetical protein ZEAMMB73_983793            67.8    1e-10   
ref|NP_001061515.1|  Os08g0314800                                     67.4    2e-10   
gb|AFW58788.1|  hypothetical protein ZEAMMB73_448418                  64.7    2e-10   
ref|XP_002313862.1|  polyadenylate-binding family protein             67.4    2e-10   
ref|XP_010263472.1|  PREDICTED: polyadenylate-binding protein 2-like  67.4    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009398670.1|  PREDICTED: polyadenylate-binding protein 2-like  67.4    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009147891.1|  PREDICTED: polyadenylate-binding protein 8       67.4    2e-10   Brassica rapa
emb|CDY54068.1|  BnaCnng26160D                                        67.0    2e-10   Brassica napus [oilseed rape]
ref|XP_010691731.1|  PREDICTED: polyadenylate-binding protein 2-like  67.0    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008663371.1|  PREDICTED: polyadenylate-binding protein 2-like  67.0    2e-10   
ref|XP_002448132.1|  hypothetical protein SORBIDRAFT_06g021850        67.0    2e-10   Sorghum bicolor [broomcorn]
ref|XP_006659302.1|  PREDICTED: polyadenylate-binding protein 8-like  67.0    3e-10   Oryza brachyantha
ref|NP_001151785.1|  LOC100285420                                     66.6    3e-10   Zea mays [maize]
ref|XP_002284923.1|  PREDICTED: polyadenylate-binding protein 8 i...  66.2    4e-10   Vitis vinifera
ref|XP_008364810.1|  PREDICTED: polyadenylate-binding protein 8-like  66.2    4e-10   
ref|XP_008220252.1|  PREDICTED: polyadenylate-binding protein 2-like  66.2    4e-10   Prunus mume [ume]
ref|XP_007226962.1|  hypothetical protein PRUPE_ppa002618mg           66.2    4e-10   Prunus persica
ref|XP_002518733.1|  polyadenylate-binding protein, putative          66.2    4e-10   Ricinus communis
gb|ABK94932.1|  unknown                                               65.5    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006421219.1|  hypothetical protein CICLE_v10007158mg           65.5    5e-10   
gb|EYU37653.1|  hypothetical protein MIMGU_mgv1a002809mg              65.9    5e-10   Erythranthe guttata [common monkey flower]
ref|XP_002301171.2|  hypothetical protein POPTR_0002s12570g           65.5    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007153579.1|  hypothetical protein PHAVU_003G0475001g          65.1    8e-10   Phaseolus vulgaris [French bean]
ref|XP_002891531.1|  PAB8 binding protein 8                           65.5    9e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006404818.1|  hypothetical protein EUTSA_v10000075mg           65.1    1e-09   Eutrema salsugineum [saltwater cress]
emb|CDP01307.1|  unnamed protein product                              65.1    1e-09   Coffea canephora [robusta coffee]
ref|XP_008373847.1|  PREDICTED: polyadenylate-binding protein 8-like  64.7    1e-09   
ref|XP_004304018.1|  PREDICTED: polyadenylate-binding protein 8-like  64.7    2e-09   Fragaria vesca subsp. vesca
gb|AGF69179.1|  polyadenylate-binding protein 2-like protein          64.3    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003580095.1|  PREDICTED: polyadenylate-binding protein 2-like  64.3    2e-09   Brachypodium distachyon [annual false brome]
gb|EMS47633.1|  Polyadenylate-binding protein 2                       64.3    2e-09   Triticum urartu
ref|XP_008347611.1|  PREDICTED: polyadenylate-binding protein 8-like  61.6    2e-09   
ref|XP_004499046.1|  PREDICTED: polyadenylate-binding protein 2-l...  63.9    2e-09   
dbj|BAJ86310.1|  predicted protein                                    63.9    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008378021.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    3e-09   
ref|XP_006393217.1|  hypothetical protein EUTSA_v10011289mg           63.5    3e-09   Eutrema salsugineum [saltwater cress]
ref|XP_011017176.1|  PREDICTED: polyadenylate-binding protein 8-like  63.5    3e-09   Populus euphratica
gb|EMT03423.1|  Polyadenylate-binding protein 2                       63.5    3e-09   
ref|XP_008393785.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    3e-09   
ref|XP_010526963.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_004505404.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    4e-09   
ref|XP_009359888.1|  PREDICTED: polyadenylate-binding protein 2-like  63.2    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_010928350.1|  PREDICTED: polyadenylate-binding protein 8-l...  63.2    4e-09   Elaeis guineensis
ref|XP_010928349.1|  PREDICTED: polyadenylate-binding protein 2-l...  63.2    4e-09   Elaeis guineensis
gb|KFK35979.1|  hypothetical protein AALP_AA4G062600                  63.2    6e-09   Arabis alpina [alpine rockcress]
ref|XP_010530761.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  62.4    9e-09   Tarenaya hassleriana [spider flower]
ref|XP_007042478.1|  Poly(A) binding protein 8                        62.4    1e-08   
gb|KJB14629.1|  hypothetical protein B456_002G134900                  62.0    1e-08   Gossypium raimondii
dbj|BAJ97269.1|  predicted protein                                    62.0    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90169.1|  predicted protein                                    62.0    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEW09165.1|  hypothetical protein CL4424Contig1_01                 58.2    1e-08   Pinus radiata
gb|EYU36333.1|  hypothetical protein MIMGU_mgv1a002664mg              62.0    1e-08   Erythranthe guttata [common monkey flower]
gb|KJB14633.1|  hypothetical protein B456_002G134900                  62.0    1e-08   Gossypium raimondii
gb|KFK32750.1|  poly binding protein                                  62.0    1e-08   Arabis alpina [alpine rockcress]
gb|AFG69765.1|  hypothetical protein CL4424Contig1_01                 58.2    1e-08   Pinus taeda
gb|KHG25571.1|  Polyadenylate-binding protein 1-like 2                61.6    2e-08   Gossypium arboreum [tree cotton]
emb|CDO97198.1|  unnamed protein product                              61.6    2e-08   Coffea canephora [robusta coffee]
gb|KJB58541.1|  hypothetical protein B456_009G214100                  61.6    2e-08   Gossypium raimondii
emb|CDO97200.1|  unnamed protein product                              61.6    2e-08   Coffea canephora [robusta coffee]
ref|XP_008795896.1|  PREDICTED: polyadenylate-binding protein 2-like  61.6    2e-08   Phoenix dactylifera
ref|XP_006283328.1|  hypothetical protein CARUB_v10004368mg           61.2    2e-08   Capsella rubella
ref|XP_002300227.1|  polyadenylate-binding family protein             60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010432464.1|  PREDICTED: polyadenylate-binding protein 2-like  60.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010555994.1|  PREDICTED: polyadenylate-binding protein 8       60.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_010437669.1|  PREDICTED: polyadenylate-binding protein 2-like  60.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010447142.1|  PREDICTED: polyadenylate-binding protein 2-like  60.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_011000130.1|  PREDICTED: polyadenylate-binding protein 8-like  60.8    3e-08   Populus euphratica
ref|XP_010447143.1|  PREDICTED: polyadenylate-binding protein 2       60.5    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010432462.1|  PREDICTED: polyadenylate-binding protein 2-l...  60.5    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010527159.1|  PREDICTED: polyadenylate-binding protein 4-like  60.5    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_007017178.1|  Poly(A) binding protein 8 isoform 1              60.5    4e-08   
gb|EMT11581.1|  Polyadenylate-binding protein 2                       58.2    4e-08   
gb|AID60122.1|  poly(A) binding protein 8                             60.5    4e-08   Brassica napus [oilseed rape]
ref|XP_010531254.1|  PREDICTED: polyadenylate-binding protein 4       60.5    4e-08   Tarenaya hassleriana [spider flower]
ref|XP_011000826.1|  PREDICTED: polyadenylate-binding protein 8-like  60.5    4e-08   Populus euphratica
emb|CDX75397.1|  BnaA01g03050D                                        60.5    4e-08   
emb|CDX69025.1|  BnaC01g04280D                                        60.5    4e-08   
emb|CDX89562.1|  BnaC04g35810D                                        60.5    4e-08   
ref|XP_006422975.1|  hypothetical protein CICLE_v10027999mg           60.1    5e-08   Citrus clementina [clementine]
ref|XP_008788846.1|  PREDICTED: polyadenylate-binding protein 2-like  60.1    5e-08   Phoenix dactylifera
ref|XP_006295403.1|  hypothetical protein CARUB_v10024499mg           60.1    6e-08   Capsella rubella
gb|KJB32341.1|  hypothetical protein B456_005G236500                  60.1    6e-08   Gossypium raimondii
gb|KJB40266.1|  hypothetical protein B456_007G054700                  59.7    6e-08   Gossypium raimondii
ref|XP_009108756.1|  PREDICTED: polyadenylate-binding protein 2       59.7    7e-08   Brassica rapa
emb|CDY51957.1|  BnaA08g11610D                                        59.7    7e-08   Brassica napus [oilseed rape]
emb|CDY62723.1|  BnaC03g77220D                                        59.7    7e-08   Brassica napus [oilseed rape]
ref|XP_002869174.1|  predicted protein                                59.7    8e-08   
gb|KJB40264.1|  hypothetical protein B456_007G054700                  59.3    9e-08   Gossypium raimondii
gb|KJB40263.1|  hypothetical protein B456_007G054700                  59.3    9e-08   Gossypium raimondii
