BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017L17

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591334.1|  PREDICTED: probable phytol kinase 3, chlorop...    326   6e-108   Nicotiana tomentosiformis
ref|XP_009790459.1|  PREDICTED: probable phytol kinase 3, chlorop...    320   1e-105   Nicotiana sylvestris
ref|XP_011098894.1|  PREDICTED: probable phytol kinase 3, chlorop...    319   4e-105   Sesamum indicum [beniseed]
gb|EYU45412.1|  hypothetical protein MIMGU_mgv1a010789mg                314   3e-103   Erythranthe guttata [common monkey flower]
gb|ADZ24711.1|  phytol kinase                                           313   7e-103   Solanum pennellii
ref|XP_004246260.1|  PREDICTED: probable phytol kinase 3, chlorop...    312   2e-102   Solanum lycopersicum
ref|XP_006354090.1|  PREDICTED: probable phytol kinase 3, chlorop...    307   1e-100   Solanum tuberosum [potatoes]
ref|XP_007205802.1|  hypothetical protein PRUPE_ppa010668mg             301   3e-99    
ref|XP_008384758.1|  PREDICTED: probable phytol kinase 2, chlorop...    302   4e-98    
ref|XP_010069238.1|  PREDICTED: probable phytol kinase 3, chlorop...    298   6e-98    Eucalyptus grandis [rose gum]
ref|XP_004294311.1|  PREDICTED: probable phytol kinase 2, chlorop...    301   6e-98    Fragaria vesca subsp. vesca
ref|XP_008221407.1|  PREDICTED: probable phytol kinase 3, chlorop...    301   8e-98    Prunus mume [ume]
emb|CDP09225.1|  unnamed protein product                                297   2e-97    Coffea canephora [robusta coffee]
ref|XP_009369583.1|  PREDICTED: probable phytol kinase 2, chlorop...    298   8e-97    Pyrus x bretschneideri [bai li]
ref|XP_002516647.1|  Phytol kinase 1, chloroplast precursor, puta...    298   1e-96    Ricinus communis
gb|KHG05203.1|  putative phytol kinase 3, chloroplastic                 296   2e-96    Gossypium arboreum [tree cotton]
ref|XP_002313239.2|  hypothetical protein POPTR_0009s07860g             294   3e-96    
ref|XP_007016939.1|  Phosphatidate cytidylyltransferase family pr...    296   4e-96    
ref|XP_007016937.1|  Phosphatidate cytidylyltransferase family pr...    296   1e-95    
gb|KJB83902.1|  hypothetical protein B456_013G270100                    294   3e-95    Gossypium raimondii
gb|KDP45737.1|  hypothetical protein JCGZ_17344                         293   8e-95    Jatropha curcas
ref|XP_010028019.1|  PREDICTED: probable phytol kinase 3, chlorop...    290   2e-94    
ref|XP_002313238.2|  hypothetical protein POPTR_0009s07860g             292   2e-94    
ref|XP_011003760.1|  PREDICTED: probable phytol kinase 2, chlorop...    288   5e-94    Populus euphratica
gb|KEH34361.1|  phytol kinase                                           290   8e-94    Medicago truncatula
ref|XP_002278580.2|  PREDICTED: probable phytol kinase 2, chlorop...    289   2e-93    Vitis vinifera
emb|CDY66208.1|  BnaCnng49970D                                          289   3e-93    Brassica napus [oilseed rape]
ref|XP_007146804.1|  hypothetical protein PHAVU_006G071000g             289   3e-93    Phaseolus vulgaris [French bean]
emb|CDM84848.1|  unnamed protein product                                288   8e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010520194.1|  PREDICTED: probable phytol kinase 2, chlorop...    288   9e-93    Tarenaya hassleriana [spider flower]
ref|XP_011003752.1|  PREDICTED: probable phytol kinase 2, chlorop...    287   2e-92    Populus euphratica
ref|XP_004970454.1|  PREDICTED: probable phytol kinase 2, chlorop...    286   5e-92    Setaria italica
ref|XP_011025082.1|  PREDICTED: probable phytol kinase 3, chlorop...    285   8e-92    Populus euphratica
emb|CBI15917.3|  unnamed protein product                                283   8e-92    Vitis vinifera
ref|XP_010028020.1|  PREDICTED: probable phytol kinase 3, chlorop...    283   9e-92    
ref|XP_008457339.1|  PREDICTED: probable phytol kinase 2, chlorop...    285   1e-91    Cucumis melo [Oriental melon]
gb|AFK48670.1|  unknown                                                 285   2e-91    Lotus japonicus
gb|KHG27084.1|  putative phytol kinase 3, chloroplastic                 281   4e-91    Gossypium arboreum [tree cotton]
ref|XP_002299996.2|  hypothetical protein POPTR_0001s28680g             281   4e-91    Populus trichocarpa [western balsam poplar]
gb|KJB20420.1|  hypothetical protein B456_003G147500                    281   4e-91    Gossypium raimondii
gb|AAM65097.1|  unknown                                                 283   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008356261.1|  PREDICTED: probable phytol kinase 3, chlorop...    281   6e-91    
gb|KHN02090.1|  Putative phytol kinase 3, chloroplastic                 283   8e-91    Glycine soja [wild soybean]
ref|NP_001130181.1|  uncharacterized protein LOC100191275               283   1e-90    Zea mays [maize]
ref|NP_001044703.2|  Os01g0832000                                       280   2e-90    
ref|XP_002458716.1|  hypothetical protein SORBIDRAFT_03g038850          283   2e-90    
dbj|BAD43853.1|  unknown protein                                        281   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145246.1|  PREDICTED: probable phytol kinase 2, chlorop...    282   3e-90    
ref|NP_200664.1|  farnesol kinase                                       281   4e-90    Arabidopsis thaliana [mouse-ear cress]
gb|ACU24460.1|  unknown                                                 281   4e-90    Glycine max [soybeans]
ref|XP_009120370.1|  PREDICTED: probable phytol kinase 2, chlorop...    280   4e-90    Brassica rapa
ref|XP_003564535.1|  PREDICTED: probable phytol kinase 2, chlorop...    280   7e-90    Brachypodium distachyon [annual false brome]
emb|CDY67806.1|  BnaA10g29300D                                          280   8e-90    Brassica napus [oilseed rape]
ref|XP_010264775.1|  PREDICTED: probable phytol kinase 2, chlorop...    278   1e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006644954.1|  PREDICTED: probable phytol kinase 2, chlorop...    277   2e-89    
ref|XP_006425114.1|  hypothetical protein CICLE_v10028969mg             278   2e-89    Citrus clementina [clementine]
sp|Q5N9J9.3|PHYK2_ORYSJ  RecName: Full=Probable phytol kinase 2, ...    279   2e-89    Oryza sativa Japonica Group [Japonica rice]
gb|KDO66965.1|  hypothetical protein CISIN_1g022935mg                   278   3e-89    Citrus sinensis [apfelsine]
ref|XP_009603395.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    275   4e-89    
ref|XP_010089521.1|  putative phytol kinase 3                           283   5e-89    
ref|XP_006488562.1|  PREDICTED: probable phytol kinase 3, chlorop...    278   5e-89    Citrus sinensis [apfelsine]
ref|NP_001242263.1|  probable phytol kinase 3, chloroplastic            278   6e-89    
ref|XP_004500292.1|  PREDICTED: probable phytol kinase 3, chlorop...    277   1e-88    Cicer arietinum [garbanzo]
ref|XP_004500293.1|  PREDICTED: probable phytol kinase 3, chlorop...    277   1e-88    Cicer arietinum [garbanzo]
ref|XP_002278563.2|  PREDICTED: probable phytol kinase 2, chlorop...    274   3e-88    
ref|XP_010443595.1|  PREDICTED: probable phytol kinase 2, chlorop...    276   4e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010503534.1|  PREDICTED: probable phytol kinase 2, chlorop...    273   6e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010520844.1|  PREDICTED: probable phytol kinase 2, chlorop...    274   6e-88    
ref|XP_010453909.1|  PREDICTED: probable phytol kinase 2, chlorop...    275   7e-88    Camelina sativa [gold-of-pleasure]
ref|XP_006401067.1|  hypothetical protein EUTSA_v10014180mg             275   8e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010483456.1|  PREDICTED: probable phytol kinase 2, chlorop...    274   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010689412.1|  PREDICTED: probable phytol kinase 2, chlorop...    273   3e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006847435.1|  hypothetical protein AMTR_s00153p00083300          271   4e-87    
ref|XP_006280848.1|  hypothetical protein CARUB_v10026834mg             272   1e-86    Capsella rubella
ref|XP_009132278.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...    268   8e-86    
gb|KEH28892.1|  phytol kinase                                           267   1e-85    Medicago truncatula
ref|XP_009420002.1|  PREDICTED: probable phytol kinase 2, chlorop...    269   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132038.1|  PREDICTED: probable phytol kinase 2, chlorop...    269   2e-85    Brassica rapa
emb|CBI15916.3|  unnamed protein product                                269   3e-85    Vitis vinifera
emb|CDY70799.1|  BnaAnng35070D                                          268   4e-85    Brassica napus [oilseed rape]
gb|KFK27385.1|  hypothetical protein AALP_AA8G375800                    268   6e-85    Arabis alpina [alpine rockcress]
gb|KCW54677.1|  hypothetical protein EUGRSUZ_I00620                     265   6e-85    Eucalyptus grandis [rose gum]
gb|KEH28894.1|  phytol kinase                                           265   7e-85    Medicago truncatula
ref|XP_010412644.1|  PREDICTED: probable phytol kinase 2, chlorop...    263   9e-84    Camelina sativa [gold-of-pleasure]
gb|EPS57827.1|  hypothetical protein M569_16990                         263   1e-83    Genlisea aurea
ref|XP_006425113.1|  hypothetical protein CICLE_v10028969mg             263   1e-83    
ref|XP_008811675.1|  PREDICTED: probable phytol kinase 2, chlorop...    263   2e-83    Phoenix dactylifera
ref|XP_010910062.1|  PREDICTED: probable phytol kinase 2, chlorop...    261   2e-82    Elaeis guineensis
ref|XP_010426391.1|  PREDICTED: probable phytol kinase 2, chlorop...    258   5e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010650879.1|  PREDICTED: probable phytol kinase 2, chlorop...    257   8e-82    Vitis vinifera
emb|CDY65783.1|  BnaA03g56270D                                          260   1e-81    Brassica napus [oilseed rape]
gb|KCW57521.1|  hypothetical protein EUGRSUZ_H00292                     253   4e-81    Eucalyptus grandis [rose gum]
emb|CDY65781.1|  BnaA03g56250D                                          250   9e-79    Brassica napus [oilseed rape]
gb|AFW84692.1|  hypothetical protein ZEAMMB73_467064                    241   2e-76    
gb|KCW54683.1|  hypothetical protein EUGRSUZ_I00622                     238   7e-75    Eucalyptus grandis [rose gum]
ref|NP_001065534.2|  Os11g0105800                                       240   1e-74    
ref|XP_002442649.1|  hypothetical protein SORBIDRAFT_08g000500          240   2e-74    Sorghum bicolor [broomcorn]
ref|XP_004977649.1|  PREDICTED: probable phytol kinase 2, chlorop...    239   2e-74    
ref|XP_002864581.1|  hypothetical protein ARALYDRAFT_332145             246   3e-74    
ref|XP_004977648.1|  PREDICTED: probable phytol kinase 2, chlorop...    239   3e-74    Setaria italica
ref|XP_004978591.1|  PREDICTED: probable phytol kinase 2, chlorop...    238   6e-74    Setaria italica
gb|EMT05708.1|  Putative phytol kinase 2, chloroplastic                 234   1e-72    
gb|ABA95607.1|  phosphatidate cytidylyltransferase family protein...    235   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EAY81967.1|  hypothetical protein OsI_37144                          235   1e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_002450098.1|  hypothetical protein SORBIDRAFT_05g000470          235   1e-72    Sorghum bicolor [broomcorn]
ref|XP_008676758.1|  PREDICTED: uncharacterized protein LOC100272...    235   1e-72    Zea mays [maize]
ref|NP_001065932.1|  Os12g0105500                                       234   2e-72    
gb|AFW84693.1|  hypothetical protein ZEAMMB73_467064                    230   2e-72    
gb|ACG40052.1|  phytol kinase 2                                         232   2e-71    Zea mays [maize]
ref|XP_006662647.1|  PREDICTED: probable phytol kinase 2, chlorop...    231   3e-71    
dbj|BAA97326.1|  unnamed protein product                                238   5e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KJB20421.1|  hypothetical protein B456_003G147500                    227   6e-71    Gossypium raimondii
ref|XP_003579056.1|  PREDICTED: probable phytol kinase 2, chlorop...    230   9e-71    Brachypodium distachyon [annual false brome]
gb|KCW57523.1|  hypothetical protein EUGRSUZ_H00292                     223   9e-70    Eucalyptus grandis [rose gum]
gb|ADE76360.1|  unknown                                                 229   3e-69    Picea sitchensis
ref|XP_007016938.1|  Phosphatidate cytidylyltransferase family pr...    219   5e-67    
gb|KJB83901.1|  hypothetical protein B456_013G270100                    219   7e-67    Gossypium raimondii
gb|KDO66964.1|  hypothetical protein CISIN_1g022935mg                   215   3e-65    Citrus sinensis [apfelsine]
ref|XP_008805007.1|  PREDICTED: probable phytol kinase 2, chlorop...    208   2e-63    
ref|XP_006387376.1|  hypothetical protein POPTR_1135s00210g             205   6e-63    
gb|EYU45411.1|  hypothetical protein MIMGU_mgv1a012281mg                205   2e-61    Erythranthe guttata [common monkey flower]
ref|XP_006387375.1|  hypothetical protein POPTR_1135s00200g             201   8e-61    
ref|XP_004977650.1|  PREDICTED: probable phytol kinase 2, chlorop...    201   6e-60    
ref|XP_006292344.1|  hypothetical protein CARUB_v10018556mg             200   7e-60    
gb|KCW54682.1|  hypothetical protein EUGRSUZ_I00621                     195   4e-58    Eucalyptus grandis [rose gum]
ref|NP_001140612.1|  uncharacterized protein LOC100272684               194   6e-58    Zea mays [maize]
ref|XP_001766222.1|  predicted protein                                  195   1e-57    
gb|AFW64554.1|  hypothetical protein ZEAMMB73_110888                    192   5e-56    