ref|XP_009140459.1|  PREDICTED: polyadenylate-binding protein 4-like  59.3    1e-07   Brassica rapa
emb|CDY38939.1|  BnaA04g13600D                                        59.3    1e-07   Brassica napus [oilseed rape]
gb|KCW55175.1|  hypothetical protein EUGRSUZ_I01129                   58.9    1e-07   Eucalyptus grandis [rose gum]
ref|XP_010028424.1|  PREDICTED: polyadenylate-binding protein 2       59.3    1e-07   Eucalyptus grandis [rose gum]
gb|KHG04753.1|  Polyadenylate-binding 2 -like protein                 58.9    1e-07   Gossypium arboreum [tree cotton]
ref|XP_002878680.1|  PAB4 binding protein 4                           58.5    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010110808.1|  Polyadenylate-binding protein 2                  58.5    2e-07   Morus notabilis
gb|KHG04776.1|  Polyadenylate-binding 2 -like protein                 58.5    2e-07   Gossypium arboreum [tree cotton]
dbj|BAD94406.1|  putative poly(A) binding protein                     55.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71223.1|  BnaC07g05020D                                        58.2    2e-07   
emb|CDY36634.1|  BnaA07g04230D                                        58.2    2e-07   Brassica napus [oilseed rape]
ref|XP_010417088.1|  PREDICTED: polyadenylate-binding protein 4-like  58.2    2e-07   Camelina sativa [gold-of-pleasure]
gb|KFK40021.1|  hypothetical protein AALP_AA3G319900                  58.2    3e-07   Arabis alpina [alpine rockcress]
ref|XP_010519297.1|  PREDICTED: polyadenylate-binding protein 8-like  57.8    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_006412275.1|  hypothetical protein EUTSA_v10024683mg           57.8    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009117148.1|  PREDICTED: polyadenylate-binding protein 2       57.4    4e-07   Brassica rapa
gb|KJB14632.1|  hypothetical protein B456_002G134900                  57.4    4e-07   Gossypium raimondii
ref|XP_006412276.1|  hypothetical protein EUTSA_v10024683mg           57.4    4e-07   
ref|XP_006409548.1|  hypothetical protein EUTSA_v10022589mg           57.4    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010429282.1|  PREDICTED: polyadenylate-binding protein 4       57.0    5e-07   Camelina sativa [gold-of-pleasure]
gb|KFK30042.1|  hypothetical protein AALP_AA7G209600                  57.0    5e-07   Arabis alpina [alpine rockcress]
ref|XP_007047341.1|  Poly(A) binding protein 8                        57.0    6e-07   
emb|CDX79295.1|  BnaC06g20080D                                        53.5    6e-07   
ref|NP_179916.1|  poly(A) binding protein 4                           57.0    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25927.1|AF360217_1  putative poly(A) binding protein            57.0    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KCW66376.1|  hypothetical protein EUGRSUZ_F00193                   56.2    9e-07   Eucalyptus grandis [rose gum]
dbj|BAD94856.1|  poly(A)-binding protein                              53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119410.1|  PREDICTED: polyadenylate-binding protein 2       56.2    1e-06   Brassica rapa
gb|KHN22334.1|  Polyadenylate-binding protein 2                       56.2    1e-06   Glycine soja [wild soybean]
ref|XP_003525892.1|  PREDICTED: polyadenylate-binding protein 8-like  56.2    1e-06   Glycine max [soybeans]
gb|KHG16756.1|  Polyadenylate-binding 2 -like protein                 55.8    1e-06   Gossypium arboreum [tree cotton]
emb|CDY08990.1|  BnaC01g31010D                                        52.8    1e-06   Brassica napus [oilseed rape]
gb|EYU42687.1|  hypothetical protein MIMGU_mgv1a002746mg              55.8    1e-06   Erythranthe guttata [common monkey flower]
gb|EYU36334.1|  hypothetical protein MIMGU_mgv1a002624mg              55.8    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_011092553.1|  PREDICTED: polyadenylate-binding protein 2-like  55.8    1e-06   Sesamum indicum [beniseed]
ref|XP_006425947.1|  hypothetical protein CICLE_v10025109mg           55.8    2e-06   
ref|XP_006425948.1|  hypothetical protein CICLE_v10025109mg           55.8    2e-06   Citrus clementina [clementine]
ref|NP_001275799.1|  poly A-binding protein 2                         55.8    2e-06   Citrus sinensis [apfelsine]
gb|KDO79129.1|  hypothetical protein CISIN_1g006290mg                 55.8    2e-06   Citrus sinensis [apfelsine]
ref|XP_006494495.1|  PREDICTED: polyadenylate-binding protein 4       55.8    2e-06   
dbj|BAJ53194.1|  JHL03K20.3                                           55.8    2e-06   Jatropha curcas
gb|KDP31970.1|  hypothetical protein JCGZ_12431                       55.5    2e-06   Jatropha curcas
emb|CBI19492.3|  unnamed protein product                              52.8    2e-06   Vitis vinifera
ref|XP_009136273.1|  PREDICTED: polyadenylate-binding protein 2-l...  55.5    2e-06   Brassica rapa
ref|XP_009136272.1|  PREDICTED: polyadenylate-binding protein 2-l...  55.5    2e-06   Brassica rapa
gb|AFK34295.1|  unknown                                               52.0    2e-06   Medicago truncatula
pdb|2DYD|A  Chain A, Solution Structure Of The Pabc Domain From T...  51.2    3e-06   Triticum aestivum [Canadian hard winter wheat]
emb|CDX89664.1|  BnaC03g45780D                                        54.3    4e-06   
ref|XP_008787484.1|  PREDICTED: polyadenylate-binding protein 2-like  54.3    5e-06   
emb|CBI32381.3|  unnamed protein product                              54.3    5e-06   Vitis vinifera
gb|AAL86321.1|  putative poly(A)-binding protein                      53.9    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195137.5|  polyadenylate-binding protein 2                     53.9    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863435.1|  predicted protein                                53.5    5e-06   
ref|NP_001062583.1|  Os09g0115400                                     53.9    6e-06   
ref|XP_010261307.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  53.9    7e-06   
ref|XP_010688794.1|  PREDICTED: polyadenylate-binding protein 2-like  53.9    7e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006661030.1|  PREDICTED: polyadenylate-binding protein 8-like  53.5    8e-06   
ref|XP_003523956.1|  PREDICTED: polyadenylate-binding protein 8 i...  53.5    8e-06   Glycine max [soybeans]
gb|KHN04485.1|  Polyadenylate-binding protein 2                       53.5    9e-06   Glycine soja [wild soybean]
ref|XP_006578033.1|  PREDICTED: polyadenylate-binding protein 8 i...  53.5    9e-06   Glycine max [soybeans]
ref|XP_006578034.1|  PREDICTED: polyadenylate-binding protein 8 i...  53.5    9e-06   Glycine max [soybeans]
ref|XP_011044832.1|  PREDICTED: polyadenylate-binding protein 3-like  53.5    9e-06   Populus euphratica
ref|XP_002307526.2|  hypothetical protein POPTR_0005s22040g           53.1    1e-05   
ref|XP_003603074.1|  Poly(A)-binding protein                          53.1    1e-05   Medicago truncatula
ref|XP_007201196.1|  hypothetical protein PRUPE_ppa002584mg           52.4    2e-05   Prunus persica
ref|XP_008237538.1|  PREDICTED: polyadenylate-binding protein 3-like  52.0    3e-05   
emb|CDY67364.1|  BnaA03g57630D                                        51.2    3e-05   Brassica napus [oilseed rape]
ref|XP_004978120.1|  PREDICTED: polyadenylate-binding protein 2-like  52.0    3e-05   
ref|XP_006842170.1|  hypothetical protein AMTR_s00078p00149860        51.6    3e-05   
ref|XP_009342699.1|  PREDICTED: polyadenylate-binding protein 3       50.4    8e-05   Pyrus x bretschneideri [bai li]
ref|XP_011092554.1|  PREDICTED: polyadenylate-binding protein 2-like  50.4    8e-05   Sesamum indicum [beniseed]
gb|KJB63886.1|  hypothetical protein B456_010G021800                  50.1    1e-04   Gossypium raimondii
gb|KJB63885.1|  hypothetical protein B456_010G021800                  50.1    1e-04   Gossypium raimondii
ref|XP_010906556.1|  PREDICTED: polyadenylate-binding protein 2-l...  50.1    1e-04   Elaeis guineensis
ref|XP_010906557.1|  PREDICTED: polyadenylate-binding protein 8-l...  49.7    1e-04   
ref|XP_008337230.1|  PREDICTED: polyadenylate-binding protein 3-like  49.3    2e-04   
ref|XP_009335160.1|  PREDICTED: polyadenylate-binding protein 3       49.3    2e-04   
ref|XP_011459765.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  48.9    3e-04   Fragaria vesca subsp. vesca
ref|XP_006434548.1|  hypothetical protein CICLE_v10003530mg           48.9    3e-04   Citrus clementina [clementine]
ref|XP_009402160.1|  PREDICTED: polyadenylate-binding protein 5-like  48.5    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO83840.1|  hypothetical protein CISIN_1g006641mg                 48.5    3e-04   Citrus sinensis [apfelsine]
ref|XP_010089427.1|  Polyadenylate-binding protein 3                  48.5    4e-04   
emb|CAN75447.1|  hypothetical protein VITISV_030926                   48.5    4e-04   Vitis vinifera
emb|CBI29360.3|  unnamed protein product                              48.5    4e-04   Vitis vinifera
ref|XP_010645822.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  48.5    4e-04   
ref|XP_004496415.1|  PREDICTED: polyadenylate-binding protein 3-l...  48.1    5e-04   Cicer arietinum [garbanzo]
ref|XP_004496416.1|  PREDICTED: polyadenylate-binding protein 3-l...  48.1    5e-04   Cicer arietinum [garbanzo]
ref|XP_002527095.1|  polyadenylate-binding protein, putative          47.4    8e-04   Ricinus communis
ref|XP_004291087.1|  PREDICTED: polyadenylate-binding protein 2-like  47.4    0.001   Fragaria vesca subsp. vesca



>ref|XP_006342637.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=665

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            NV DGPMPGV GGM+S+PYDMGGMLPRDAA   PVPI+ LA+ALANAPPEQQRTMLGE+L
Sbjct  533  NVPDGPMPGVAGGMLSVPYDMGGMLPRDAAMGQPVPISTLATALANAPPEQQRTMLGESL  592

Query  12   YPLV  1
            YPLV
Sbjct  593  YPLV  596



>ref|XP_004252758.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=666

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            NV DGPMPGV GGM+S+PYDMGGMLPRDAA    PVPI+ LA+ALANAPPEQQRTMLGE+
Sbjct  533  NVPDGPMPGVAGGMLSVPYDMGGMLPRDAAAMGQPVPISTLATALANAPPEQQRTMLGES  592

Query  15   LYPLV  1
            LYPLV
Sbjct  593  LYPLV  597



>ref|XP_011074395.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            NV D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENL
Sbjct  523  NVPDVPIPGVAGGMLSVPYDMGGMLPRDAAVPQPMPITALASALANATPEQQRTMLGENL  582

Query  12   YPLV  1
            YPLV
Sbjct  583  YPLV  586



>ref|XP_011074396.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            NV D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENL
Sbjct  523  NVPDVPIPGVAGGMLSVPYDMGGMLPRDAAIPQPMPITALASALANATPEQQRTMLGENL  582

Query  12   YPLV  1
            YPLV
Sbjct  583  YPLV  586



>gb|AAF66825.1| poly(A)-binding protein [Nicotiana tabacum]
Length=479

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  351  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  410

Query  3    V  1
            V
Sbjct  411  V  411



>ref|XP_009782955.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  533  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  592

Query  3    V  1
            V
Sbjct  593  V  593



>ref|XP_009782956.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=658

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  530  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  589

Query  3    V  1
            V
Sbjct  590  V  590



>ref|XP_009606598.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=660

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  532  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  591

Query  3    V  1
            V
Sbjct  592  V  592



>ref|XP_009606599.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=657

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  529  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  588

Query  3    V  1
            V
Sbjct  589  V  589



>dbj|BAM15222.1| poly(A)-binding protein [Nicotiana tabacum]
Length=657

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  529  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  588

Query  3    V  1
            V
Sbjct  589  V  589



>emb|CAJ38367.1| polyA-binding protein [Plantago major]
Length=314

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  13
            NV D PM G GGM S+PYDM GMLPRDAA    P+P+TALASALANA PEQQRTMLGENL
Sbjct  182  NVPDVPMTG-GGMFSVPYDMTGMLPRDAAAIPQPMPVTALASALANATPEQQRTMLGENL  240

Query  12   YPLV  1
            YPLV
Sbjct  241  YPLV  244



>ref|XP_009775186.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=662

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N  + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ LASALANAPPEQQRTMLGE+L
Sbjct  531  NGQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISTLASALANAPPEQQRTMLGESL  590

Query  12   YPLV  1
            YPLV
Sbjct  591  YPLV  594



>gb|AAK30205.1|AF349964_1 poly(A)-binding protein [Daucus carota]
Length=658

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            NV D  MPGVGG M+ +PY+MGGMLPR+AA   P+PITALASALANAP +QQRTMLGENL
Sbjct  528  NVGDVTMPGVGGGMLPVPYNMGGMLPREAAMGQPMPITALASALANAPADQQRTMLGENL  587

Query  12   YPLV  1
            YPLV
Sbjct  588  YPLV  591



>gb|EPS62510.1| hypothetical protein M569_12280, partial [Genlisea aurea]
Length=524

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 4/63 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+P  GG++S+PYDMGGMLPRD A   P+PITALASALANA  EQQRTMLGENLY
Sbjct  401  NMPDVPIPS-GGLLSVPYDMGGMLPRDVAIPQPMPITALASALANATLEQQRTMLGENLY  459

Query  9    PLV  1
            PLV
Sbjct  460  PLV  462



>ref|XP_008454965.1| PREDICTED: polyadenylate-binding protein 2 [Cucumis melo]
Length=649

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_004136969.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 ref|XP_004159899.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN43917.1| hypothetical protein Csa_7G073530 [Cucumis sativus]
Length=649

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>gb|AAF63202.1|AF240679_1 poly(A)-binding protein [Cucumis sativus]
Length=649

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_010270544.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=648

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 53/65 (82%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  511  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  570

Query  15   LYPLV  1
            LYPLV
Sbjct  571  LYPLV  575



>ref|XP_010270536.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=654

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 53/65 (82%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  517  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  576

Query  15   LYPLV  1
            LYPLV
Sbjct  577  LYPLV  581



>ref|XP_008456143.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Cucumis 
melo]
Length=552

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  418  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  477

Query  3    V  1
            V
Sbjct  478  V  478



>ref|XP_003607922.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES90119.1| polyadenylate-binding protein [Medicago truncatula]
Length=654

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            DGPMPGV GGM S+PYD+GGM  RDA+    +PI ALAS LANA PEQQRTMLGENLYPL
Sbjct  524  DGPMPGVAGGMYSVPYDVGGMPIRDASLSQQIPIGALASHLANASPEQQRTMLGENLYPL  583

Query  3    V  1
            V
Sbjct  584  V  584



>ref|XP_004161443.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2-like [Cucumis sativus]
Length=576

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  442  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  501

Query  3    V  1
            V
Sbjct  502  V  502



>ref|XP_004140705.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN57514.1| hypothetical protein Csa_3G202720 [Cucumis sativus]
Length=654

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_008456142.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=654

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CBI21386.3| unnamed protein product [Vitis vinifera]
Length=654

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N++D P+PGV GGM+S PYDM GM  RDAA   P+PI ALA+ALANAPP+QQRT+LGENL
Sbjct  521  NMADVPIPGVPGGMLSAPYDMAGMPFRDAAVSQPMPIGALATALANAPPDQQRTLLGENL  580

Query  12   YPLV  1
            YPLV
Sbjct  581  YPLV  584



>ref|XP_002285190.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CAN65906.1| hypothetical protein VITISV_004873 [Vitis vinifera]
Length=648

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 4/63 (6%)
 Frame = -3

Query  177  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            +SD PMPGV GGMVS+PYDMGGM   DAA    +P+ ALA+ALANAPP +QRTMLGENLY
Sbjct  520  LSDVPMPGVAGGMVSVPYDMGGMPLHDAAISQSIPVGALATALANAPPAEQRTMLGENLY  579

Query  9    PLV  1
            PLV
Sbjct  580  PLV  582



>ref|XP_010107907.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC17307.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=651

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+P+DMGGM  RDA    P+PI A+A+ALANA PEQQRTMLGENLYPL
Sbjct  520  DVPMPGVAGGMFSVPFDMGGMPLRDAGMSQPIPIGAMATALANATPEQQRTMLGENLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN35693.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=652

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  521  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  580

Query  9    PLV  1
            PLV
Sbjct  581  PLV  583



>ref|XP_007160868.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
 gb|ESW32862.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
Length=651

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+ GV GGM+S+PYDMGG+  RD+   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDSVGQPMPIQALATALANAPPEQQRTMLGEALY  579

Query  9    PLV  1
            PLV
Sbjct  580  PLV  582



>gb|KHG12838.1| ELAV-like protein 2 [Gossypium arboreum]
Length=648

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  3    V  1
            V
Sbjct  576  V  576



>gb|KJB79363.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=648

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  3    V  1
            V
Sbjct  576  V  576



>gb|KJB79366.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=649

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  517  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  576

Query  3    V  1
            V
Sbjct  577  V  577



>ref|XP_004499044.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499045.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=648

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRTMLGE LY
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTMLGEALY  579

Query  9    PLV  1
            PLV
Sbjct  580  PLV  582



>ref|XP_003529405.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN43051.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=651

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D P+PGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  521  DVPIPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  580

Query  3    V  1
            V
Sbjct  581  V  581



>gb|KJB32340.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=647

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLSQPIPIGALASALANATPEQQRTMLGENLYPLV  575



>gb|KHG19377.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=647

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLAQPIPIGALASALANATPEQQRTMLGENLYPLV  575



>ref|XP_006574897.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  3    V  1
            V
Sbjct  578  V  578



>gb|KHN05826.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=648

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  3    V  1
            V
Sbjct  578  V  578



>gb|KHN12798.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=654

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  523  NMQDVPLQVAAGGMLSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  582

Query  9    PLV  1
            PLV
Sbjct  583  PLV  585



>ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=654

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  523  NMQDVPLQVAAGGMLSVPYDMGGLPMRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  582

Query  9    PLV  1
            PLV
Sbjct  583  PLV  585



>ref|XP_006855143.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
 gb|ERN16610.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
Length=654

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+PGV GGM+S+PYDMG +  R++    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  518  NMPDVPLPGVAGGMLSVPYDMGSVPLRESGISQPIPIGALASALANATPEQQRTMLGESL  577

Query  12   YPLV  1
            YPLV
Sbjct  578  YPLV  581



>ref|XP_009768210.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana sylvestris]
Length=649

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANASPTEQRTMLGENLYPL  578

Query  3    V  1
            V
Sbjct  579  V  579



>ref|XP_009386707.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=653

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  520  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  578

Query  12   YPLV  1
            YPLV
Sbjct  579  YPLV  582



>ref|XP_009386708.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  519  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  577

Query  12   YPLV  1
            YPLV
Sbjct  578  YPLV  581



>ref|XP_009386705.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  525  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  583

Query  12   YPLV  1
            YPLV
Sbjct  584  YPLV  587



>ref|XP_009386706.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  524  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  582

Query  12   YPLV  1
            YPLV
Sbjct  583  YPLV  586



>gb|KJB29450.1| hypothetical protein B456_005G101600 [Gossypium raimondii]
Length=648

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 3/53 (6%)
 Frame = -3

Query  150  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            GGM+S+PYDMG M  RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV
Sbjct  525  GGMLSIPYDMGSMPVRDAGSGQPIPVTALATSLANATPEQQRTMLGESLYPLV  577



>gb|EPS61401.1| hypothetical protein M569_13396, partial [Genlisea aurea]
Length=551

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = -3

Query  150  GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            GGMVS PYDM  M+P+   P+PITALASALAN+ PEQQRTMLGENLYPLV
Sbjct  446  GGMVSSPYDMVAMIPQQ--PMPITALASALANSTPEQQRTMLGENLYPLV  493



>gb|EMS55649.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=625

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  495  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  554



>ref|XP_009600995.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana tomentosiformis]
 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum]
Length=649

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  578

Query  3    V  1
            V
Sbjct  579  V  579



>gb|EMT14398.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=573

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  443  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  502



>gb|AAB38974.1| poly(A)-binding protein [Triticum aestivum]
Length=651

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  521  DPAMHGVGGVMTSPYEMGGMPMRDAGESQPVPIGALASALANSPPETQRMMLGENLYPLV  580



>ref|XP_006346392.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=643

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRDAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>dbj|BAJ96406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  614  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  673



>gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana tabacum]
Length=330

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  200  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  259

Query  3    V  1
            V
Sbjct  260  V  260



>gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana]
Length=643

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 4/58 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            DG  PGVGG M S+PYD+GG   R   P+P+ ALA+ALANA P +QRTMLGENLYPLV
Sbjct  519  DGAFPGVGGGMFSIPYDIGG---RIVQPIPVGALATALANASPTEQRTMLGENLYPLV  573