emb|CDY65782.1|  BnaA03g56260D                                          186   1e-54    Brassica napus [oilseed rape]
gb|EMT05709.1|  Putative phytol kinase 2, chloroplastic                 186   1e-53    
ref|XP_002966017.1|  hypothetical protein SELMODRAFT_230719             184   3e-53    
ref|XP_011098893.1|  PREDICTED: probable phytol kinase 3, chlorop...    181   2e-52    Sesamum indicum [beniseed]
ref|XP_001780576.1|  predicted protein                                  180   8e-52    
ref|XP_004496158.1|  PREDICTED: probable phytol kinase 1, chlorop...    178   2e-50    Cicer arietinum [garbanzo]
ref|XP_007144301.1|  hypothetical protein PHAVU_007G144700g             178   2e-50    Phaseolus vulgaris [French bean]
gb|KEH43364.1|  phytol kinase                                           178   4e-50    Medicago truncatula
ref|NP_001239775.1|  probable phytol kinase 1, chloroplastic            177   5e-50    Glycine max [soybeans]
ref|XP_003556292.1|  PREDICTED: probable phytol kinase 1, chlorop...    177   8e-50    Glycine max [soybeans]
ref|XP_009783010.1|  PREDICTED: probable phytol kinase 1, chlorop...    177   1e-49    Nicotiana sylvestris
ref|XP_004234914.1|  PREDICTED: probable phytol kinase 1, chlorop...    176   3e-49    
ref|XP_006436584.1|  hypothetical protein CICLE_v10032240mg             175   4e-49    Citrus clementina [clementine]
ref|XP_009591844.1|  PREDICTED: probable phytol kinase 1, chlorop...    176   5e-49    Nicotiana tomentosiformis
gb|KJB83903.1|  hypothetical protein B456_013G270100                    172   6e-49    Gossypium raimondii
ref|XP_010067215.1|  PREDICTED: probable phytol kinase 1, chlorop...    175   6e-49    Eucalyptus grandis [rose gum]
ref|XP_006398907.1|  hypothetical protein EUTSA_v10014196mg             174   7e-49    Eutrema salsugineum [saltwater cress]
ref|XP_010067173.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   1e-48    Eucalyptus grandis [rose gum]
ref|XP_008456566.1|  PREDICTED: probable phytol kinase 1, chlorop...    174   1e-48    Cucumis melo [Oriental melon]
ref|XP_001764046.1|  predicted protein                                  172   1e-48    
emb|CBI40186.3|  unnamed protein product                                174   1e-48    Vitis vinifera
ref|XP_002269950.1|  PREDICTED: probable phytol kinase 1, chlorop...    173   2e-48    Vitis vinifera
ref|XP_006838740.1|  hypothetical protein AMTR_s00002p00254420          172   2e-48    
ref|XP_006588439.1|  PREDICTED: probable phytol kinase 1, chlorop...    171   2e-48    Glycine max [soybeans]
ref|XP_002315347.2|  hypothetical protein POPTR_0010s23890g             174   2e-48    
ref|XP_006364440.1|  PREDICTED: probable phytol kinase 1, chlorop...    173   3e-48    Solanum tuberosum [potatoes]
ref|XP_008218940.1|  PREDICTED: probable phytol kinase 1, chlorop...    173   3e-48    Prunus mume [ume]
ref|XP_010490961.1|  PREDICTED: phytol kinase 1, chloroplastic          172   4e-48    Camelina sativa [gold-of-pleasure]
ref|XP_011024295.1|  PREDICTED: probable phytol kinase 1, chlorop...    172   4e-48    Populus euphratica
emb|CDY44860.1|  BnaC09g50600D                                          172   6e-48    Brassica napus [oilseed rape]
ref|XP_009122590.1|  PREDICTED: phytol kinase 1, chloroplastic-like     172   6e-48    Brassica rapa
ref|XP_010423571.1|  PREDICTED: phytol kinase 1, chloroplastic-like     172   7e-48    Camelina sativa [gold-of-pleasure]
ref|XP_009361416.1|  PREDICTED: probable phytol kinase 1, chlorop...    172   9e-48    Pyrus x bretschneideri [bai li]
ref|XP_008375637.1|  PREDICTED: probable phytol kinase 1, chlorop...    171   1e-47    
ref|XP_011094481.1|  PREDICTED: probable phytol kinase 1, chlorop...    171   1e-47    Sesamum indicum [beniseed]
ref|NP_196069.1|  phytol kinase 1                                       171   1e-47    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42044.1|  unknown protein                                         171   1e-47    Arabidopsis thaliana [mouse-ear cress]
gb|KGN63038.1|  hypothetical protein Csa_2G385070                       171   2e-47    Cucumis sativus [cucumbers]
gb|KHN00934.1|  Putative phytol kinase 1, chloroplastic                 168   3e-47    Glycine soja [wild soybean]
ref|XP_010028018.1|  PREDICTED: probable phytol kinase 3, chlorop...    165   3e-47    
ref|XP_010452347.1|  PREDICTED: phytol kinase 1, chloroplastic-like     170   3e-47    Camelina sativa [gold-of-pleasure]
gb|AAM61593.1|  unknown                                                 170   3e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288296.1|  hypothetical protein CARUB_v10001540mg             170   4e-47    Capsella rubella
ref|XP_002871097.1|  hypothetical protein ARALYDRAFT_325092             170   4e-47    Arabidopsis lyrata subsp. lyrata
ref|XP_009130827.1|  PREDICTED: phytol kinase 1, chloroplastic-like     170   5e-47    Brassica rapa
emb|CDO99832.1|  unnamed protein product                                170   6e-47    Coffea canephora [robusta coffee]
ref|XP_007218720.1|  hypothetical protein PRUPE_ppa009034mg             169   6e-47    Prunus persica
ref|XP_010906567.1|  PREDICTED: probable phytol kinase 1, chlorop...    168   7e-47    
ref|XP_004138682.1|  PREDICTED: probable phytol kinase 1, chlorop...    169   8e-47    
emb|CDY69673.1|  BnaCnng64700D                                          169   9e-47    Brassica napus [oilseed rape]
ref|XP_006364441.1|  PREDICTED: probable phytol kinase 1, chlorop...    169   1e-46    
ref|XP_010906565.1|  PREDICTED: probable phytol kinase, chloropla...    169   1e-46    Elaeis guineensis
gb|KHG03995.1|  putative phytol kinase 1, chloroplastic                 169   2e-46    Gossypium arboreum [tree cotton]
ref|XP_004307151.1|  PREDICTED: phytol kinase 1, chloroplastic          168   2e-46    Fragaria vesca subsp. vesca
ref|XP_009396489.1|  PREDICTED: probable phytol kinase, chloropla...    169   2e-46    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60714.1|  phytol kinase                                           166   2e-46    Genlisea aurea
gb|KJB60478.1|  hypothetical protein B456_009G307400                    167   3e-46    Gossypium raimondii
ref|XP_007010114.1|  Vitamin E pathway gene 5 isoform 1                 168   5e-46    
gb|KFK24895.1|  hypothetical protein AALP_AA8G038700                    167   6e-46    Arabis alpina [alpine rockcress]
ref|XP_010552940.1|  PREDICTED: phytol kinase 1, chloroplastic          167   7e-46    Tarenaya hassleriana [spider flower]
gb|KDP45055.1|  hypothetical protein JCGZ_01555                         167   9e-46    Jatropha curcas
gb|KDO66966.1|  hypothetical protein CISIN_1g022935mg                   164   2e-45    Citrus sinensis [apfelsine]
gb|ACP43458.1|  phytol kinase                                           165   2e-45    Lactuca sativa [cultivated lettuce]
ref|XP_010665627.1|  PREDICTED: probable phytol kinase 1, chlorop...    164   1e-44    Beta vulgaris subsp. vulgaris [field beet]
gb|ACF84080.1|  unknown                                                 158   3e-44    Zea mays [maize]
ref|XP_002447301.1|  hypothetical protein SORBIDRAFT_06g032370          160   1e-43    Sorghum bicolor [broomcorn]
ref|XP_001418836.1|  predicted protein                                  159   2e-43    Ostreococcus lucimarinus CCE9901
emb|CDP05574.1|  unnamed protein product                                156   2e-43    Coffea canephora [robusta coffee]
ref|XP_003580789.1|  PREDICTED: probable phytol kinase, chloropla...    160   2e-43    Brachypodium distachyon [annual false brome]
ref|NP_001105847.1|  probable phytol kinase, chloroplastic precursor    160   3e-43    Zea mays [maize]
sp|Q7XR51.1|PHYK1_ORYSJ  RecName: Full=Probable phytol kinase 1, ...    159   4e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AIE88275.1|  hypothetical protein OG_BBa0063K01.6                    159   5e-43    Oryza glaberrima
gb|EEE61880.1|  hypothetical protein OsJ_16572                          159   6e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005643081.1|  hypothetical protein COCSUDRAFT_49246              158   6e-43    Coccomyxa subellipsoidea C-169
gb|ABA42672.1|  phytol kinase                                           157   8e-43    Zea mays [maize]
ref|XP_007010115.1|  Vitamin E pathway gene 5 isoform 2                 158   2e-42    
ref|XP_009396497.1|  PREDICTED: probable phytol kinase, chloropla...    157   4e-42    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278283.1|  PREDICTED: probable phytol kinase, chloropla...    157   4e-42    Nelumbo nucifera [Indian lotus]
gb|KCW65249.1|  hypothetical protein EUGRSUZ_G02725                     152   2e-41    Eucalyptus grandis [rose gum]
ref|XP_010658680.1|  PREDICTED: phytol kinase 1, chloroplastic is...    153   5e-41    Vitis vinifera
ref|XP_002500009.1|  predicted protein                                  150   2e-40    Micromonas commoda
ref|XP_008795886.1|  PREDICTED: probable phytol kinase, chloropla...    152   3e-40    Phoenix dactylifera
ref|XP_002968111.1|  hypothetical protein SELMODRAFT_440293             148   5e-40    
gb|KCW65250.1|  hypothetical protein EUGRSUZ_G02725                     146   1e-39    Eucalyptus grandis [rose gum]
ref|XP_004960241.1|  PREDICTED: probable phytol kinase 2, chlorop...    146   4e-38    Setaria italica
ref|XP_003080172.1|  Predicted ER membrane protein (ISS)                146   5e-38    Ostreococcus tauri
emb|CDP04896.1|  unnamed protein product                                141   5e-38    Coffea canephora [robusta coffee]
ref|XP_011094482.1|  PREDICTED: probable phytol kinase 1, chlorop...    144   6e-38    
gb|EYU39693.1|  hypothetical protein MIMGU_mgv1a014475mg                142   6e-38    Erythranthe guttata [common monkey flower]
sp|Q2N2K3.1|PHYK_WHEAT  RecName: Full=Probable phytol kinase, chl...    145   1e-37    Triticum aestivum [Canadian hard winter wheat]
sp|Q2N2K2.1|PHYK2_SOYBN  RecName: Full=Probable phytol kinase 2, ...    143   4e-37    Glycine max [soybeans]
ref|XP_006436583.1|  hypothetical protein CICLE_v10032240mg             142   9e-37    Citrus clementina [clementine]
ref|XP_008795887.1|  PREDICTED: probable phytol kinase, chloropla...    142   1e-36    Phoenix dactylifera
ref|XP_010556037.1|  PREDICTED: probable phytol kinase 2, chlorop...    135   1e-36    Tarenaya hassleriana [spider flower]
ref|XP_002955247.1|  hypothetical protein VOLCADRAFT_45651              139   3e-36    Volvox carteri f. nagariensis
ref|XP_002532923.1|  Phytol kinase 1, chloroplast precursor, puta...    140   3e-36    
ref|XP_001694607.1|  phytol kinase-related protein                      140   8e-36    Chlamydomonas reinhardtii
ref|XP_010665628.1|  PREDICTED: probable phytol kinase 1, chlorop...    137   9e-35    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004344106.1|  phytol kinase 2, putative                          135   2e-34    Acanthamoeba castellanii str. Neff
ref|XP_003057921.1|  predicted protein                                  134   3e-34    Micromonas pusilla CCMP1545
ref|WP_012164598.1|  phosphatidate cytidylyltransferase                 133   8e-34    Acaryochloris marina
gb|ACG23902.1|  hypothetical protein                                    134   8e-34    Zea mays [maize]
ref|XP_008668661.1|  PREDICTED: probable phytol kinase, chloropla...    134   8e-34    Zea mays [maize]
ref|WP_010480729.1|  phosphatidate cytidylyltransferase                 131   5e-33    Acaryochloris sp. CCMEE 5410
gb|AFW64553.1|  hypothetical protein ZEAMMB73_110888                    130   7e-33    
ref|WP_013560255.1|  phosphatidate cytidylyltransferase                 129   2e-32    Anaerolinea thermophila
ref|WP_040625197.1|  phosphatidate cytidylyltransferase                 129   3e-32    
ref|XP_004960242.1|  PREDICTED: probable phytol kinase 2, chlorop...    130   5e-32    
ref|XP_005645987.1|  hypothetical protein COCSUDRAFT_53992              128   8e-32    Coccomyxa subellipsoidea C-169
ref|XP_008795889.1|  PREDICTED: probable phytol kinase 2, chlorop...    124   4e-30    
ref|XP_007514499.1|  predicted protein                                  124   1e-29    Bathycoccus prasinos
ref|XP_008218941.1|  PREDICTED: probable phytol kinase 1, chlorop...    120   9e-29    Prunus mume [ume]
gb|EWM28810.1|  Phosphatidate cytidylyltransferase                      120   5e-28    Nannochloropsis gaditana
ref|XP_005854647.1|  hypothetical protein NGA_2086500                   119   6e-28    Nannochloropsis gaditana CCMP526
ref|XP_006653001.1|  PREDICTED: probable phytol kinase 1, chlorop...    115   2e-27    
dbj|GAM20177.1|  hypothetical protein SAMD00019534_033520               115   2e-27    Acytostelium subglobosum LB1
ref|XP_005706670.1|  phosphatidate cytidylyltransferase/ phytol k...    116   8e-27    Galdieria sulphuraria
ref|XP_008795888.1|  PREDICTED: probable phytol kinase, chloropla...    114   2e-26    
gb|KCW54678.1|  hypothetical protein EUGRSUZ_I00620                   97.4    4e-26    Eucalyptus grandis [rose gum]
emb|CBJ48773.1|  Probable phytol kinase, chloroplast precursor, c...    110   8e-25    Ectocarpus siliculosus
ref|XP_004351203.1|  hypothetical protein DFA_10953                     106   9e-24    Cavenderia fasciculata
ref|XP_005850569.1|  hypothetical protein CHLNCDRAFT_140477             107   1e-23    Chlorella variabilis
ref|XP_005777419.1|  hypothetical protein EMIHUDRAFT_469241             107   1e-23    Emiliania huxleyi CCMP1516
gb|EMS55542.1|  putative phytol kinase, chloroplastic                   106   1e-23    Triticum urartu
ref|XP_002668969.1|  predicted protein                                  106   2e-23    Naegleria gruberi strain NEG-M