>ref|XP_009613515.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=663

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N  + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ALASALANAPPEQQRTMLGE+L
Sbjct  532  NGQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISALASALANAPPEQQRTMLGESL  591

Query  12   YPLV  1
            YPLV
Sbjct  592  YPLV  595



>emb|CAN61506.1| hypothetical protein VITISV_011738 [Vitis vinifera]
Length=433

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S+PYDMG ML RDA    P+ I+ LAS  A+   +QQRTMLGE+L
Sbjct  338  NMLDSPMPGVAGGMLSIPYDMGDMLLRDAXFXQPILISXLASTHASVASDQQRTMLGESL  397

Query  12   YPLV  1
            YPL+
Sbjct  398  YPLL  401



>ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES59411.1| polyadenylate-binding protein [Medicago truncatula]
Length=647

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPL  4
            N+ D P+  +GG + + YDMGG+  RD  P +PI ALA+ALANAPPEQQRTMLGE LYPL
Sbjct  521  NIQDAPVQNIGGGM-MSYDMGGLPLRDVVPPMPIHALATALANAPPEQQRTMLGEALYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>ref|XP_004956317.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=664

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            M GVG ++  PY+MGGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  535  MHGVGAVMPSPYEMGGMPIRDAGVSQPVPIGALATALANAPPDQQRLMLGENLYPLV  591



>ref|XP_004230758.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum lycopersicum]
Length=643

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D   PGVGG M S+PYDMGGM  R A    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRAAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>gb|KCW66377.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=441

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  307  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  366

Query  9    PLV  1
            PLV
Sbjct  367  PLV  369



>dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas]
Length=642

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM G+ GGM+ +PYDMGGM  RD A   PV   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPVQTGALATALANAMPEQQRTLLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>gb|EPS71660.1| hypothetical protein M569_03099, partial [Genlisea aurea]
Length=150

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = -3

Query  150  GGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            GGMV+LPYDMGG   R+    A PVPI ALASALANA P +QRT+LGE+LYPLV
Sbjct  33   GGMVTLPYDMGGFPLREIGIPAQPVPIGALASALANATPAEQRTLLGESLYPLV  86



>ref|XP_010059905.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
 gb|KCW66374.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=657

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  523  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  582

Query  9    PLV  1
            PLV
Sbjct  583  PLV  585



>gb|KCW66375.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=627

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  493  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  552

Query  9    PLV  1
            PLV
Sbjct  553  PLV  555



>gb|ADE76290.1| unknown [Picea sitchensis]
Length=313

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 6/66 (9%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-----PVPITALASALANAPPEQQRTMLGE  19
            NV++ P+ GV GGM  LP DMGG+  R A      P+PI ALASALANA PEQQRTMLGE
Sbjct  179  NVNEIPLSGVAGGMHPLPLDMGGLPLRAAETTISQPIPIGALASALANATPEQQRTMLGE  238

Query  18   NLYPLV  1
            +LYPLV
Sbjct  239  SLYPLV  244



>ref|XP_003576878.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=653

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  M GVGG +  PY++GGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  523  DPAMHGVGGGMPSPYEIGGMPMRDAGASQPVPIGALATALANAPPDQQRMMLGENLYPLV  582



>ref|XP_006434727.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47967.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=651

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G GGM+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  517  NMQDFPFDMGAGGMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  576

Query  15   LYPLV  1
            LYPLV
Sbjct  577  LYPLV  581



>ref|XP_009415843.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ + PMPG  GGM+S PYDMG +  R+AA   P+P   LASALANA PEQQRTMLGE+L
Sbjct  516  NIPEVPMPGAPGGMLS-PYDMGSLPIREAAISQPIPTGTLASALANANPEQQRTMLGESL  574

Query  12   YPLV  1
            YPLV
Sbjct  575  YPLV  578



>gb|EEE61291.1| hypothetical protein OsJ_15377 [Oryza sativa Japonica Group]
Length=613

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -3

Query  165  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLV  1
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  486  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLV  542



>ref|XP_007201197.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
 gb|EMJ02396.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
Length=653

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  3    V  1
            V
Sbjct  582  V  582



>ref|XP_008236485.1| PREDICTED: polyadenylate-binding protein 8 [Prunus mume]
Length=653

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  3    V  1
            V
Sbjct  582  V  582



>ref|XP_008651618.1| PREDICTED: uncharacterized protein LOC100381531 isoform X1 [Zea 
mays]
Length=656

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV
Sbjct  527  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLV  583



>ref|NP_001053248.1| Os04g0504800 [Oryza sativa Japonica Group]
 emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa Japonica Group]
 dbj|BAF15162.1| Os04g0504800 [Oryza sativa Japonica Group]
 dbj|BAG90316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -3

Query  165  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLV  1
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  532  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLV  588



>ref|NP_001167831.1| uncharacterized protein LOC100381531 [Zea mays]
 gb|ACN26239.1| unknown [Zea mays]
Length=249

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV
Sbjct  120  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLV  176



>gb|EEC77593.1| hypothetical protein OsI_16552 [Oryza sativa Indica Group]
Length=659

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -3

Query  165  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLV  1
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  532  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLV  588



>emb|CAE02947.3| OSJNBa0014K14.19 [Oryza sativa Japonica Group]
Length=657

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -3

Query  165  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLV  1
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  530  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLV  586



>ref|XP_009395913.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 5/64 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV  GM+S PY+MGG+  RD     P+PI ALASALAN+ PEQQR MLGE+L
Sbjct  519  NMPDVPMPGVVSGMLS-PYEMGGLPMRDVPIPQPIPIGALASALANSTPEQQRMMLGESL  577

Query  12   YPLV  1
            YPLV
Sbjct  578  YPLV  581



>ref|NP_001168063.1| uncharacterized protein LOC100381794 [Zea mays]
 gb|ACN26977.1| unknown [Zea mays]
Length=183

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  55   MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLV  110



>ref|XP_006374904.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
 gb|ERP52701.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
Length=651

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYP  7
            N+ D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP
Sbjct  519  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYP  578

Query  6    LV  1
            +V
Sbjct  579  IV  580



>gb|KDO84108.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=593

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  459  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  518

Query  15   LYPLV  1
            LYPLV
Sbjct  519  LYPLV  523



>gb|KDO84110.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=472

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  338  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  397

Query  15   LYPLV  1
            LYPLV
Sbjct  398  LYPLV  402



>ref|XP_011029544.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=651

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYP  7
            N+ D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP
Sbjct  519  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYP  578

Query  6    LV  1
            +V
Sbjct  579  IV  580



>ref|XP_010093503.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB54169.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=647

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  13
            N+SD P+ G  GGM+S+PY MGG+  RD     P+   ALAS+LANA P+QQRT+LGENL
Sbjct  512  NMSDIPIGGAPGGMLSVPYSMGGVPIRDTPYGQPMSTGALASSLANATPDQQRTLLGENL  571

Query  12   YPLV  1
            YPLV
Sbjct  572  YPLV  575



>gb|KDO84109.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=575

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  441  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  500

Query  15   LYPLV  1
            LYPLV
Sbjct  501  LYPLV  505



>ref|XP_003573691.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=663

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGM-LPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  1
            D P  GVGGMV  PY+MG M L  + AP  VP   LASALAN+PPEQQR MLGE+LYPLV
Sbjct  534  DSPFRGVGGMVPSPYEMGRMTLNDNGAPQQVPSGTLASALANSPPEQQRLMLGESLYPLV  593



>ref|XP_006473293.1| PREDICTED: polyadenylate-binding protein 8-like [Citrus sinensis]
Length=652

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  518  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  577

Query  15   LYPLV  1
            LYPLV
Sbjct  578  LYPLV  582



>gb|AAB61594.1| poly(A)-binding protein, partial [Mesembryanthemum crystallinum]
Length=176

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMV--SLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPLV  1
            D P+PGV G V   + YDMGGM  RD +P VP+  LA+ LANA PEQQR +LGENLYPLV
Sbjct  42   DAPLPGVTGGVLPGVQYDMGGMPIRDLSPTVPVGTLATLLANATPEQQRLLLGENLYPLV  101



>gb|KDO84107.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=652

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  518  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  577

Query  15   LYPLV  1
            LYPLV
Sbjct  578  LYPLV  582



>ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=658

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S+PYDMGGM  RDAA   PVPITALA+ALANA PE QRT+LGE+L
Sbjct  524  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAAGQPVPITALATALANASPEHQRTLLGESL  583

Query  12   YPLV  1
            YPLV
Sbjct  584  YPLV  587



>tpg|DAA39543.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=246

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  118  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLV  173



>ref|NP_564554.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 ref|NP_001185184.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 sp|Q9FXA2.1|PABP8_ARATH RecName: Full=Polyadenylate-binding protein 8; Short=PABP-8; 
Short=Poly(A)-binding protein 8 [Arabidopsis thaliana]
 gb|AAG13056.1|AC011807_15 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAK43894.1|AF370517_1 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAL47336.1| putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AEE32472.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 gb|AEE32473.1| poly(A) binding protein 8 [Arabidopsis thaliana]
Length=671

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 7/61 (11%)
 Frame = -3

Query  162  MPG-VGGMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  4
            MPG    M+S+PYD+   GG+  RD+    PVPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  541  MPGPTQNMLSVPYDVSSGGGVHHRDSPTSQPVPIVALATRLANAAPEQQRTMLGENLYPL  600

Query  3    V  1
            V
Sbjct  601  V  601



>gb|EEC83349.1| hypothetical protein OsI_28748 [Oryza sativa Indica Group]
Length=252

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182



>gb|AAQ56324.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
Length=266

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  137  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  196



>gb|EEE68458.1| hypothetical protein OsJ_26852 [Oryza sativa Japonica Group]
Length=252

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182



>tpg|DAA39542.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=648

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  520  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLV  575



>ref|XP_009408013.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = -3

Query  165  PMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            P+ G+ GGM SLPYDMGG +P+    VPI  L SALANA  EQQRTMLGE+LYPLV
Sbjct  521  PVSGIHGGMFSLPYDMGGGMPQ--PTVPIGELTSALANATLEQQRTMLGESLYPLV  574



>tpg|DAA39541.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=654

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  1
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  526  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLV  581



>ref|NP_001061515.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAC92404.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAC92537.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF23429.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAG89395.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39945.1| putative poly(A)-binding protein [Oryza sativa Indica Group]
Length=660

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  531  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  590



>gb|AFW58788.1| hypothetical protein ZEAMMB73_448418 [Zea mays]
Length=212

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLV  1
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV
Sbjct  85   MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLV  141



>ref|XP_002313862.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE87817.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=642

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  513  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>ref|XP_010263472.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=653

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  519  NMPDVPMSGVAGGMLSVPYDMGGMPLRDAAMSQPIPIGALATALANATPEQQRTMLGESL  578

Query  12   YPLV  1
            YPLV
Sbjct  579  YPLV  582



>ref|XP_009398670.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 42/60 (70%), Gaps = 6/60 (10%)
 Frame = -3

Query  162  MPGVG---GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP VG   GM S PYDMGGM  R A    PVP+  L SALANA PEQQR MLGE+LYPLV
Sbjct  518  MPEVGNPEGMFSPPYDMGGMPARHAGMSQPVPVGELTSALANATPEQQRLMLGESLYPLV  577



>ref|XP_009147891.1| PREDICTED: polyadenylate-binding protein 8 [Brassica rapa]
 emb|CDY51045.1| BnaA06g03080D [Brassica napus]
Length=653

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = -3

Query  165  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  7
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  6    LV  1
            LV
Sbjct  581  LV  582



>emb|CDY54068.1| BnaCnng26160D [Brassica napus]
Length=653

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = -3

Query  165  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  7
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  6    LV  1
            LV
Sbjct  581  LV  582



>ref|XP_010691731.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -3

Query  171  DGPMPGV-GGMV-SLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  7
            DGP+PGV GGM+  + +DMGGM  RDAA    VP+  LA+ LANA PE QR +LGENLYP
Sbjct  528  DGPIPGVTGGMLPGVQFDMGGMPVRDAALSPTVPVGTLATLLANATPEHQRLLLGENLYP  587

Query  6    LV  1
            LV
Sbjct  588  LV  589



>ref|XP_008663371.1| PREDICTED: polyadenylate-binding protein 2-like [Zea mays]
Length=652

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLV  1
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV
Sbjct  525  MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLV  581



>ref|XP_002448132.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
 gb|EES12460.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
Length=664

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLV  1
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV
Sbjct  537  MPGVAGGMIQAYDMGGFPVRDAAVSPAAQIGTLTSALANANPEQQRTILGENLYPLV  593



>ref|XP_006659302.1| PREDICTED: polyadenylate-binding protein 8-like [Oryza brachyantha]
Length=659

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = -3

Query  177  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  7
            ++D    GVGG+V  PY+MG +   DA    P+PI ALASALAN+PP+QQR MLGE+LYP
Sbjct  528  MTDTGFRGVGGLVPSPYEMGRLPLSDAGAPQPLPIGALASALANSPPDQQRLMLGESLYP  587

Query  6    LV  1
            LV
Sbjct  588  LV  589



>ref|NP_001151785.1| LOC100285420 [Zea mays]
 gb|ACG44303.1| polyadenylate-binding protein 2 [Zea mays]
 tpg|DAA37055.1| TPA: polyadenylate-binding protein 2 [Zea mays]
Length=660

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = -3

Query  162  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLV  1
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV
Sbjct  533  MPGVAGGMMQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLV  589



>ref|XP_002284923.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010664560.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Vitis 
vinifera]
 emb|CAN76464.1| hypothetical protein VITISV_017035 [Vitis vinifera]
Length=640

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S+PYDMGG+  RDAA   P+PI+ALASALANA P+QQRTMLGE+L
Sbjct  507  NMPDVPMPGVAGGMLSIPYDMGGVPLRDAAIGQPMPISALASALANATPDQQRTMLGESL  566

Query  12   YPLV  1
            YPLV
Sbjct  567  YPLV  570



>ref|XP_008364810.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=652

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 51/65 (78%), Gaps = 8/65 (12%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGG---MLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            DGPMPGV GGM S+PYDMGG   M  RDAA     VPI ALA+ALANA PEQQRTMLGEN
Sbjct  517  DGPMPGVAGGMFSVPYDMGGGGSMPIRDAAVSQPTVPIGALATALANATPEQQRTMLGEN  576

Query  15   LYPLV  1
            LYPLV
Sbjct  577  LYPLV  581



>ref|XP_008220252.1| PREDICTED: polyadenylate-binding protein 2-like [Prunus mume]
Length=651

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  6    LV  1
            LV
Sbjct  580  LV  581



>ref|XP_007226962.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 ref|XP_007226963.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28161.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28162.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
Length=651

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  6    LV  1
            LV
Sbjct  580  LV  581



>ref|XP_002518733.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF43658.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=644

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+S+PYDM GM  RDAA   P+PI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLSVPYDMSGMPMRDAALSQPIPIGALASALANASPEQQRTMLGENLYPL  573

Query  3    V  1
            V
Sbjct  574  V  574



>gb|ABK94932.1| unknown [Populus trichocarpa]
Length=408

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  279  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  338

Query  3    V  1
            V
Sbjct  339  V  339



>ref|XP_006421219.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
 gb|ESR34459.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
Length=437

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            N+ D PM GV G M+ +P+DMG  +PR  A    P PIT L++ALANA PEQ+RT+ GE+
Sbjct  284  NMQDVPMQGVAGCMLPIPFDMGAGMPRRDASVGQPTPITPLSTALANASPEQRRTLPGES  343

Query  15   LYPLV  1
            LYPL+
Sbjct  344  LYPLI  348



>gb|EYU37653.1| hypothetical protein MIMGU_mgv1a002809mg [Erythranthe guttata]
Length=635

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = -3

Query  150  GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            GGM S+PY MG M   D   + P PI AL SALAN+ P +QRTMLGENLYPLV
Sbjct  520  GGMFSVPYQMGNMPSHDGGMSRPTPIGALTSALANSSPTEQRTMLGENLYPLV  572



>ref|XP_002301171.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
 gb|EEE80444.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
Length=657

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQRTMLGE L
Sbjct  517  NMPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRTMLGEGL  576

Query  12   YPLV  1
            YPLV
Sbjct  577  YPLV  580



>ref|XP_007153579.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
 gb|ESW25573.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
Length=561

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PMPGV GGM S+PYD+GGM  RDA+    +PI ALASALANA PEQQRTMLGENLYPL
Sbjct  432  DVPMPGVAGGMFSVPYDVGGMPLRDASHSQQIPIGALASALANASPEQQRTMLGENLYPL  491

Query  3    V  1
            V
Sbjct  492  V  492



>ref|XP_002891531.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67790.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 7/61 (11%)
 Frame = -3

Query  162  MPGVG-GMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  4
            MPG+   M+S+PYD+   GG+  RD+     VPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  539  MPGLTPNMLSVPYDVSSGGGVHHRDSPASQSVPIGALATQLANAAPEQQRTMLGENLYPL  598

Query  3    V  1
            V
Sbjct  599  V  599



>ref|XP_006404818.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
 gb|ESQ46271.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
Length=652

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ DG MPG  GMV + YDM GM  P+   P+P  ALAS+LA A P QQRT+LGENLYPL
Sbjct  522  NMQDGSMPG--GMVPVAYDMNGMPFPQ---PMPAGALASSLAQASPAQQRTLLGENLYPL  576

Query  3    V  1
            V
Sbjct  577  V  577



>emb|CDP01307.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            +V D  MPGV G V  PYDMGG LPR+     P+P TALASALANA PEQQRTMLGENLY
Sbjct  528  SVPDVRMPGVAGGVLSPYDMGGTLPREGTIGQPMPTTALASALANASPEQQRTMLGENLY  587

Query  9    PLV  1
            PLV
Sbjct  588  PLV  590



>ref|XP_008373847.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
 ref|XP_008364535.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=658

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 8/65 (12%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDM---GGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  16
            DGPMPGV GGM S+PYD+   GGM  RDAA     +PI ALA+ALANA PEQQRTMLGEN
Sbjct  523  DGPMPGVAGGMFSVPYDISGGGGMPIRDAALSQPTIPIGALATALANATPEQQRTMLGEN  582

Query  15   LYPLV  1
            LYPLV
Sbjct  583  LYPLV  587



>ref|XP_004304018.1| PREDICTED: polyadenylate-binding protein 8-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  138  SLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            S+PYD+ GM  RD   + P+PI  LASALANA PEQQRTMLGE+LYPLV
Sbjct  532  SVPYDLSGMPLRDPALSQPLPIGTLASALANATPEQQRTMLGESLYPLV  580



>gb|AGF69179.1| polyadenylate-binding protein 2-like protein, partial [Triticum 
aestivum]
Length=497

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 6/56 (11%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLV  1
            GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  423  GVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLV  476



>ref|XP_003580095.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=661

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 6/60 (10%)
 Frame = -3

Query  165  PMPGVG--GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            PM GVG  GM+  PYDMGG   RDA      PI  L SALANA P+QQRT+LGE+LYPLV
Sbjct  532  PMAGVGAGGMIQ-PYDMGGFPVRDAGLSPAAPIGTLTSALANATPDQQRTLLGESLYPLV  590



>gb|EMS47633.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=567

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = -3

Query  177  VSDGPMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLY  10
            V   P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LY
Sbjct  436  VQQMPGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLY  493

Query  9    PLV  1
            PLV
Sbjct  494  PLV  496



>ref|XP_008347611.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=213

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GVGG M S+PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  87   NMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQGVPALATALANASTEQQRTMLGEALYP  146

Query  6    LV  1
            LV
Sbjct  147  LV  148



>ref|XP_004499046.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Cicer 
arietinum]
Length=588

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTM--LGEN  16
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRT+  + E+
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTVSPVSEH  579

Query  15   LYPLV  1
             + ++
Sbjct  580  CFSVL  584



>dbj|BAJ86310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 41/56 (73%), Gaps = 6/56 (11%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLV  1
            GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  622  GVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLV  675



>ref|XP_008378021.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=648

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GVGG M S+PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  522  NMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQGVPALATALANASTEQQRTMLGEALYP  581

Query  6    LV  1
            LV
Sbjct  582  LV  583



>ref|XP_006393217.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
 gb|ESQ30503.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
Length=669