ref|XP_011400679.1|  putative phytol kinase 3, chloroplastic            104   5e-23    Auxenochlorella protothecoides
ref|XP_005773265.1|  hypothetical protein EMIHUDRAFT_369009             104   5e-23    Emiliania huxleyi CCMP1516
ref|XP_005770298.1|  hypothetical protein EMIHUDRAFT_436338             104   6e-23    Emiliania huxleyi CCMP1516
ref|XP_002946158.1|  hypothetical protein VOLCADRAFT_55632              104   6e-23    Volvox carteri f. nagariensis
ref|XP_004996012.1|  hypothetical protein PTSG_03426                    103   6e-23    Salpingoeca rosetta
ref|XP_005818786.1|  hypothetical protein GUITHDRAFT_149059             104   9e-23    Guillardia theta CCMP2712
gb|EFA81634.1|  hypothetical protein PPL_05626                          102   1e-22    Heterostelium album PN500
ref|XP_005781745.1|  hypothetical protein EMIHUDRAFT_99736              101   1e-21    Emiliania huxleyi CCMP1516
gb|KCW54679.1|  hypothetical protein EUGRSUZ_I00620                   97.1    2e-21    Eucalyptus grandis [rose gum]
gb|KHN37861.1|  Putative phytol kinase 1, chloroplastic               96.3    3e-21    Glycine soja [wild soybean]
ref|XP_008349551.1|  PREDICTED: probable phytol kinase 2, chlorop...  98.6    3e-21    
gb|KCW54680.1|  hypothetical protein EUGRSUZ_I00620                   97.1    4e-21    Eucalyptus grandis [rose gum]
ref|XP_003289382.1|  hypothetical protein DICPUDRAFT_88483            99.0    4e-21    Dictyostelium purpureum
gb|AFW84638.1|  hypothetical protein ZEAMMB73_788794                  91.3    1e-19    
ref|XP_002178808.1|  predicted protein                                94.7    2e-19    Phaeodactylum tricornutum CCAP 1055/1
dbj|BAG88541.1|  unnamed protein product                              90.5    3e-19    Oryza sativa Japonica Group [Japonica rice]
gb|AEV40976.1|  putative phosphatidate cytidylyltransferase           90.5    4e-19    Oryza punctata
ref|XP_645174.1|  hypothetical protein DDB_G0272380                   92.8    6e-19    Dictyostelium discoideum AX4
gb|EWM22868.1|  phosphatidate cytidylyltransferase                    93.2    9e-19    Nannochloropsis gaditana
gb|AEV41120.1|  putative phosphatidate cytidylyltransferase           89.4    1e-18    Oryza officinalis
gb|AEV41074.1|  putative phosphatidate cytidylyltransferase           89.0    1e-18    Oryza minuta
ref|WP_017309557.1|  phosphatidate cytidylyltransferase               90.9    3e-18    Fischerella sp. PCC 9339
ref|XP_005538511.1|  hypothetical protein, conserved                  92.8    4e-18    Cyanidioschyzon merolae strain 10D
ref|WP_016859908.1|  phosphatidate cytidylyltransferase               89.7    7e-18    Fischerella muscicola
ref|XP_010906566.1|  PREDICTED: probable phytol kinase, chloropla...  90.1    8e-18    Elaeis guineensis
ref|NP_001054214.1|  Os04g0670700                                     86.3    1e-17    
ref|WP_026723041.1|  phosphatidate cytidylyltransferase               87.8    4e-17    
ref|XP_650979.1|  hypothetical protein                                85.5    2e-16    
ref|XP_001696576.1|  predicted protein                                89.4    3e-16    
gb|KJB60479.1|  hypothetical protein B456_009G307400                  84.7    3e-16    
ref|XP_001735667.1|  hypothetical protein                             84.7    4e-16    
ref|XP_001735047.1|  hypothetical protein                             84.7    4e-16    
ref|XP_002970593.1|  hypothetical protein SELMODRAFT_411298           82.8    4e-16    
dbj|BAN41720.1|  hypothetical protein, conserved                      83.6    1e-15    
ref|XP_004183825.1|  hypothetical protein EIN_168840                  83.2    1e-15    
ref|XP_011398499.1|  putative phytol kinase 1, chloroplastic          82.8    1e-15    
ref|XP_008860791.1|  phosphatidate cytidylyltransferase               83.2    1e-15    
ref|WP_009455416.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  83.2    1e-15    
ref|XP_008857866.1|  phosphatidate cytidylyltransferase               82.8    1e-15    
gb|EMS14287.1|  phosphatidate cytidylyltransferase, putative          82.8    2e-15    
ref|WP_016865492.1|  phosphatidate cytidylyltransferase               82.8    2e-15    
ref|XP_002289701.1|  predicted protein                                84.3    2e-15    
ref|WP_017748439.1|  hypothetical protein                             82.4    2e-15    
dbj|BAN42092.1|  hypothetical protein, conserved                      82.0    3e-15    
gb|EMD43429.1|  phosphatidate cytidylyltransferase, putative          81.6    4e-15    
dbj|BAN41395.1|  hypothetical protein, conserved                      81.6    5e-15    
ref|XP_647969.1|  hypothetical protein                                81.3    5e-15    
ref|WP_008085193.1|  phosphatidate cytidylyltransferase               82.0    5e-15    
ref|WP_017318032.1|  phosphatidate cytidylyltransferase               81.3    6e-15    
ref|WP_008082386.1|  phosphatidate cytidylyltransferase               81.3    8e-15    
ref|XP_004184212.1|  hypothetical protein EIN_284420                  80.9    8e-15    
ref|WP_012507193.1|  phosphatidate cytidylyltransferase               80.1    1e-14    
ref|WP_016874337.1|  phosphatidate cytidylyltransferase               79.7    2e-14    
ref|WP_041041323.1|  phosphatidate cytidylyltransferase               79.3    2e-14    
gb|KIY99927.1|  Phytol kinase 1                                       78.6    3e-14    
gb|AFW64552.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  76.6    8e-14    
ref|XP_001735373.1|  hypothetical protein                             77.8    8e-14    
ref|WP_015283132.1|  dolichol kinase                                  77.8    1e-13    
ref|WP_041467762.1|  phosphatidate cytidylyltransferase               77.4    1e-13    
gb|ABL66347.1|  phosphatidate cytidylyltransferase                    77.0    1e-13    
ref|XP_004260841.1|  hypothetical protein EIN_183870                  75.9    5e-13    
ref|XP_004255447.1|  hypothetical protein EIN_192850                  75.5    5e-13    
ref|WP_027841469.1|  phosphatidate cytidylyltransferase               73.2    4e-12    
ref|WP_015118115.1|  dolichol kinase                                  72.4    6e-12    
ref|XP_004183951.1|  hypothetical protein EIN_172200                  72.4    6e-12    
ref|WP_040433468.1|  phosphatidate cytidylyltransferase               72.4    6e-12    
ref|WP_012501506.1|  phosphatidate cytidylyltransferase               72.4    6e-12    
gb|EAT58783.1|  Phosphatidate cytidylyltransferase                    72.4    7e-12    
ref|WP_011357002.1|  phosphatidate cytidylyltransferase               72.0    8e-12    
dbj|BAN42014.1|  hypothetical protein, conserved                      72.0    8e-12    
ref|XP_008857211.1|  hypothetical protein ENU1_090200                 71.6    9e-12    
ref|WP_041466046.1|  phosphatidate cytidylyltransferase               71.6    1e-11    
gb|ACD91195.1|  phosphatidate cytidylyltransferase                    71.6    1e-11    
gb|KIE09019.1|  phosphatidate cytidylyltransferase                    71.6    1e-11    
ref|WP_026735418.1|  phosphatidate cytidylyltransferase               71.2    2e-11    
ref|WP_010933646.1|  phosphatidate cytidylyltransferase               70.9    2e-11    
emb|CDP14245.1|  unnamed protein product                              68.6    5e-11    
emb|CBK19603.2|  unnamed protein product                              68.9    5e-11    
ref|WP_041471667.1|  phosphatidate cytidylyltransferase               69.3    7e-11    
gb|ACE05130.1|  phosphatidate cytidylyltransferase                    69.3    8e-11    
ref|XP_648836.1|  hypothetical protein                                68.9    9e-11    
ref|XP_004259054.1|  hypothetical protein EIN_119570                  68.9    2e-10    
ref|XP_010095178.1|  hypothetical protein L484_005212                 65.9    3e-09    
ref|WP_011824669.1|  dolichol kinase                                  63.9    6e-09    
ref|WP_038654837.1|  dolichol kinase                                  63.5    7e-09    
ref|WP_026102604.1|  phosphatidate cytidylyltransferase               63.5    9e-09    
ref|WP_010306053.1|  dolichol kinase                                  62.0    4e-08    
ref|XP_009804931.1|  PREDICTED: probable phytol kinase 2, chlorop...  59.7    4e-08    
emb|CBK25124.2|  unnamed protein product                              60.1    5e-08    
ref|WP_035402200.1|  phosphatidate cytidylyltransferase               61.6    6e-08    
ref|WP_011295650.1|  dolichol kinase                                  60.5    1e-07    
ref|WP_006512393.1|  dolichol kinase                                  59.7    2e-07    
ref|WP_011889556.1|  phosphatidate cytidylyltransferase               58.5    6e-07    
ref|WP_013643755.1|  phosphatidate cytidylyltransferase               57.4    8e-07    
dbj|BAM70495.1|  putative cytidylyltransferase                        56.2    2e-06    
ref|WP_004029428.1|  phosphatidate cytidylyltransferase               55.8    3e-06    
gb|ABM79726.1|  Dolichol kinase                                       56.2    3e-06    
ref|WP_022344140.1|  integral membrane protein                        56.2    3e-06    
ref|XP_004257868.1|  phosphatidate cytidylyltransferase, putative     54.7    4e-06    
ref|XP_002970346.1|  hypothetical protein SELMODRAFT_411288           54.7    4e-06    
ref|WP_041374995.1|  dolichol kinase                                  55.8    5e-06    
ref|WP_010876985.1|  phosphatidate cytidylyltransferase               55.1    5e-06    
ref|WP_011131611.1|  dolichol kinase                                  55.5    7e-06    
ref|WP_021788544.1|  cytidylyltransferase family protein              55.5    7e-06    
ref|WP_013296538.1|  phosphatidate cytidylyltransferase               54.7    8e-06    
ref|WP_036900951.1|  dolichol kinase                                  55.1    1e-05    
gb|KGG10597.1|  phytol kinase                                         54.7    1e-05    
ref|WP_007099399.1|  dolichol kinase                                  54.7    1e-05    
ref|WP_012196383.1|  dolichol kinase                                  54.7    1e-05    
ref|WP_011126013.1|  MULTISPECIES: dolichol kinase                    54.7    1e-05    
ref|WP_021786189.1|  cytidylyltransferase family protein              55.5    1e-05    
ref|WP_039725000.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  54.3    2e-05    
ref|WP_012538167.1|  membrane protein                                 53.5    2e-05    
ref|WP_015168761.1|  dolichol kinase                                  53.9    3e-05    
ref|WP_017298107.1|  hypothetical protein                             53.9    3e-05    
ref|WP_036914894.1|  MULTISPECIES: dolichol kinase                    53.5    3e-05    
ref|WP_015191507.1|  phosphatidate cytidylyltransferase               53.9    3e-05    
dbj|GAN33990.1|  membrane protein                                     54.3    4e-05    
ref|WP_036919648.1|  MULTISPECIES: dolichol kinase                    53.1    4e-05    
ref|WP_013325056.1|  phosphatidate cytidylyltransferase               53.1    5e-05    
ref|WP_014696273.1|  membrane protein                                 52.4    6e-05    
gb|AHF65041.1|  hypothetical protein Syncc8109_2735                   52.8    6e-05    
ref|WP_008514072.1|  dolichol kinase                                  52.0    7e-05    
emb|CEA13580.1|  phosphatidate cytidylyltransferase                   52.0    8e-05    
ref|WP_026824512.1|  phosphatidate cytidylyltransferase               52.4    8e-05    
ref|WP_044281169.1|  hypothetical protein                             52.4    9e-05    
gb|EHO41581.1|  phosphatidate cytidylyltransferase                    52.4    1e-04    
ref|WP_036482643.1|  phosphatidate cytidylyltransferase               52.0    1e-04    
ref|WP_012538883.1|  membrane protein                                 51.6    1e-04    
ref|WP_013826837.1|  phosphatidate cytidylyltransferase               51.2    1e-04    
ref|XP_004258684.1|  hypothetical protein EIN_398830                  51.6    1e-04    
ref|WP_013275289.1|  hypothetical protein                             52.8    2e-04    
ref|WP_010900735.1|  dolichol kinase                                  52.0    2e-04    
ref|WP_011178183.1|  cytidylyltransferase family protein              52.0    2e-04    
ref|WP_015880508.1|  MULTISPECIES: phosphatidate cytidylyltransfe...  51.2    2e-04    
gb|KCZ73106.1|  dolichol kinase                                       50.8    2e-04    
gb|ETZ18513.1|  putative membrane spanning protein                    48.9    3e-04    
ref|WP_024655404.1|  membrane protein                                 50.4    3e-04    
ref|WP_009788583.1|  dolichol kinase                                  50.4    4e-04    
ref|WP_028459871.1|  phosphatidate cytidylyltransferase               50.8    4e-04    
ref|WP_009627750.1|  phosphatidate cytidylyltransferase               50.4    4e-04    
ref|WP_028105465.1|  phosphatidate cytidylyltransferase               50.1    5e-04    
ref|WP_004162270.1|  phosphatidate cytidylyltransferase               50.1    5e-04    
ref|WP_021794460.1|  dolichol kinase                                  50.8    5e-04    
ref|WP_011361028.1|  dolichol kinase                                  49.7    7e-04    
ref|WP_040236322.1|  membrane protein                                 48.9    7e-04    
ref|WP_043402075.1|  hypothetical protein                             50.4    7e-04    
gb|KGG13734.1|  phytol kinase                                         48.9    7e-04    
gb|KJE48545.1|  hypothetical protein TZ01_08955                       50.1    7e-04    
ref|WP_010313810.1|  dolichol kinase                                  49.3    9e-04    