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 8/62 (13%)
 Frame = -3

Query  162  MPGVG-GMVSLPYDM----GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYP  7
            MPG+   M+S+PYD+    GG   RD+    PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  537  MPGLTPNMLSVPYDVSGGAGGGHLRDSPAGQPVPIGALATSLANAAPEHQRTMLGENLYP  596

Query  6    LV  1
            LV
Sbjct  597  LV  598



>ref|XP_011017176.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=651

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQR MLGE+L
Sbjct  517  NMPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRMMLGESL  576

Query  12   YPLV  1
            YPLV
Sbjct  577  YPLV  580



>gb|EMT03423.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=566

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 43/59 (73%), Gaps = 7/59 (12%)
 Frame = -3

Query  162  MPGVG-GMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLV  1
            MPGVG GMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV
Sbjct  439  MPGVGVGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLV  495



>ref|XP_008393785.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
 ref|XP_008351992.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=649

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  523  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  582

Query  6    LV  1
            LV
Sbjct  583  LV  584



>ref|XP_010526963.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=638

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = -3

Query  159  PGVGGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            P + GM  LPY+M  M  R+      PVPI ALASALANA PEQQRTMLGENLYP+V
Sbjct  515  PAMSGM--LPYEMTNMPLREPVLSHQPVPIGALASALANATPEQQRTMLGENLYPMV  569



>ref|XP_004505404.1| PREDICTED: polyadenylate-binding protein 2-like [Cicer arietinum]
Length=585

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 4/52 (8%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTM  28
            DGPMPGV GGM S+PYD+GG+  RDA+    +PI ALAS LANA PEQQRT+
Sbjct  529  DGPMPGVAGGMFSVPYDVGGIPLRDASLPQQIPIGALASHLANASPEQQRTV  580



>ref|XP_009359888.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
 ref|XP_009359896.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=650

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -3

Query  180  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  7
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  524  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  583

Query  6    LV  1
            LV
Sbjct  584  LV  585



>ref|XP_010928350.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=633

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  498  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  557

Query  12   YPLV  1
            YPLV
Sbjct  558  YPLV  561



>ref|XP_010928349.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=658

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  523  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  582

Query  12   YPLV  1
            YPLV
Sbjct  583  YPLV  586



>gb|KFK35979.1| hypothetical protein AALP_AA4G062600 [Arabis alpina]
Length=671

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 9/63 (14%)
 Frame = -3

Query  162  MPGVG-GMVSLPYDMGG-----MLPRDA---APVPITALASALANAPPEQQRTMLGENLY  10
            MPG+   M+S+PYD+ G     +  RD+    PVPI ALA++LANA PE QRTMLGENLY
Sbjct  538  MPGLTPNMLSVPYDVSGAGGGNVHLRDSPSSQPVPIGALATSLANAAPEHQRTMLGENLY  597

Query  9    PLV  1
            PLV
Sbjct  598  PLV  600



>ref|XP_010530761.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Tarenaya hassleriana]
Length=649

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 44/62 (71%), Gaps = 10/62 (16%)
 Frame = -3

Query  171  DGP-MPGVGGMVSLPYDMGGMLPRD---AAP-VPITALASALANAPPEQQRTMLGENLYP  7
            D P MPG+     LPY+M  M  R+   + P VPI ALASALANA PEQQRTMLGENLYP
Sbjct  523  DAPTMPGM-----LPYEMANMSMREPVMSQPAVPIGALASALANATPEQQRTMLGENLYP  577

Query  6    LV  1
            LV
Sbjct  578  LV  579



>ref|XP_007042478.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX98309.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=645

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MP V GGM+S+PYDMGGM  RD   + P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  517  DVSMPNVAGGMLSVPYDMGGMPMRDVPLSQPIPIGALASALANASPDQQRTMLGENLYPL  576

Query  3    V  1
            V
Sbjct  577  V  577



>gb|KJB14629.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=651

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  517  NMPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESL  576

Query  12   YPLV  1
            YPLV
Sbjct  577  YPLV  580



>dbj|BAJ97269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDA-APVPIT--ALASALANAPPEQQRTMLGENLYPLV  1
            +    GVGGM    Y+MG M P D  AP  ++  ALASALAN+PPEQQR MLGE+LYPLV
Sbjct  533  EAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYPLV  592



>dbj|BAJ90169.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDA-APVPIT--ALASALANAPPEQQRTMLGENLYPLV  1
            +    GVGGM    Y+MG M P D  AP  ++  ALASALAN+PPEQQR MLGE+LYPLV
Sbjct  533  EAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYPLV  592



>gb|AEW09165.1| hypothetical protein CL4424Contig1_01, partial [Pinus radiata]
Length=84

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 6/66 (9%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGM-LPRDAAPV----PITALASALANAPPEQQRTMLGE  19
            NV + P+ GVGG M+ +P+DM  + +P   A +    P+  +ASALANA PEQQRTMLGE
Sbjct  1    NVPEVPLTGVGGGMLPVPFDMSSVPIPAPDAGISQSSPMETMASALANATPEQQRTMLGE  60

Query  18   NLYPLV  1
            +LYPLV
Sbjct  61   SLYPLV  66



>gb|EYU36333.1| hypothetical protein MIMGU_mgv1a002664mg [Erythranthe guttata]
Length=649

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 6/53 (11%)
 Frame = -3

Query  141  VSLPYDMGGMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLV  1
            +S+PYDMGGMLPRD+AP+      PITALA+ALANA PEQQR MLGENLYPLV
Sbjct  528  LSVPYDMGGMLPRDSAPIQPQQPMPITALATALANATPEQQRIMLGENLYPLV  580



>gb|KJB14633.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=645

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  511  NMPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESL  570

Query  12   YPLV  1
            YPLV
Sbjct  571  YPLV  574



>gb|KFK32750.1| poly binding protein [Arabis alpina]
Length=646

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV + YDM GM P    P+P  ALAS+LA+A P QQRT+LGE+LYPLV
Sbjct  517  NMPDGPMPG--GMVPVAYDMNGM-PF-GQPMPTGALASSLASATPAQQRTILGESLYPLV  572



>gb|AFG69765.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69766.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69767.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69768.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69769.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
Length=84

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 6/66 (9%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGM-LPRDAAPV----PITALASALANAPPEQQRTMLGE  19
            NV + P+ GVGG M+ +P+DM  + +P   A +    P+  +ASALANA PEQQRTMLGE
Sbjct  1    NVPEVPLTGVGGGMLPVPFDMSSVPIPAPDAGISQSSPMETMASALANATPEQQRTMLGE  60

Query  18   NLYPLV  1
            +LYPLV
Sbjct  61   SLYPLV  66



>gb|KHG25571.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=653

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA P QQRT+LGENLYPLV
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATPVQQRTLLGENLYPLV  581



>emb|CDO97198.1| unnamed protein product [Coffea canephora]
Length=653

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  MPGV GGM+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  523  DVSMPGVVGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  582



>gb|KJB58541.1| hypothetical protein B456_009G214100 [Gossypium raimondii]
Length=650

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPM  V GGM+S+PYDMGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LYPL
Sbjct  520  EGPMSNVPGGMLSVPYDMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLYPL  579

Query  3    V  1
            V
Sbjct  580  V  580



>emb|CDO97200.1| unnamed protein product [Coffea canephora]
Length=654

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGG-MVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            D  MPGVGG M+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  524  DVSMPGVGGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  583



>ref|XP_008795896.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=660

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  4
            D P+PGV GGM+S PYD+GGM  RD   + P+PI ALASALANA PEQQRTMLGE+LYPL
Sbjct  526  DVPVPGVAGGMLSAPYDIGGMPLRDPGMSQPIPIGALASALANASPEQQRTMLGESLYPL  585

Query  3    V  1
            V
Sbjct  586  V  586



>ref|XP_006283328.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
 gb|EOA16226.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
Length=629

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 5/44 (11%)
 Frame = -3

Query  132  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            PYDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  529  PYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLV  567



>ref|XP_002300227.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE85032.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=644

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  3    V  1
            V
Sbjct  575  V  575



>ref|XP_010432464.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -3

Query  156  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLV  570



>ref|XP_010555994.1| PREDICTED: polyadenylate-binding protein 8 [Tarenaya hassleriana]
Length=646

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 5/60 (8%)
 Frame = -3

Query  165  PMPGVG-GMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            PMPGV   M+S+PYDM G +P RD++   PVPI ALASALANA PEQQRTMLGENLYPLV
Sbjct  519  PMPGVAPSMLSVPYDMAGAVPLRDSSVSQPVPIGALASALANASPEQQRTMLGENLYPLV  578



>ref|XP_010437669.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=633

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -3

Query  156  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  524  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANATPEQQRTMLGENLYPLV  571



>ref|XP_010447142.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -3

Query  156  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLV  570



>ref|XP_011000130.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=644

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  3    V  1
            V
Sbjct  575  V  575



>ref|XP_010447143.1| PREDICTED: polyadenylate-binding protein 2 [Camelina sativa]
Length=632

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -3

Query  156  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLV  570



>ref|XP_010432462.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010432463.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=632

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 6/53 (11%)
 Frame = -3

Query  156  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLV  570



>ref|XP_010527159.1| PREDICTED: polyadenylate-binding protein 4-like, partial [Tarenaya 
hassleriana]
Length=636

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ DGP+PG  G++ + YDM GM  P+   P+   ALASALANA P QQRT+LGE+LYPL
Sbjct  517  NMPDGPIPG--GILPVAYDMTGMPFPQ---PLSTGALASALANATPAQQRTLLGEHLYPL  571

Query  3    V  1
            V
Sbjct  572  V  572



>ref|XP_007017178.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
 gb|EOY14403.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
Length=648

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PM  V GGM+S+PYD+GGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  514  NMPDVPMSSVAGGMLSVPYDLGGMPLRDAGVGQPMPIPALATALANATPEQQRTMLGESL  573

Query  12   YPLV  1
            YPLV
Sbjct  574  YPLV  577



>gb|EMT11581.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=195

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPYDMGGMLPRDA-APVPIT--ALASALANAPPEQQRTMLGENLYPLV  1
            D    GVG MV   Y+MG   P D  AP  ++  ALASAL N+PPEQQR MLGE+LYPLV
Sbjct  65   DAAFRGVGAMVPSLYEMGRTTPGDTGAPQQVSSGALASALVNSPPEQQRLMLGESLYPLV  124