>ref|XP_009591334.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
tomentosiformis]
Length=294

 Score =   326 bits (835),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 170/214 (79%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSGRQGA++AALIPGLNI K+LLLGL
Sbjct  81   WEETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGRQGAILAALIPGLNIIKMLLLGL  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KDD TVKSMSRFGD+RELLKGPLYYA TITLACAVYWR SPIAI L+CNLCAGDG+A
Sbjct  141  GLWKDDATVKSMSRFGDHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLCAGDGIA  200

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+NKNKSFAGSIAMAA GFLASIG++HYFS FG ++++ HMV GFL V
Sbjct  201  DIVGRRFGKQKLPYNKNKSFAGSIAMAAAGFLASIGYLHYFSLFGYIQESSHMVFGFLFV  260

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAALVESHP+STELDDNLTVPL SVL GS + 
Sbjct  261  SLAAALVESHPISTELDDNLTVPLTSVLVGSLVL  294



>ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
sylvestris]
Length=298

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSGRQGA++A+LIPGLNI K+LLLGL
Sbjct  85   WEETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGRQGAILASLIPGLNIIKMLLLGL  144

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KDD TVKSMSRFGD+RELLKGPLYYA TITLACAVYWR SPIAI L+CNLCAGDG+A
Sbjct  145  GLWKDDATVKSMSRFGDHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLCAGDGIA  204

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+NKNKSFAGSIAMA+ GFLASIG++HYFS FG ++++ H V GFL V
Sbjct  205  DIVGRRFGKQKLPYNKNKSFAGSIAMASAGFLASIGYLHYFSLFGYIQESSHTVFGFLFV  264

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAALVESHP+STELDDNLTVPL S+L GS + 
Sbjct  265  SLAAALVESHPISTELDDNLTVPLTSMLVGSLVL  298



>ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=292

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WE+ AKRG FDQ LNRKLVHV++G+ FMLCWPMFSSGRQGA++AALIPG+NI K+LLLGL
Sbjct  79   WEQTAKRGVFDQKLNRKLVHVTVGLAFMLCWPMFSSGRQGAILAALIPGINIIKMLLLGL  138

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD TVKSMSRFGDYRELLKGPLYYA TITLA A+YWR+SPIAIA VCNLCAGDGMA
Sbjct  139  GIWKDDATVKSMSRFGDYRELLKGPLYYASTITLASAIYWRTSPIAIAAVCNLCAGDGMA  198

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S KLP+N+NKS  GSI MA  GFLAS+G+M YFSSFG ++++ +MVLGFL+V
Sbjct  199  DIVGRRFGSQKLPYNQNKSVVGSITMACAGFLASVGYMFYFSSFGYIQESTNMVLGFLIV  258

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AAALVESHPLSTELDDNLTVPLA+VL GS + 
Sbjct  259  SIAAALVESHPLSTELDDNLTVPLAAVLVGSLVL  292



>gb|EYU45412.1| hypothetical protein MIMGU_mgv1a010789mg [Erythranthe guttata]
Length=301

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ LNRK+VHV++G+ FMLCWPMFSSGRQGA+VAALIPG+NI K+LLLGL
Sbjct  88   WEETAKRGVFDQKLNRKIVHVTVGLAFMLCWPMFSSGRQGAIVAALIPGINIVKMLLLGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSRFG+++ELLKGPLYYA TITLA A+YWR+SPIAIA VCNLCAGDGMA
Sbjct  148  GIWKDEATVKSMSRFGNHKELLKGPLYYAATITLAGAIYWRTSPIAIAAVCNLCAGDGMA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+N+NKS  GSIAMA  GFLASIG+M YFSSFG +E++P MV+GFL+ 
Sbjct  208  DIVGRRFGTQKLPYNQNKSAVGSIAMACAGFLASIGYMLYFSSFGFIEESPKMVMGFLIT  267

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AAALVESHP+STELDDNLTVPL +VL GS +F
Sbjct  268  SVAAALVESHPISTELDDNLTVPLTAVLVGSLVF  301



>gb|ADZ24711.1| phytol kinase [Solanum pennellii]
Length=293

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 184/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+ LLGL
Sbjct  80   WEETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMFLLGL  139

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD TVKSMSRFGD+RELLKGPLYYA++IT ACA+YWR SPI+I L+CNLCAGDG+A
Sbjct  140  GIWKDDATVKSMSRFGDHRELLKGPLYYALSITCACAIYWRYSPISIGLICNLCAGDGIA  199

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+NKNKSFAGSIAMAA G LASIGF+HYFS FG ++     VLGFL +
Sbjct  200  DIVGRRFGKQKLPYNKNKSFAGSIAMAAAGLLASIGFLHYFSLFGYIQVNSKTVLGFLFI  259

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            SLAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  260  SLAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum]
Length=293

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 184/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+ LLGL
Sbjct  80   WEETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMFLLGL  139

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD TVKSMSRFGD+RELLKGPLYYA++IT ACA+YWR SPI+I L+CNLCAGDG+A
Sbjct  140  GIWKDDATVKSMSRFGDHRELLKGPLYYALSITCACAIYWRYSPISIGLICNLCAGDGIA  199

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+NKNKSFAGSIAMAA G LASIGF+HYFS FG ++     VLGFL +
Sbjct  200  DIVGRRFGKQKLPYNKNKSFAGSIAMAAAGLLASIGFLHYFSLFGYIQVNSKTVLGFLFM  259

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            SLAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  260  SLAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Solanum 
tuberosum]
Length=293

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 184/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ  NRKLVH+S+G+VFMLCWPMFSSG+QGA++AA IPGLNI K+LLLGL
Sbjct  80   WEETAKRGVFDQKTNRKLVHISIGLVFMLCWPMFSSGQQGAILAAFIPGLNIIKMLLLGL  139

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD TVKSMSRFGD+RELLKGPLYYA +IT ACA+YWR SPI+I L+CNLCAGDG+A
Sbjct  140  GIWKDDATVKSMSRFGDHRELLKGPLYYAFSITYACAIYWRYSPISIGLICNLCAGDGIA  199

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+NKNKSFAGSIAMAA GFLAS+GF+ YFS  G ++ +   VLGFL +
Sbjct  200  DIVGRRFGKQKLPYNKNKSFAGSIAMAAAGFLASLGFLFYFSLLGYIQVSSKTVLGFLFM  259

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            SLAAALVESHPLS+ELDDNLTVPL SVL GS +
Sbjct  260  SLAAALVESHPLSSELDDNLTVPLTSVLVGSLV  292



>ref|XP_007205802.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
 gb|EMJ07001.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
Length=241

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG+FDQ LNRK VHVS+G+VFMLCWP+FSSG QGA +A+L PG+NIF++LLLGL
Sbjct  28   WEETAKRGFFDQKLNRKFVHVSIGLVFMLCWPLFSSGLQGAFLASLTPGINIFRMLLLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKS+SR GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+A
Sbjct  88   GIWKDEATVKSISRSGDYRELLKGPLYYATTITLACIIYWRTSPIAIALICNLCAGDGLA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + K+P+N+NKS  GS+AMA+ GFL SIG+MHYFS FG ++++  MVLGFLVV
Sbjct  148  DIVGRRFGTRKIPYNRNKSIVGSVAMASAGFLTSIGYMHYFSRFGFVQESWDMVLGFLVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST++DDNLTVPL S+L G  +F
Sbjct  208  SLASALVESLPISTDVDDNLTVPLTSILVGGLVF  241



>ref|XP_008384758.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=325

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRK VHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGL
Sbjct  112  WQETAKRGIFDQKLNRKFVHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGL  171

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+GD+RELLKGPLYYA TITLAC VYWR+SPIAIAL+CNLCAGDG+A
Sbjct  172  GIWKDEATVKSMSRYGDHRELLKGPLYYATTITLACLVYWRTSPIAIALICNLCAGDGLA  231

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+N+NKS AGS+AMA+ GFL SIG+M+YFSSFG ++++  M LGFLVV
Sbjct  232  DIVGRRFGTQKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGFLVV  291

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S L GS +F
Sbjct  292  SLASALVESLPISTELDDNLTVSLTSALIGSLVF  325



>ref|XP_010069238.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57520.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=241

 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS+G++FMLCWP+FSSG + AL+AA +PGLNI ++LL+G 
Sbjct  28   FEETAKRGLFDQKLNRKLVHVSIGIIFMLCWPLFSSGHRSALLAATVPGLNIIRVLLVGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+  VKSMSRFGD+RELLKGPLYYA TIT ACA YW++SPIAIA +CNLCAGDG A
Sbjct  88   GIWKDEAIVKSMSRFGDHRELLKGPLYYASTITFACAYYWKTSPIAIAAICNLCAGDGFA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGRR    KLP+N NKSFAGSIAMA+ GFLAS+GFM YFSSFG ++ +  MV GFL+V
Sbjct  148  DIIGRRFGHHKLPYNSNKSFAGSIAMASAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVESHPLS+ELDDNLTVPL S+L GS +F
Sbjct  208  SLASALVESHPLSSELDDNLTVPLTSMLVGSLVF  241



>ref|XP_004294311.1| PREDICTED: probable phytol kinase 2, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WE+ AKRG FDQ LNRKLVH+S+G+VFMLCWP+FSSG QGAL+A+LIPGLNI ++LLLGL
Sbjct  103  WEQTAKRGVFDQKLNRKLVHISIGLVFMLCWPLFSSGYQGALLASLIPGLNIIRMLLLGL  162

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+KD+ TVKSMSR+ DYRELLKGPLYYA  IT AC VY+R+SP+AIAL+CNLCAGDG+A
Sbjct  163  GIMKDEATVKSMSRYNDYRELLKGPLYYATAITWACVVYYRTSPVAIALICNLCAGDGLA  222

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR  + K+P+N+NKS AGS+AMA+ GFL+SIG+M+YFS FG ++K+  MVLGFLVV
Sbjct  223  DVVGRRFGTQKIPYNRNKSIAGSVAMASAGFLSSIGYMYYFSKFGFVDKSWDMVLGFLVV  282

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTVPL S+L GS IF
Sbjct  283  SLASALVESLPISTELDDNLTVPLTSILVGSFIF  316



>ref|XP_008221407.1| PREDICTED: probable phytol kinase 3, chloroplastic [Prunus mume]
Length=325

 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE AKRG FDQ LNRK VHVS+G+VFMLCWP+FSSG +GA +A+L PG+NIF++LLLGL
Sbjct  112  WEETAKRGVFDQKLNRKCVHVSIGLVFMLCWPLFSSGLRGAFLASLTPGINIFRMLLLGL  171

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKS+SR+GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+A
Sbjct  172  GIWKDEATVKSISRYGDYRELLKGPLYYATTITLACIIYWRTSPIAIALICNLCAGDGLA  231

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + K+P+N+NKS  GS+AMA+ GFL SIG+MHYFS FG ++++  MVLGFLVV
Sbjct  232  DIVGRRFGTRKIPYNRNKSVVGSVAMASAGFLTSIGYMHYFSRFGFVQESWGMVLGFLVV  291

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST LDDNLTVPLAS+L GS +F
Sbjct  292  SLASALVESLPISTNLDDNLTVPLASILVGSLVF  325



>emb|CDP09225.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EIAK G  DQ LNRKLVHVS+G+VFMLCWPMFSSG +GA++AALIPG+NI K+LLLGL
Sbjct  28   WGEIAKMGVLDQKLNRKLVHVSIGLVFMLCWPMFSSGNRGAVLAALIPGVNIIKVLLLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+ TVKSMSRFGD+RELLKGPLYYA TITLACA+ WR+SPIAIA +CNLCAGDG+A
Sbjct  88   GVYEDEATVKSMSRFGDHRELLKGPLYYATTITLACALCWRTSPIAIAAICNLCAGDGLA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S KLP+NKNKS  G+ +M   GFLASIG+MHYFS+FG +E++  M   F VV
Sbjct  148  DIMGRRFGSKKLPYNKNKSIVGTFSMVVAGFLASIGYMHYFSTFGYVEESWQMAYRFFVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL AALVESHP+STELDDNLTVPL SVL GS +F
Sbjct  208  SLVAALVESHPISTELDDNLTVPLTSVLVGSFVF  241



>ref|XP_009369583.1| PREDICTED: probable phytol kinase 2, chloroplastic [Pyrus x bretschneideri]
Length=326

 Score =   298 bits (764),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVHVS+G+VFMLCWP+FSSG QGA  A+L PGLNIF++LLLGL
Sbjct  113  WQETAKRGIFDQKLNRKLVHVSIGLVFMLCWPLFSSGLQGAFFASLTPGLNIFRMLLLGL  172

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+GD+RELLKGPLYYA TITLAC VYWR+SPIAIAL+CNLCAGDG+A
Sbjct  173  GIWKDEATVKSMSRYGDHRELLKGPLYYATTITLACLVYWRTSPIAIALICNLCAGDGLA  232

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GR+  + KLP+N+NKS AGS+AMA+ GFL SIG+M+YFSSFG ++++  M LGFLVV
Sbjct  233  DIVGRQFGTLKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGFLVV  292

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST+LDDNLTV L S L GS +F
Sbjct  293  SLASALVESLPISTKLDDNLTVSLTSALIGSLVF  326



>ref|XP_002516647.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45742.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=304

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E A RG FDQ LNRKLVH+S+G+VFMLCWP+FSSG QGA++AAL PG+NIF++LLLGL
Sbjct  91   WKETAIRGIFDQKLNRKLVHISIGLVFMLCWPLFSSGHQGAILAALTPGVNIFRMLLLGL  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSRFGD+RELLKGPLYYA+TITLACA+YWR+SPIAIA +CNLCAGDG+A
Sbjct  151  GIWKDEATVKSMSRFGDHRELLKGPLYYALTITLACAIYWRTSPIAIAAICNLCAGDGIA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+N++KS AGSIAMA  GF+AS+ FM+YF+SFG L K+  M+LGFLVV
Sbjct  211  DIVGRRFGRQKIPYNRDKSIAGSIAMALAGFIASVMFMYYFASFGYLRKSYEMILGFLVV  270

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ LVES P+STELDDNLTV + S+L G+ +F
Sbjct  271  SLASTLVESLPISTELDDNLTVTVTSILLGTLVF  304



>gb|KHG05203.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=306

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G 
Sbjct  93   WQETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIMRMILIGS  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA YWR+SPIAIA +CNLCAGDG A
Sbjct  153  GLWKDEATVKSMSRYGDYRELLKGPLYYATTITLACAFYWRTSPIAIAAICNLCAGDGFA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GR+    KLP+NKNKS AGS+AMA  GF  S+G+M+YFS FG ++++  +V GFL+V
Sbjct  213  DIVGRQFGGQKLPYNKNKSIAGSVAMAIAGFFTSVGYMYYFSYFGYIKESTEIVFGFLIV  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  273  SLASALVESLPVSTELDDNLTVTLTSILVGSLVF  306



>ref|XP_002313239.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87194.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=237

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AK G  DQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G 
Sbjct  25   WKETAKHG-LDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQILLIGS  83

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMA
Sbjct  84   GMWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMA  143

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVV
Sbjct  144  DIVGRRFGRQKIPYNKNKSIAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVV  203

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+A VES P+STELDDNLTV L S+L G+ +F
Sbjct  204  SLASAFVESLPISTELDDNLTVTLTSILLGNLVF  237



>ref|XP_007016939.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY34558.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=307

 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKR   DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G 
Sbjct  94   WQETAKRRLCDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGS  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+A
Sbjct  154  GLWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    KLP+N NKS AGS+AMA  GFLAS+GFM+YF+ FG ++++  +VLGFLVV
Sbjct  214  DVVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVGFMYYFAYFGYIQESWEIVLGFLVV  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  274  SLASALVESLPISTELDDNLTVTLTSILVGSLVF  307



>ref|XP_007016937.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34556.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=352

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 185/214 (86%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG  DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G 
Sbjct  140  WQETAKRG-LDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGS  198

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+A
Sbjct  199  GLWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIA  258

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    KLP+N NKS AGS+AMA  GFLAS+GFM+YF+ FG ++++  +VLGFLVV
Sbjct  259  DVVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVGFMYYFAYFGYIQESWEIVLGFLVV  318

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  319  SLASALVESLPISTELDDNLTVTLTSILVGSLVF  352



>gb|KJB83902.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=306

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G 
Sbjct  93   WQETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGS  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG A
Sbjct  153  GLWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDGFA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GR+    KLP+NKNKS AGS+AMA  GFL S+G+M+YFS FG ++++  +V GFL+V
Sbjct  213  DIVGRQFGGQKLPYNKNKSIAGSVAMAIAGFLTSVGYMYYFSYFGYIKESTEIVFGFLIV  272

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+STELDDNLTV L S+L GS +F
Sbjct  273  SIASALVESLPVSTELDDNLTVTLTSILVGSLVF  306



>gb|KDP45737.1| hypothetical protein JCGZ_17344 [Jatropha curcas]
Length=297

 Score =   293 bits (749),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKR  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AAL PG+NIF++L+LGL
Sbjct  84   WQETAKRRLFDQKLNRKLVHISIGLVFMLCWPLFSSGHRGAILAALTPGINIFRMLILGL  143

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSRFGD+RELLKGPLYYA+TITL CA+YWR+SPI IA +CNLCAGDGMA
Sbjct  144  GIWKDEATVKSMSRFGDHRELLKGPLYYALTITLTCAIYWRTSPITIAAICNLCAGDGMA  203

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+N NKS AGS+AMA  GFLASI +MHYF+SFG + ++  M +GFLVV
Sbjct  204  DIVGRRFGNHKLPYNTNKSIAGSVAMALAGFLASITYMHYFASFGYVRESWEMTMGFLVV  263

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+A+VES P+ST+LDDNLTV L SVL G+ +F
Sbjct  264  SIASAIVESLPISTQLDDNLTVSLTSVLLGTLVF  297



>ref|XP_010028019.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW54676.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=241

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG 
Sbjct  28   FEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG A
Sbjct  88   GIWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAICNLCAGDGFA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGRR+   K+P+N+NKS AGSIAM   GFLAS+GFM YFSSFG +  +  M  GFLVV
Sbjct  148  DIIGRRLGQHKIPYNRNKSLAGSIAMGCAGFLASLGFMSYFSSFGYIRGSWEMASGFLVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVESHPLS+ LDDNLTVPL   L GS +F
Sbjct  208  SLASALVESHPLSSRLDDNLTVPLTCALVGSLVF  241



>ref|XP_002313238.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87193.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=313

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            + E  KR  FDQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G 
Sbjct  100  FAETTKRHVFDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQILLIGS  159

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMA
Sbjct  160  GMWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMA  219

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVV
Sbjct  220  DIVGRRFGRQKIPYNKNKSIAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVV  279

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+A VES P+STELDDNLTV L S+L G+ +F
Sbjct  280  SLASAFVESLPISTELDDNLTVTLTSILLGNLVF  313



>ref|XP_011003760.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
 ref|XP_011003768.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
Length=241

 Score =   288 bits (738),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AK G  DQ LNRKLVH+S+G+VFML WP+FSSG +GAL+AAL PG+NI ++LL+G 
Sbjct  29   WKETAKHG-LDQKLNRKLVHISIGLVFMLWWPIFSSGHRGALLAALTPGVNIIRMLLIGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G  KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMA
Sbjct  88   GTWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVV
Sbjct  148  DIVGRRFGRQKIPYNKNKSIAGSVAMALAGFVASVGFMYYFASFGYVQKSREMLLGFLVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+A VES P+STELDDNLTV L S+L G  +F
Sbjct  208  SLASAFVESLPISTELDDNLTVTLTSILLGHLVF  241



>gb|KEH34361.1| phytol kinase [Medicago truncatula]
Length=301

 Score =   290 bits (742),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E AKRG FDQ LNRKLVH+++G+VFMLCWP+F +GR     AA IPG+NI ++ ++G 
Sbjct  88   FKETAKRGLFDQKLNRKLVHITIGLVFMLCWPLFGNGRWAPFYAAFIPGVNILRMFVIGS  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ TVKSMSRFGDYRELL+GPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMA
Sbjct  148  GILKDEATVKSMSRFGDYRELLRGPLYYAATITLASMIYWRTSPISIAAICNLCAGDGMA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S KLP+NKNKS+AGSIAMA+ GFLASIG+M YFSSFG +E     V+GFLVV
Sbjct  208  DIVGRRFGSEKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSSFGYMEGGWSKVIGFLVV  267

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+  A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  268  SVITAVVESHPISTDLDDNLTVPLTSILVGSMVF  301



>ref|XP_002278580.2| PREDICTED: probable phytol kinase 2, chloroplastic [Vitis vinifera]
Length=309

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EIAKRG+FDQ + RKLVH+S+G+VFML WP+FSSGRQGA++AALIPG+NI ++LLLGL
Sbjct  96   WGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPLFSSGRQGAVLAALIPGVNIIRMLLLGL  155

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+  VKSMSR GD+RELLKGPLYYA  ITLACA+YWR+SPIAIA +CNLCAGDG+A
Sbjct  156  GIWKDEAIVKSMSRHGDHRELLKGPLYYASAITLACAIYWRTSPIAIAAICNLCAGDGLA  215