>gb|AID60122.1| poly(A) binding protein 8 [Brassica napus]
 gb|AID60165.1| polyA binding protein 8 [Brassica napus]
Length=606

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 5/52 (10%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  498  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLV  544



>ref|XP_010531254.1| PREDICTED: polyadenylate-binding protein 4 [Tarenaya hassleriana]
Length=644

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGP+PG  G++ + YDM GM P  A P+   ALASALAN  P QQRT+LGE+LYPLV
Sbjct  516  NMLDGPIPG--GILPIAYDMNGM-PF-AQPLSTGALASALANGTPAQQRTLLGEHLYPLV  571



>ref|XP_011000826.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=643

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  573

Query  3    V  1
            V
Sbjct  574  V  574



>emb|CDX75397.1| BnaA01g03050D [Brassica napus]
Length=616

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 5/52 (10%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  508  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLV  554



>emb|CDX69025.1| BnaC01g04280D [Brassica napus]
Length=611

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  501  GSGGDVA-PYDMGN--NNNNITMPIGALASNLANASPEQQRTMLGENLYPLV  549



>emb|CDX89562.1| BnaC04g35810D [Brassica napus]
Length=645

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPM   GGMV  PYD+ GM      P+P  ALAS+LA A P QQRT+LGE LYPLV
Sbjct  516  NMPDGPM--AGGMVPFPYDINGMPL--GQPMPAGALASSLAQASPAQQRTILGETLYPLV  571



>ref|XP_006422975.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
 ref|XP_006487035.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
 gb|ESR36215.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
Length=645

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGGMVSLPY-DMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  4
            D  MPGVGGM+ +PY DM  M  RDA    PVPI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVSMPGVGGMLPIPYGDMAAMPLRDAPISQPVPIGALASALANASPEQQRTMLGENLYPL  573

Query  3    V  1
            V
Sbjct  574  V  574



>ref|XP_008788846.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=665

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ + PMPG  GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  530  NMPEVPMPGAAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  589

Query  12   YPLV  1
            YPLV
Sbjct  590  YPLV  593



>ref|XP_006295403.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
 gb|EOA28301.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
Length=658

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPM G  GMV + YDM GM P    P+  + LAS+LAN+ P QQRT+LGE+LYPLV
Sbjct  526  NMPDGPMQG--GMVQVAYDMNGM-PF-GQPLSASQLASSLANSSPAQQRTLLGESLYPLV  581



>gb|KJB32341.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=634

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 6/56 (11%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTML--GENL  13
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRT+   GE+L
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLSQPIPIGALASALANATPEQQRTVHAGGESL  573



>gb|KJB40266.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=607

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLV
Sbjct  478  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLV  535



>ref|XP_009108756.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=619

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  502  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  557



>emb|CDY51957.1| BnaA08g11610D [Brassica napus]
Length=619

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  502  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  557



>emb|CDY62723.1| BnaC03g77220D [Brassica napus]
Length=617

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  500  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  555



>ref|XP_002869174.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45433.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 5/44 (11%)
 Frame = -3

Query  132  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            PYDMG  +P     +PI ALAS LANA PEQQRTMLGE+LYPLV
Sbjct  525  PYDMGNNMP-----LPIGALASHLANASPEQQRTMLGESLYPLV  563



>gb|KJB40264.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=651

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLV
Sbjct  522  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLV  579



>gb|KJB40263.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=653

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -3

Query  162  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLV
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLV  581



>ref|XP_009140459.1| PREDICTED: polyadenylate-binding protein 4-like [Brassica rapa]
Length=644

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570



>emb|CDY38939.1| BnaA04g13600D [Brassica napus]
Length=644

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570



>gb|KCW55175.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=471

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  4
            D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LYPL
Sbjct  341  DMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLYPL  400

Query  3    V  1
            V
Sbjct  401  V  401



>ref|XP_010028424.1| PREDICTED: polyadenylate-binding protein 2 [Eucalyptus grandis]
 gb|KCW55174.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=646

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  4
            D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LYPL
Sbjct  516  DMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLYPL  575

Query  3    V  1
            V
Sbjct  576  V  576



>gb|KHG04753.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=590

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ + P+  VGG M+S+PYDMGGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  456  NMPEVPLSNVGGGMLSVPYDMGGMPLRDAGIGQPMPIPALATALANATPEQQRTMLGESL  515

Query  12   YPLV  1
            YPLV
Sbjct  516  YPLV  519



>ref|XP_002878680.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54939.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
Length=655

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPM  +GGMV + YDM GM    A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  524  NMPDGPM--LGGMVPVAYDMNGMPI--AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  579



>ref|XP_010110808.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC28180.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=639

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  10
            N+ +  +PGV GGM+ +PYD+GG+  RD A   +PITALA+ALANAPPEQQRTMLGE LY
Sbjct  513  NIQEVQIPGVAGGMLPVPYDVGGLPIRDGAGQAMPITALATALANAPPEQQRTMLGEALY  572

Query  9    PLV  1
            PLV
Sbjct  573  PLV  575



>gb|KHG04776.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=622

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            +GPM  V GG++S+PY+MGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LYPL
Sbjct  491  EGPMSNVPGGILSVPYEMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLYPL  550

Query  3    V  1
            V
Sbjct  551  V  551



>dbj|BAD94406.1| putative poly(A) binding protein [Arabidopsis thaliana]
Length=154

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  23   NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  78



>emb|CDX71223.1| BnaC07g05020D [Brassica napus]
Length=638

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 7/62 (11%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  7
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  513  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  569

Query  6    LV  1
            LV
Sbjct  570  LV  571



>emb|CDY36634.1| BnaA07g04230D [Brassica napus]
Length=649

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 7/62 (11%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  7
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  509  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  565

Query  6    LV  1
            LV
Sbjct  566  LV  567



>ref|XP_010417088.1| PREDICTED: polyadenylate-binding protein 4-like [Camelina sativa]
Length=660

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPM G  GMV + YDM GM P  A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  528  NMPDGPMQG--GMVPVAYDMNGM-PF-AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  583



>gb|KFK40021.1| hypothetical protein AALP_AA3G319900 [Arabis alpina]
Length=651

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 7/62 (11%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYP  7
            S GP P V GM  LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYP
Sbjct  526  SGGP-PDVPGM--LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYP  582

Query  6    LV  1
            LV
Sbjct  583  LV  584



>ref|XP_010519297.1| PREDICTED: polyadenylate-binding protein 8-like [Tarenaya hassleriana]
Length=649

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 6/63 (10%)
 Frame = -3

Query  171  DGPMPGVG-GMVSLPYDM-GGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLY  10
            D PMPGV   M+S+PYD+ GG  P RD+A   PVPI ALASALANA PEQQRTMLGENLY
Sbjct  518  DVPMPGVSPSMLSVPYDIAGGAAPLRDSAVSQPVPIGALASALANASPEQQRTMLGENLY  577

Query  9    PLV  1
            PLV
Sbjct  578  PLV  580



>ref|XP_006412275.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53728.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=624

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  524  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLV  563



>ref|XP_009117148.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=613

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 6/52 (12%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQR MLGENLYPLV
Sbjct  506  GSGGDVA-PYDMG-----NNNTMPIGALASNLANASPEQQRMMLGENLYPLV  551



>gb|KJB14632.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=652

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 5/65 (8%)
 Frame = -3

Query  180  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRT-MLGEN  16
            N+ + P+  VGG M+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRT MLGE+
Sbjct  517  NMPEVPLSNVGGGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTQMLGES  576

Query  15   LYPLV  1
            LYPLV
Sbjct  577  LYPLV  581



>ref|XP_006412276.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53729.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=599

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  120  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  499  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLV  538



>ref|XP_006409548.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
 gb|ESQ51001.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
Length=649

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  135  LPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYPLV
Sbjct  534  LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYPLV  582



>ref|XP_010429282.1| PREDICTED: polyadenylate-binding protein 4 [Camelina sativa]
Length=662

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPM G  GMV + YDM GM P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  530  NMPDGPMQG--GMVPVAYDMNGM-PF-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  585



>gb|KFK30042.1| hypothetical protein AALP_AA7G209600 [Arabis alpina]
Length=632

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 5/52 (10%)
 Frame = -3

Query  156  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            G GG V  PYDMG     +  P+PI ALAS LA+A PEQQRTMLGE+LYPLV
Sbjct  524  GSGGDVP-PYDMGN----NNMPLPIGALASNLAHASPEQQRTMLGESLYPLV  570



>ref|XP_007047341.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX91498.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=659

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N++D P+ GV GGM+ +PY++GGM  RDAA   P+   ALA+ALANA PEQQRT+LGENL
Sbjct  525  NMTDVPISGVPGGMLPVPYEVGGMPFRDAAFSQPMTTGALATALANATPEQQRTLLGENL  584

Query  12   YPLV  1
            YPLV
Sbjct  585  YPLV  588



>emb|CDX79295.1| BnaC06g20080D [Brassica napus]
Length=100

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  90  VPITALASALANAPPEQQRTMLGENLYPLV  1
           +PI ALAS LANA PEQQRTMLGENLYPLV
Sbjct  9   MPIGALASNLANASPEQQRTMLGENLYPLV  38



>ref|NP_179916.1| poly(A) binding protein 4 [Arabidopsis thaliana]
 sp|O22173.1|PABP4_ARATH RecName: Full=Polyadenylate-binding protein 4; Short=PABP-4; 
Short=Poly(A)-binding protein 4 [Arabidopsis thaliana]
 gb|AAB87097.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAK92796.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAL85120.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AEC07446.1| poly(A) binding protein 4 [Arabidopsis thaliana]
Length=662

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586



>gb|AAK25927.1|AF360217_1 putative poly(A) binding protein [Arabidopsis thaliana]
Length=662

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586



>gb|KCW66376.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=549

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTM  28
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+
Sbjct  493  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTV  546



>dbj|BAD94856.1| poly(A)-binding protein [Arabidopsis thaliana]
Length=126

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = -3

Query  132  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV
Sbjct  26   PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLV  64



>ref|XP_009119410.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=634

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  7
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLY 
Sbjct  509  SGGP-PDVLGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYQ  565

Query  6    LV  1
            LV
Sbjct  566  LV  567



>gb|KHN22334.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=592

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  471  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  521