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVV
Sbjct  216  DLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVV  275

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL + LVES P+S+ELDDNLT+P+ S+L G+ +F
Sbjct  276  SLGSTLVESLPISSELDDNLTIPVTSLLLGTLVF  309



>emb|CDY66208.1| BnaCnng49970D [Brassica napus]
Length=302

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGL
Sbjct  88   WGEIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMA
Sbjct  148  GVYQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPIAIAVICNLCAGDGMA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR+ + KLP+N+NKS AGSI MA  GFLAS+G+M+YFSSFG +E T   M+L FLV
Sbjct  208  DIVGRRLGTEKLPYNRNKSLAGSIGMAIAGFLASVGYMYYFSSFGYMESTGWDMILRFLV  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+AL+ES P+ST++DDNLT+PL S L G+ +F
Sbjct  268  ISIASALIESLPISTDIDDNLTIPLTSALVGTLLF  302



>ref|XP_007146804.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
 gb|ESW18798.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
Length=311

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVH+S+G++FMLCWP+FS+G   A  AALIPG+NI ++++ GL
Sbjct  98   WQETAKRGIFDQKLNRKLVHLSIGLMFMLCWPLFSTGNMAAFFAALIPGVNIIRMIVTGL  157

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++KD+ TVKSMSRFGD+RELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMA
Sbjct  158  GLVKDEATVKSMSRFGDHRELLKGPLYYATTITLASIIYWRTSPISIAAICNLCAGDGMA  217

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+NK+KS+AGSIAMA+ GFLASIG+M YFSSFG +E +  +VL FL+V
Sbjct  218  DIVGRRFGGEKIPYNKDKSYAGSIAMASAGFLASIGYMWYFSSFGYIEGSWKLVLSFLLV  277

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+  A VES P+STELDDNLTVPL S+L G+ IF
Sbjct  278  SIGTAFVESLPISTELDDNLTVPLTSILLGTVIF  311



>emb|CDM84848.1| unnamed protein product [Triticum aestivum]
Length=312

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG  DQ LNRKLVH+++GMVF+L WP+FSSGR     AAL PG+NI ++LLLGL
Sbjct  99   FEELAKRGVCDQKLNRKLVHITIGMVFLLFWPLFSSGRYAPFFAALAPGINIIRMLLLGL  158

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+K++  VKSMSR GD+RELLKGPLYYA TITLA +V WR+SPIAIALVCNLCAGDG+A
Sbjct  159  GIMKNEAMVKSMSRSGDHRELLKGPLYYATTITLATSVLWRTSPIAIALVCNLCAGDGIA  218

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR+   KLP+N NKS+AGSIAMA  GFLASIG+MHYF SFG +EK+ +M LGFLVV
Sbjct  219  DVVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASIGYMHYFHSFGLMEKSWYMTLGFLVV  278

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AAALVESHP+STELDDNLTVPL S L GS I 
Sbjct  279  SVAAALVESHPISTELDDNLTVPLTSFLVGSLIL  312



>ref|XP_010520194.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=309

 Score =   288 bits (736),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W E  KRG FDQ L RKLVHVS+G VFMLCWP+FSSG +GA++A+L+PG NI + LLLGL
Sbjct  96   WGEFGKRGIFDQKLVRKLVHVSVGPVFMLCWPLFSSGLRGAVLASLVPGGNIIRTLLLGL  155

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR+GD RELLKGPLYYA+ ITL+CA YWR+SPIAIA++CNLCAGDGMA
Sbjct  156  GVYHDEGTIKSMSRYGDRRELLKGPLYYALAITLSCAFYWRTSPIAIAVICNLCAGDGMA  215

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + KLP+N+NKS AGSIAMAA GFLAS+G+M+YF+SFG +E +  M+L FL+V
Sbjct  216  DIVGRRLGTEKLPYNRNKSVAGSIAMAAAGFLASVGYMYYFASFGYIEDSGGMILRFLIV  275

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S  AALVES P+S+E+DDNLTVPL S L G+ +F
Sbjct  276  STVAALVESIPISSEIDDNLTVPLTSALVGTLVF  309



>ref|XP_011003752.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Populus euphratica]
Length=310

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            + E  KR  FDQ LNRKLVH+S+G+VFML WP+FSSG +GAL+AAL PG+NI ++LL+G 
Sbjct  97   FAETTKRHVFDQKLNRKLVHISIGLVFMLWWPIFSSGHRGALLAALTPGVNIIRMLLIGS  156

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G  KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMA
Sbjct  157  GTWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMA  216

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+NKNKS AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVV
Sbjct  217  DIVGRRFGRQKIPYNKNKSIAGSVAMALAGFVASVGFMYYFASFGYVQKSREMLLGFLVV  276

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+A VES P+STELDDNLTV L S+L G  +F
Sbjct  277  SLASAFVESLPISTELDDNLTVTLTSILLGHLVF  310



>ref|XP_004970454.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=314

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F++ L+RKLVH+S+G+VF+L WP+FSSG     +AAL PG+NI ++ LLG+
Sbjct  101  YEELAKRGVFEEKLSRKLVHISVGLVFLLFWPLFSSGTYAPFLAALAPGVNIIRMFLLGI  160

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKSMSR GDYRELLKGPLYYA TIT A +V WRSSPIAIALVCNLCAGDG+A
Sbjct  161  GLMKNEAMVKSMSRSGDYRELLKGPLYYATTITFATSVLWRSSPIAIALVCNLCAGDGIA  220

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GR +   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M LGFLVV
Sbjct  221  DVVGRHLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALGFLVV  280

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AAALVESHP+STELDDNLTVPL S L GS IF
Sbjct  281  SIAAALVESHPISTELDDNLTVPLTSFLVGSLIF  314



>ref|XP_011025082.1| PREDICTED: probable phytol kinase 3, chloroplastic [Populus euphratica]
Length=294

 Score =   285 bits (728),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKR  FDQ LNRKL+H+S+G+VFMLCWPMFSSG QGAL+AA IPGLNI ++LL+G 
Sbjct  81   FEETAKRRIFDQKLNRKLLHISIGLVFMLCWPMFSSGHQGALLAACIPGLNIIRMLLIGS  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+  VKSMSRFGD RELLKGPLYYA+TIT+ACA+YWR+SP+AIA +CNLCAGDG+A
Sbjct  141  GMWKDEAMVKSMSRFGDRRELLKGPLYYALTITVACAIYWRTSPVAIAAICNLCAGDGIA  200

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ S K+P+N+NKS AGS+AMA  GFLAS+GFMHYFS+FG ++K+  M LGFL+V
Sbjct  201  DIVGRRLGSQKIPYNRNKSIAGSVAMALAGFLASLGFMHYFSAFGYVQKSWEMTLGFLIV  260

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA++ VES P+STELDDNLTV L S+L G+ +F
Sbjct  261  SLASSFVESLPISTELDDNLTVTLTSLLLGNLVF  294



>emb|CBI15917.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   283 bits (725),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EIAKRG+FDQ + RKLVH+S+G+VFML WP+FSSGRQGA++AALIPG+NI ++LLLGL
Sbjct  28   WGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPLFSSGRQGAVLAALIPGVNIIRMLLLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+  VKSMSR GD+RELLKGPLYYA  ITLACA+YWR+SPIAIA +CNLCAGDG+A
Sbjct  88   GIWKDEAIVKSMSRHGDHRELLKGPLYYASAITLACAIYWRTSPIAIAAICNLCAGDGLA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVV
Sbjct  148  DLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL + LVES P+S+ELDDNLT+P+ S+L
Sbjct  208  SLGSTLVESLPISSELDDNLTIPVTSLL  235



>ref|XP_010028020.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=244

 Score =   283 bits (723),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS+G+VFMLCWP+FSS  +GAL+AA IPG NI ++LL+G 
Sbjct  31   FEETAKRGLFDQKLNRKLVHVSVGLVFMLCWPLFSSEHRGALLAATIPGFNIIRMLLVGS  90

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSRFGD RELL+GPLYY + IT ACA YWR+SP+AIA +CNLCAGDG A
Sbjct  91   GIWKDEATVKSMSRFGDRRELLEGPLYYVLMITFACAYYWRTSPVAIAAICNLCAGDGFA  150

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGR+    K+P+N NKS AGSIAM + GFLAS+GF+ YFSSFG ++ +  MV GFL+V
Sbjct  151  DIIGRQFGQHKIPYNPNKSVAGSIAMTSAGFLASLGFLSYFSSFGYIQGSWEMVGGFLMV  210

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S A+ALVESHPLS+++DDNLTVPLA  L GS +F
Sbjct  211  SFASALVESHPLSSQIDDNLTVPLACALVGSLVF  244



>ref|XP_008457339.1| PREDICTED: probable phytol kinase 2, chloroplastic [Cucumis melo]
Length=322

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 179/214 (84%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA+ A+LIPG N+ ++L+LG 
Sbjct  110  WVETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAIFASLIPGANVIRMLVLGF  168

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ T+KSMSR+GDYRELLKGPLYY  TITL C  YWR+SPI+IAL+CNLCAGDG A
Sbjct  169  GILKDEATLKSMSRYGDYRELLKGPLYYVATITLVCIFYWRTSPISIALICNLCAGDGFA  228

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S K+ +N+NKS AGS+AMA  GFLASIG+M+YFSSFG +E +  M L FL+V
Sbjct  229  DIVGRRFGSEKIFYNENKSLAGSVAMATAGFLASIGYMYYFSSFGYVEASIGMALRFLIV  288

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTVPL S+L GS +F
Sbjct  289  SLASALVESLPISTELDDNLTVPLTSLLVGSLVF  322



>gb|AFK48670.1| unknown [Lotus japonicus]
Length=315

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A RG FDQ LNRKLVHVS+G+ F+ CWP++S  +  +L AALIPG+NI ++L +GL
Sbjct  102  WEETATRGLFDQKLNRKLVHVSIGLAFIFCWPLYSDDKWASLFAALIPGVNILRMLFIGL  161

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+GTVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPIAIA +CNLCAGDGMA
Sbjct  162  GILKDEGTVKSMSRFGDYRELLKGPLYYAATITLAAVLYWRTSPIAIAAICNLCAGDGMA  221

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    K+P+N+NKS+AGS+AMA+ GFLAS+G+M YFSSFG +E +  + L FL+V
Sbjct  222  DIVGRRFGGKKIPYNRNKSYAGSVAMASAGFLASVGYMWYFSSFGFMEGSWELALRFLIV  281

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+  A+VES P+STELDDNLTVPL S+L GS +F
Sbjct  282  SVVTAVVESLPISTELDDNLTVPLTSILVGSIVF  315



>gb|KHG27084.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=240

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+  AK G  DQ LNRKLVH+S+G+VFMLCWP+FS+G +GA++AA+ PG+NI ++LL+G 
Sbjct  28   WQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPLFSAGYRGAILAAITPGVNIIRMLLIGS  86

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+A
Sbjct  87   GIWKDEATVKSMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLA  146

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR+   KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG +++   M+L FLVV
Sbjct  147  DVVGRRLGRKKLPYNRNKSVAGSVAMATAGFLSSVGYMYYFSYFGYIQEGWGMILRFLVV  206

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S+  GS IF
Sbjct  207  SLASALVESLPISTELDDNLTVSLTSIFIGSLIF  240



>ref|XP_002299996.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
 gb|EEE84801.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
Length=241

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKR  FDQ LNRKL+H+S+G+VFMLCWPMFSSG +GAL+AA IPGLNI ++LL+G 
Sbjct  28   FEETAKRHIFDQKLNRKLMHISIGLVFMLCWPMFSSGLRGALLAACIPGLNIIRMLLIGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSRFGD RELLKGPLYYA+TIT+ACA+YWR+SP+AIA +CNLCAGDG+A
Sbjct  88   GMWKDEATVKSMSRFGDRRELLKGPLYYALTITVACAIYWRTSPVAIAAICNLCAGDGIA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ S K+P+N+NKS AGS+AMA  GFLAS+GFM YFS+FG ++K+  M+LGFL+V
Sbjct  148  DIVGRRLGSQKIPYNRNKSIAGSVAMALAGFLASLGFMVYFSAFGYVQKSWEMILGFLIV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA++ VES P+STELDDNLTV L S+L G+ +F
Sbjct  208  SLASSFVESLPISTELDDNLTVTLTSLLLGNLVF  241



>gb|KJB20420.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=240

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+  AK G  DQ LNRKLVH+S+G+VFMLCWP+FS+G +GA++AA+ PG+NI ++LL+G 
Sbjct  28   WQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPLFSAGYRGAILAAITPGVNIIRMLLIGS  86

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+A
Sbjct  87   GIWKDEATVKSMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLA  146

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR+   KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG ++    M+L FLVV
Sbjct  147  DVVGRRLGRKKLPYNRNKSIAGSVAMATAGFLSSVGYMYYFSYFGYIQDGWGMILRFLVV  206

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STELDDNLTV L S+  GS IF
Sbjct  207  SLASALVESLPISTELDDNLTVSLTSIFIGSLIF  240



>gb|AAM65097.1| unknown [Arabidopsis thaliana]
Length=307

 Score =   283 bits (724),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L FLV+
Sbjct  214  DIVGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSGGMILRFLVI  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  274  SIASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>ref|XP_008356261.1| PREDICTED: probable phytol kinase 3, chloroplastic [Malus domestica]
Length=266

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  735  NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSM  556
             LNRKLVHVS+G+VFMLCWP+FSSG +GA +A L PGLNIF++LLLGLGI KD+ TVKSM
Sbjct  65   KLNRKLVHVSIGLVFMLCWPLFSSGLRGAFLACLTPGLNIFRMLLLGLGIWKDEATVKSM  124

Query  555  SRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKL  376
            SR+GDYRELLKGPLYYA TITLAC +YWR+SPIAIAL+CNLCAGDG+ADI+GRR  + K+
Sbjct  125  SRYGDYRELLKGPLYYATTITLACLIYWRTSPIAIALICNLCAGDGLADIVGRRFGTXKI  184

Query  375  PHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPL  196
            P+N++KS AGS+AMA+ GFL SIG+MHYFSSFG ++++  MVLGFLVVSLA+ALVES P+
Sbjct  185  PYNRSKSIAGSVAMASAGFLTSIGYMHYFSSFGFVQESWGMVLGFLVVSLASALVESLPI  244

Query  195  STELDDNLTVPLASVLAGSCIF  130
            STELDDNLTV L SVL GS +F
Sbjct  245  STELDDNLTVSLTSVLVGSLVF  266



>gb|KHN02090.1| Putative phytol kinase 3, chloroplastic [Glycine soja]
Length=322

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E AKR  FDQ LNRKLVH+S+G++FMLCWP+FS+    +  AALIPG+NIF++L++GL
Sbjct  109  FQETAKRDLFDQKLNRKLVHISIGLIFMLCWPLFSTETWASFFAALIPGINIFRMLVIGL  168

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMA
Sbjct  169  GILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMA  228

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  +VLGFL+V
Sbjct  229  DIVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLVLGFLLV  288

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            S+  A VES P+STELDDNLTVPL S+L GS I
Sbjct  289  SIVTAFVESLPISTELDDNLTVPLTSILVGSII  321



>ref|NP_001130181.1| uncharacterized protein LOC100191275 [Zea mays]
 ref|XP_008657098.1| PREDICTED: probable phytol kinase 2, chloroplastic [Zea mays]
 gb|ACF78326.1| unknown [Zea mays]
 gb|ACF84542.1| unknown [Zea mays]
Length=312

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F+Q L+RKLVH+S+G+VFML WP+FSSG     +AAL PG+NI ++LLLGL
Sbjct  99   FEELAKRGVFEQKLSRKLVHISVGLVFMLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGL  158

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKSMSR GDYRELLKGPLYYA TIT A ++ WR+SP+AIAL+CNLCAGDG+A
Sbjct  159  GLMKNEAMVKSMSRSGDYRELLKGPLYYAATITFATSLLWRTSPVAIALICNLCAGDGIA  218

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M L FLVV
Sbjct  219  DVVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALSFLVV  278

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AAALVESHP+STELDDNLTVPL S L GS IF
Sbjct  279  SVAAALVESHPISTELDDNLTVPLTSFLVGSLIF  312



>ref|NP_001044703.2| Os01g0832000 [Oryza sativa Japonica Group]
 dbj|BAD81857.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC71742.1| hypothetical protein OsI_04308 [Oryza sativa Indica Group]
 gb|EEE55624.1| hypothetical protein OsJ_03964 [Oryza sativa Japonica Group]
 dbj|BAF06617.2| Os01g0832000 [Oryza sativa Japonica Group]
Length=246

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     +AA+ PG+NI ++LLLGL
Sbjct  33   FEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPFLAAVAPGINIIRMLLLGL  92

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKSMSR GD RELLKGPLYYA TIT A +++WR+SPIAIAL+CNLCAGDG+A
Sbjct  93   GVMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSIFWRTSPIAIALICNLCAGDGIA  152

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   KLP+N NKS+AGSIAMA  GF+ASIG+MHYF SFG +E++  +  GFLVV
Sbjct  153  DIVGRRLGQEKLPYNPNKSYAGSIAMALAGFMASIGYMHYFQSFGFIEESWSLAFGFLVV  212

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  213  SVTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  246



>ref|XP_002458716.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
 gb|EES03836.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
Length=341

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EEIAKRG F+Q L+RKLVH+S+G+VF+L WP+FSSG     +AAL PG+N+ ++LLLGL
Sbjct  128  FEEIAKRGVFEQKLSRKLVHISVGLVFLLFWPLFSSGWYAPFLAALAPGVNVIRMLLLGL  187

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKS+SR GDYRELLKGPLYYA TIT A +V WR+SP+AIAL+CNLCAGDG+A
Sbjct  188  GLMKNEAMVKSISRSGDYRELLKGPLYYATTITFATSVLWRTSPVAIALICNLCAGDGIA  247

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M LGFLVV
Sbjct  248  DVVGRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALGFLVV  307

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AA LVESHP+STELDDNLTVPL S L GS IF
Sbjct  308  SVAATLVESHPISTELDDNLTVPLTSFLVGSLIF  341



>dbj|BAD43853.1| unknown protein [Arabidopsis thaliana]
Length=307

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACVYYWKSSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV+
Sbjct  214  DIVGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVI  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  274  SIASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>ref|XP_004145246.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004153718.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172407.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65833.1| hypothetical protein Csa_1G533400 [Cucumis sativus]
Length=322

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W E AKRG  DQ LNRKLVH+S+G+ FMLCWPMFSSG QGA++A+LIPG N+ ++LLLG 
Sbjct  110  WAETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFSSGYQGAILASLIPGANVMRMLLLGF  168

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ T+KSMSR+GDYRELLKGPLYY  TIT  C  YWR+SPI+IAL+CNLCAGDG+A
Sbjct  169  GILKDEATLKSMSRYGDYRELLKGPLYYVATITFVCIFYWRTSPISIALICNLCAGDGLA  228

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S K+ +NKNKS AGS+AMA  GFLASIG+M+YFS FG +E +  M + FL+V
Sbjct  229  DIVGRRFGSEKIFYNKNKSLAGSVAMATAGFLASIGYMYYFSLFGYVEASVGMAMRFLIV  288

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STE+DDNLTVPL S L GS +F
Sbjct  289  SLASALVESLPISTEIDDNLTVPLTSFLVGSLVF  322



>ref|NP_200664.1| farnesol kinase [Arabidopsis thaliana]
 sp|Q67ZM7.2|PHYK2_ARATH RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD43980.1| unknown protein [Arabidopsis thaliana]
 gb|AED97069.1| farnesol kinase [Arabidopsis thaliana]
Length=307

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV+
Sbjct  214  DIVGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVI  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S LAG  +F
Sbjct  274  SIASALVESLPISTDIDDNLTISLTSALAGFLLF  307



>gb|ACU24460.1| unknown [Glycine max]
Length=318

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E AKR  FDQ LNRKLVH+S+G++FMLCWP+FS+    +  AALIPG+NIF++L++GL
Sbjct  105  FQETAKRDLFDQKLNRKLVHISIGLIFMLCWPLFSTETWASFFAALIPGINIFRMLVIGL  164

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMA
Sbjct  165  GILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMA  224

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  + LGFL+V
Sbjct  225  DIVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLALGFLLV  284

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            S+  A VES P+STELDDNLTVPL S+L GS I
Sbjct  285  SIVTAFVESLPISTELDDNLTVPLTSILVGSII  317



>ref|XP_009120370.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=302

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGL
Sbjct  88   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPI+IA++CNLCAGDGMA
Sbjct  148  GVYQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPISIAVICNLCAGDGMA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR  + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E     M+L FL+
Sbjct  208  DIVGRRFGTEKLPYNRNKSLAGSIGMAIAGFLASVGYMYYFASFGYMESIGWDMILRFLI  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST++DDNLT+PL S L G+ +F
Sbjct  268  ISVASALVESLPISTDIDDNLTIPLTSALVGTLLF  302



>ref|XP_003564535.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=310

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSGR    +AAL PG+NI ++LLLGL
Sbjct  97   FEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGRYAPFLAALAPGINIVRMLLLGL  156

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+K++  VKSMSR GD+RELLKGPLYYA TIT A +V WR+SPIAIAL+CNLCAGDG+A
Sbjct  157  GIMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSVLWRTSPIAIALICNLCAGDGIA  216

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   KLP+N NKS+AGSIAMA  GFLASIG+MHY  +FG +E++ +M  GFLVV
Sbjct  217  DIVGRRLGKDKLPYNPNKSYAGSIAMAVAGFLASIGYMHYLHTFGFIEESWNMAFGFLVV  276

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+AA LVESHP+STELDDNLTVPL S L GS + 
Sbjct  277  SVAATLVESHPISTELDDNLTVPLTSFLVGSLLL  310



>emb|CDY67806.1| BnaA10g29300D [Brassica napus]
Length=303

 Score =   280 bits (716),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSGRQGAL+A+L+PGLNI ++LLLGL
Sbjct  89   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGRQGALLASLVPGLNIVRMLLLGL  148

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPI+IA++CNLCAGDGMA
Sbjct  149  GVYQDEGTIKSMSRHGDRRELLKGPLYYALSITSACFFYWKTSPISIAVICNLCAGDGMA  208

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR  + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E     M+L FL+
Sbjct  209  DIVGRRFGTEKLPYNRNKSVAGSIGMAIAGFLASVGYMYYFASFGYMEGIGWDMILRFLI  268

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST++DDNLT+PL S L G+ +F
Sbjct  269  ISVASALVESLPISTDIDDNLTIPLTSALVGTLLF  303



>ref|XP_010264775.1| PREDICTED: probable phytol kinase 2, chloroplastic, partial [Nelumbo 
nucifera]
Length=271

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EIAKRG  ++ +NRKLVH+S+G+VF+L WP+FSSG QGA +AAL+PG+NI ++LL+GL
Sbjct  58   WGEIAKRGLLEKTMNRKLVHISIGLVFLLFWPLFSSGPQGAYLAALVPGVNIIRMLLIGL  117

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR GDYRELLKGPLYYA TITLA  VYWRSSPIAIA +CNLCAGDG+A
Sbjct  118  GIWKDEATVKSMSRSGDYRELLKGPLYYASTITLASVVYWRSSPIAIAAICNLCAGDGVA  177

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+N++KSFAGSIAMA+ GF+ SIG+MHYFS FG L+++  M  GFL+V
Sbjct  178  DIVGRRFGRQKLPYNRDKSFAGSIAMASAGFITSIGYMHYFSLFGLLQESWGMTFGFLIV  237

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S    +VES P+S+ELDDNLTVPL S+L GS +F
Sbjct  238  SSLTXIVESLPISSELDDNLTVPLTSLLVGSLVF  271



>ref|XP_006644954.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=248

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F+Q LNRKLVH+++G+VF+L WP+FS G     +AA+ PG+NI ++LLLGL
Sbjct  35   FEELAKRGVFEQKLNRKLVHITIGLVFLLFWPLFSPGSYAPFLAAVAPGINIIRMLLLGL  94

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKSMSR GD+RELLKGPLYYA TIT A +V+WR+SPIAIAL+CNLCAGDG+A
Sbjct  95   GVMKNEAMVKSMSRSGDHRELLKGPLYYATTITFATSVFWRTSPIAIALICNLCAGDGIA  154

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   KLP+N NKS+AGSIAM   GFLASIG+MHYF +FG +E++  +  GFLVV
Sbjct  155  DIVGRRLGQEKLPYNPNKSYAGSIAMVLAGFLASIGYMHYFQTFGFIEESWSLAFGFLVV  214

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  215  SVTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  248



>ref|XP_006425114.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38354.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=290

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  77   WEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  136

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG A
Sbjct  137  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFA  196

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVV
Sbjct  197  DVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVV  256

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  257  SLASALVESLPISTKLDDNLTITITSMAVGSLVF  290



>sp|Q5N9J9.3|PHYK2_ORYSJ RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=304

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE+AKRG F+Q LNRKLVH+++GMVF+L WP+FSSG     +AA+ PG+NI ++LLLGL
Sbjct  91   FEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFSSGSYAPFLAAVAPGINIIRMLLLGL  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  VKSMSR GD RELLKGPLYYA TIT A +++WR+SPIAIAL+CNLCAGDG+A
Sbjct  151  GVMKNEAMVKSMSRSGDPRELLKGPLYYATTITFATSIFWRTSPIAIALICNLCAGDGIA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   KLP+N NKS+AGSIAMA  GF+ASIG+MHYF SFG +E++  +  GFLVV
Sbjct  211  DIVGRRLGQEKLPYNPNKSYAGSIAMALAGFMASIGYMHYFQSFGFIEESWSLAFGFLVV  270