Query  3    V  1
            V
Sbjct  522  V  522



>ref|XP_003525892.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=630

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  559

Query  3    V  1
            V
Sbjct  560  V  560



>gb|KHG16756.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=514

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 3/38 (8%)
 Frame = -3

Query  105  RDA---APVPITALASALANAPPEQQRTMLGENLYPLV  1
            RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV
Sbjct  411  RDAGSGQPMPVTALATSLANAAPEQQRTMLGESLYPLV  448



>emb|CDY08990.1| BnaC01g31010D [Brassica napus]
Length=99

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93  PVPITALASALANAPPEQQRTMLGENLYPLV  1
           P+PI ALAS LAN  PEQQRTMLG+NLYPLV
Sbjct  7   PLPIGALASNLANTSPEQQRTMLGDNLYPLV  37



>gb|EYU42687.1| hypothetical protein MIMGU_mgv1a002746mg [Erythranthe guttata]
Length=642

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 3/53 (6%)
 Frame = -3

Query  150  GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLV  1
            GGM+S+PY+MGG+  RDA    P+PI ALASALANA P +QRTMLGENLYPLV
Sbjct  525  GGMLSVPYEMGGLPLRDARISQPIPIGALASALANASPTEQRTMLGENLYPLV  577



>gb|EYU36334.1| hypothetical protein MIMGU_mgv1a002624mg [Erythranthe guttata]
Length=653

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 7/54 (13%)
 Frame = -3

Query  141  VSLPYDMG-GMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLV  1
            +S+PYDMG GMLPRD+AP+      PITALA+ALANA  +QQRTMLGENLYPLV
Sbjct  531  LSVPYDMGSGMLPRDSAPIQQQQPMPITALATALANATSDQQRTMLGENLYPLV  584



>ref|XP_011092553.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=644

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  + GV GGM+S+PY+MGG+  RD     P+PI ALASALANA P +QRTMLGENLYPL
Sbjct  518  DVSLQGVAGGMISVPYEMGGLPLRDVGMPQPIPIGALASALANASPSEQRTMLGENLYPL  577

Query  3    V  1
            V
Sbjct  578  V  578



>ref|XP_006425947.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39187.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=650

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  12   YPLV  1
            YPLV
Sbjct  575  YPLV  578



>ref|XP_006425948.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39188.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=652

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  12   YPLV  1
            YPLV
Sbjct  577  YPLV  580



>ref|NP_001275799.1| poly A-binding protein 2 [Citrus sinensis]
 gb|AEV43365.1| poly A-binding protein 2 [Citrus sinensis]
 gb|KDO79128.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=652

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  12   YPLV  1
            YPLV
Sbjct  577  YPLV  580



>gb|KDO79129.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=650

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  12   YPLV  1
            YPLV
Sbjct  575  YPLV  578



>ref|XP_006494495.1| PREDICTED: polyadenylate-binding protein 4 [Citrus sinensis]
Length=663

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 4/64 (6%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  528  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  587

Query  12   YPLV  1
            YPLV
Sbjct  588  YPLV  591



>dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas]
Length=642

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>gb|KDP31970.1| hypothetical protein JCGZ_12431 [Jatropha curcas]
Length=642

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  3    V  1
            V
Sbjct  573  V  573



>emb|CBI19492.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  96  APVPITALASALANAPPEQQRTMLGENLYPLV  1
           +P+PI+ LASALANA P+QQRTML E+LYPLV
Sbjct  52  SPMPISTLASALANATPDQQRTMLSESLYPLV  83



>ref|XP_009136273.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Brassica 
rapa]
Length=614

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 9/58 (16%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV
Sbjct  504  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLV  552



>ref|XP_009136272.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Brassica 
rapa]
Length=616

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 9/58 (16%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV
Sbjct  506  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLV  554



>gb|AFK34295.1| unknown [Medicago truncatula]
Length=107

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  90  VPITALASALANAPPEQQRTMLGENLYPLV  1
            P+ ALA+ALANAPPEQQRTMLGE LYPLV
Sbjct  8   TPMQALATALANAPPEQQRTMLGEVLYPLV  37



>pdb|2DYD|A Chain A, Solution Structure Of The Pabc Domain From Triticum 
Aevestium Poly(A)-Binding Protein
Length=85

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  87  PITALASALANAPPEQQRTMLGENLYPLV  1
           PI ALASALAN+PPE QR MLGENLYPLV
Sbjct  6   PIGALASALANSPPETQRMMLGENLYPLV  34



>emb|CDX89664.1| BnaC03g45780D [Brassica napus]
Length=614

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 7/45 (16%)
 Frame = -3

Query  135  LPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV
Sbjct  515  LPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLV  552



>ref|XP_008787484.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=983

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 5/56 (9%)
 Frame = -3

Query  153  VGGMVSLPYDMGGML--PRDA---APVPITALASALANAPPEQQRTMLGENLYPLV  1
            +G M+ LP D  GM   P DA   +P+PIT+LASALA+A PE QR +LGE LYPLV
Sbjct  863  MGPMMPLPLDASGMHVAPMDAVRSSPIPITSLASALASATPENQRLILGEQLYPLV  918



>emb|CBI32381.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  LPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            +P  +  +P+ ALA+ALANAPP +QRTMLGENLYPLV
Sbjct  664  MPAISQSIPVGALATALANAPPAEQRTMLGENLYPLV  700



>gb|AAL86321.1| putative poly(A)-binding protein [Arabidopsis thaliana]
Length=613

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = -3

Query  132  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV
Sbjct  513  PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLV  551



>ref|NP_195137.5| polyadenylate-binding protein 2 [Arabidopsis thaliana]
 sp|P42731.1|PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=PABP-2; 
Short=Poly(A)-binding protein 2 [Arabidopsis thaliana]
 gb|AAA61780.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAA17561.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAB80128.1| poly(A)-binding protein [Arabidopsis thaliana]
 gb|AAN86187.1| putative polyadenylate-binding protein 2 (PABP2) [Arabidopsis 
thaliana]
 gb|AEE86325.1| polyadenylate-binding protein 2 [Arabidopsis thaliana]
Length=629

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 5/44 (11%)
 Frame = -3

Query  132  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  1
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV
Sbjct  529  PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLV  567



>ref|XP_002863435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  90   VPITALASALANAPPEQQRTMLGENLYPLV  1
            VPI ALA+ LANA PEQQRTMLGENLYPLV
Sbjct  254  VPIGALATQLANAAPEQQRTMLGENLYPLV  283



>ref|NP_001062583.1| Os09g0115400 [Oryza sativa Japonica Group]
 dbj|BAD16229.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24497.1| Os09g0115400 [Oryza sativa Japonica Group]
 gb|EAZ08133.1| hypothetical protein OsI_30396 [Oryza sativa Indica Group]
 gb|EAZ43770.1| hypothetical protein OsJ_28392 [Oryza sativa Japonica Group]
 gb|ACA50516.1| poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAG90618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  M GVGG V   PY+MGGM  RDAA   PVPI ALA+ALANA P+QQR MLGENLYPL
Sbjct  530  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPVPIGALATALANAAPDQQRMMLGENLYPL  589

Query  3    V  1
            V
Sbjct  590  V  590



>ref|XP_010261307.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Nelumbo nucifera]
Length=829

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 5/56 (9%)
 Frame = -3

Query  153  VGGMVSLPYDMGGM--LPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  1
            +G M+ LP D+ GM   P D +   PVPIT LASALA+A PE QR MLGE L+PLV
Sbjct  710  MGPMMPLPLDVSGMPVSPMDVSRPGPVPITTLASALASASPEHQRLMLGEQLFPLV  765



>ref|XP_010688794.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=661

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 8/64 (13%)
 Frame = -3

Query  180  NVSDGPMPGVGGMVSLP-YDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  13
            N+ D PMPG      LP YDMGGM  RDA    PVPITALA+ALANA PEQQRTMLGE+L
Sbjct  532  NMPDVPMPGA----MLPGYDMGGMPLRDAGIAQPVPITALATALANASPEQQRTMLGESL  587

Query  12   YPLV  1
            YPLV
Sbjct  588  YPLV  591



>ref|XP_006661030.1| PREDICTED: polyadenylate-binding protein 8-like, partial [Oryza 
brachyantha]
Length=627

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -3

Query  171  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  4
            D  M GVGG V   PY+MGGM  RDAA   P+PI ALA+ALANA P+QQR MLGENLYPL
Sbjct  495  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPIPIGALATALANAAPDQQRMMLGENLYPL  554

Query  3    V  1
            V
Sbjct  555  V  555



>ref|XP_003523956.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Glycine 
max]
 gb|ABC47841.1| poly(A)-binding protein [Glycine max]
Length=630

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  559

Query  3    V  1
            V
Sbjct  560  V  560



>gb|KHN04485.1| Polyadenylate-binding protein 2, partial [Glycine soja]
Length=606

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  485  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  535

Query  3    V  1
            V
Sbjct  536  V  536



>ref|XP_006578033.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Glycine 
max]
Length=624

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  503  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  553

Query  3    V  1
            V
Sbjct  554  V  554



>ref|XP_006578034.1| PREDICTED: polyadenylate-binding protein 8 isoform X3 [Glycine 
max]
Length=623

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 10/61 (16%)
 Frame = -3

Query  180  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  4
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  502  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  552

Query  3    V  1
            V
Sbjct  553  V  553



>ref|XP_011044832.1| PREDICTED: polyadenylate-binding protein 3-like [Populus euphratica]
Length=648

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGM--LPRDA---APVPITALASALANAPPEQQRTMLGENLY  10
            S  P   VG +V  P++  GM   P DA   APVPI+AL +ALA+A PE++  MLGE LY
Sbjct  523  SAAPQGFVGPVVPFPFEASGMPITPSDAQRTAPVPISALTTALASATPEKRMVMLGEQLY  582

Query  9    PLV  1
            PLV
Sbjct  583  PLV  585



>ref|XP_002307526.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
 gb|EEE94522.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
Length=649

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -3

Query  174  SDGPMPGVGGMVSLPYDMGGM--LPRDA---APVPITALASALANAPPEQQRTMLGENLY  10
            S  P   VG +V  P++  GM   P DA   APVPI+AL +ALA+A PE++  MLGE LY
Sbjct  524  SAAPQGFVGPVVPFPFEASGMPVTPSDAQRTAPVPISALTTALASATPEKRMVMLGEQLY  583

Query  9    PLV  1
            PLV
Sbjct  584  PLV  586



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568775281920