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ AALVESHP+ST LDDNLTVPL S L GS +F
Sbjct  271  SVTAALVESHPISTHLDDNLTVPLTSFLVGSLVF  304



>gb|KDO66965.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=290

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  77   WEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  136

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG A
Sbjct  137  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFA  196

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVV
Sbjct  197  DVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVV  256

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  257  SLASALVESLPISTKLDDNLTLTITSIAVGSLVF  290



>ref|XP_009603395.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic, 
partial [Nicotiana tomentosiformis]
Length=218

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -2

Query  723  KLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFG  544
            +LVH+S+G VFM CWPMFSSGRQGA++AALI GLNI K+LLLGLG+ KDD TVKSMSRFG
Sbjct  20   QLVHISIGPVFMPCWPMFSSGRQGAILAALISGLNIIKMLLLGLGLWKDDATVKSMSRFG  79

Query  543  DYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNK  364
            D+RELLKGPLYYA TITLACAVYWR SPIAI L+CNL AGDG+ADI+GRR     LP+NK
Sbjct  80   DHRELLKGPLYYAFTITLACAVYWRYSPIAIGLICNLYAGDGIADIVGRRFGKQXLPYNK  139

Query  363  NKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAA-LVESHPLSTE  187
            NKSFAGSIAMAA GFLASIG++H+FS FG ++++ H V GFL VSLAAA LVESHP+STE
Sbjct  140  NKSFAGSIAMAAAGFLASIGYLHHFSLFGYIQESSHTVFGFLFVSLAAALLVESHPISTE  199

Query  186  LDDNLTVPLASVLAGSCIF  130
            LDDNLTVPL SVL GS + 
Sbjct  200  LDDNLTVPLTSVLVGSLVL  218



>ref|XP_010089521.1| putative phytol kinase 3 [Morus notabilis]
 gb|EXB37960.1| putative phytol kinase 3 [Morus notabilis]
Length=454

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W E AKRG FDQ LNRKLVH+S+G+VFMLCWP+FS G +GA +AA +PG+NI ++LLLGL
Sbjct  112  WGETAKRGLFDQKLNRKLVHISVGLVFMLCWPLFSPGSRGAFLAASVPGVNIIRMLLLGL  171

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSRFGDYRELLKGPLYYA TITLAC +YWR+S I+IA +CNLCAGDG A
Sbjct  172  GIWKDEATVKSMSRFGDYRELLKGPLYYATTITLACIIYWRTSLISIAAICNLCAGDGSA  231

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGRR  + KLP+N++KS AGSIAMA+ GFLAS+G+M+YFSSFG +E +   VLGF +V
Sbjct  232  DIIGRRFGNRKLPYNRSKSIAGSIAMASGGFLASVGYMYYFSSFGFVEVSWEKVLGFFIV  291

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SLA  LVES P+STELDDNLTVP++S+L
Sbjct  292  SLATTLVESLPISTELDDNLTVPVSSIL  319



>ref|XP_006488562.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Citrus 
sinensis]
Length=293

 Score =   278 bits (710),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  80   WEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  139

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG A
Sbjct  140  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFA  199

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVV
Sbjct  200  DVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVV  259

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  260  SLASALVESLPISTKLDDNLTLTITSIAVGSLVF  293



>ref|NP_001242263.1| probable phytol kinase 3, chloroplastic [Glycine max]
 sp|Q2N2K0.1|PHYK3_SOYBN RecName: Full=Probable phytol kinase 3, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42677.1| phytol kinase [Glycine max]
Length=319

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E AKR  FDQ LNRKLVH+S+G++FMLC P+FS+    +  AALIPG+NIF++L++GL
Sbjct  106  FQETAKRDLFDQKLNRKLVHISIGLIFMLCXPLFSTETWASFFAALIPGINIFRMLVIGL  165

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILKD+ TVKSMSRFGDYRELLKGPLYYA TITLA  +YWR+SPI+IA +CNLCAGDGMA
Sbjct  166  GILKDEATVKSMSRFGDYRELLKGPLYYAATITLAAIIYWRTSPISIAAICNLCAGDGMA  225

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   K+P+NKNKSFAGSIAMA  GFL SIG+M YFSSFG +E +  +VLGFL+V
Sbjct  226  DIVGRRLGGEKIPYNKNKSFAGSIAMATAGFLTSIGYMWYFSSFGFIEGSWKLVLGFLLV  285

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            S+  A VES P+STELDDNLTVPL S+L GS I
Sbjct  286  SIVTAFVESLPISTELDDNLTVPLTSILVGSII  318



>ref|XP_004500292.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKR  FDQ LNRKLVH+++G++F+ CWP+FS+ + G+  AA IP +N+ +LL++GL
Sbjct  90   WQETAKRRLFDQKLNRKLVHITIGLLFIFCWPLFSTDKWGSYFAAFIPAVNVLRLLVIGL  149

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD  VKSMSRFGD+RELLKGPLYYA T+T A  +YWR+SPI+IA +CN+CAGDGMA
Sbjct  150  GIWKDDAEVKSMSRFGDHRELLKGPLYYAATLTFASIIYWRTSPISIAAICNMCAGDGMA  209

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S K+ +NKNKS+AGSIAMA+ GFLASIGFM YFSSFG +E +   V+GFLVV
Sbjct  210  DIVGRRFGSKKISYNKNKSYAGSIAMASSGFLASIGFMWYFSSFGYMEGSWKHVIGFLVV  269

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            S+ A +VES P+ST+LDDNLTVPL S+L GS +
Sbjct  270  SIVATVVESLPISTDLDDNLTVPLTSILVGSLV  302



>ref|XP_004500293.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKR  FDQ LNRKLVH+++G++F+LCWP+FS+ + G+  AA IP +N+ ++L++GL
Sbjct  90   WQETAKRRLFDQKLNRKLVHITIGLLFILCWPLFSTDKWGSYFAAFIPAVNVLRMLVIGL  149

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KDD TVKSMSRFGD+RELLKGPLYYA TIT A  +YWR+SPI+IA +CN+CAGDGMA
Sbjct  150  GIWKDDATVKSMSRFGDHRELLKGPLYYAATITFASIIYWRTSPISIAAICNMCAGDGMA  209

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  S K+ +NKNKS+AGSIAMA+ GFLASIG M YFSSFG +E +   V+GFLVV
Sbjct  210  DIVGRRFGSKKISYNKNKSYAGSIAMASSGFLASIGCMWYFSSFGYMEGSWKHVIGFLVV  269

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCI  133
            S+   +VES P+ST+LDDNLTVPL S+L GS +
Sbjct  270  SIVTTVVESLPISTDLDDNLTVPLTSILVGSLV  302



>ref|XP_002278563.2| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Vitis vinifera]
Length=241

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W  IAKRG+  Q ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGL
Sbjct  28   WGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+  VKSMSR+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+A
Sbjct  88   GIWKDEAVVKSMSRYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVV
Sbjct  148  DLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SL + LVES P+S E+DDNLT+P+ S+L G+ +F
Sbjct  208  SLGSTLVESLPISNEIDDNLTIPVTSLLLGTLVF  241



>ref|XP_010443595.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=303

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  90   WGEIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGL  149

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMA
Sbjct  150  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMA  209

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG ++ +  M+L F V+
Sbjct  210  DIVGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIKDSVGMILRFAVI  269

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  270  SIASALVESLPISTDIDDNLTISLTSALVGVLLF  303



>ref|XP_010503534.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=242

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllg  595
            W EI KRG  FDQ L RK VH+++G+VF+LCWP+FSSG QGAL A+++ GLNI ++LLLG
Sbjct  28   WGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWPLFSSGIQGALFASIVTGLNIIRMLLLG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG+  D+GT+KSMSR GD RELLKGPLYYA++ITLAC V+W++SPI+IA++CNLCAGDGM
Sbjct  88   LGVYHDEGTIKSMSRHGDRRELLKGPLYYALSITLACIVFWKTSPISIAVICNLCAGDGM  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI+GRR+ + +LP+N+NKSFAGSI M   GFLAS+G+M+YF+SFG +E +  M+L F V
Sbjct  148  ADIVGRRLGTVRLPYNRNKSFAGSIGMVTAGFLASVGYMYYFASFGYIEVSVGMILRFAV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  208  ISIASALVESLPISTQIDDNLTISLTSALVGILLF  242



>ref|XP_010520844.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=268

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W E+ KRG  DQ L RKLVH+++G+VFMLCWP+FS G QGA++A+L+PG+NI ++LLLGL
Sbjct  55   WGEVGKRGILDQTLIRKLVHINIGLVFMLCWPLFSPGLQGAVLASLVPGVNIIRMLLLGL  114

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA +ITLAC  YWR+SPIAIA++CNLCAGDGMA
Sbjct  115  GVYHDEGTIKSMSRHGDRRELLKGPLYYASSITLACVFYWRTSPIAIAVICNLCAGDGMA  174

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + KLP+N++KS AGSIAMA  GF AS+ +M YF+SFG +E++  M+L FLVV
Sbjct  175  DIVGRRLGTEKLPYNRSKSIAGSIAMATSGFTASVVYMRYFASFGYMEESWGMILRFLVV  234

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+A+VES P+ST++DDNLTV L SVL G+ IF
Sbjct  235  SIASAVVESLPISTDIDDNLTVSLTSVLLGTFIF  268



>ref|XP_010453909.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=307

 Score =   275 bits (703),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG+FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRVLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG ++ +  M+L F V+
Sbjct  214  DIVGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIKDSVGMILRFAVI  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  274  SIASALVESLPISTDIDDNLTISLTSALVGVLLF  307



>ref|XP_006401067.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
 gb|ESQ42520.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
Length=308

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 181/215 (84%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGLQGALFASLVPGLNIIRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMA
Sbjct  154  GVYKDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKTSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLV  235
            DI+GRR+ + KLP+N+NKS AGSI MA  GFLAS+G+M+YF+SFG +E +   M+L F +
Sbjct  214  DIVGRRLGTEKLPYNRNKSVAGSIGMAIAGFLASVGYMYYFASFGYIENSGGAMILRFFI  273

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ +VES P+ST++DDNLT+ L S L G+ +F
Sbjct  274  ISIASTIVESLPISTDIDDNLTISLTSALVGTILF  308



>ref|XP_010483456.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=304

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KR +FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  91   WGEIGKRRFFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGL  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP+AIA++CNLCAGDGMA
Sbjct  151  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPVAIAVICNLCAGDGMA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L F V+
Sbjct  211  DIVGRRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSVGMILRFAVI  270

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  271  SIASALVESLPISTDIDDNLTISLTSALVGVLLF  304



>ref|XP_010689412.1| PREDICTED: probable phytol kinase 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WE  AK G FD  LNRKLVH S+G+VFMLCWP+FSSG +GAL+A+LIPG+NI ++LL+G 
Sbjct  95   WEVTAKYGVFDSKLNRKLVHTSIGIVFMLCWPLFSSGYRGALLASLIPGVNIIRMLLIGS  154

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+GDYRELLKGPLYY ++IT AC V+WR+SPI IA + NLCAGDG+A
Sbjct  155  GIYKDEATVKSMSRYGDYRELLKGPLYYVLSITFACIVFWRTSPIGIAAISNLCAGDGLA  214

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+   KLP+NK KS+AG+I+MA  GF+AS+ +MHYFS FG ++++  +VL FL V
Sbjct  215  DIVGRRLGKHKLPYNKTKSYAGTISMATAGFVASVAYMHYFSLFGFMQQSWDLVLRFLFV  274

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+ ++LVES P+ST+LDDNLTVPLAS L G  +F
Sbjct  275  SIISSLVESLPISTQLDDNLTVPLASFLVGGLVF  308



>ref|XP_006847435.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
 gb|ERN09016.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
Length=241

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E+AKRG FDQ LNRKLVH+S+G+VFML WP+FSSG + A +AAL PG+NI +++LLGL
Sbjct  28   WDEMAKRGVFDQKLNRKLVHISVGLVFMLFWPLFSSGHEAAYLAALAPGINIIRMILLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI+K++  VKSMSR+GD+RELLKGPLYYA TITLA AV+WR+SPIA+A +CNLC+GDG A
Sbjct  88   GIMKNENMVKSMSRYGDHRELLKGPLYYACTITLATAVFWRTSPIAVAAICNLCSGDGFA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+N NKSF GSI MA  GF+ASIG+M+YFS FG    +  +V GF +V
Sbjct  148  DIVGRRFGTLKLPYNMNKSFMGSITMAVAGFMASIGYMYYFSLFGFYNASWDLVTGFFLV  207

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAA++VES P+ST+LDDNLTVPL S++ G  IF
Sbjct  208  SLAASIVESLPISTKLDDNLTVPLTSLIVGWLIF  241



>ref|XP_006280848.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
 gb|EOA13746.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
Length=307

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++IT+AC   W++SP AIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITVACIFCWKTSPTAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + KLP+N+NKSFAGSI MA  GF+AS+G+M+YF+SFG +E +  M+L F ++
Sbjct  214  DIMGRRLGTEKLPYNRNKSFAGSIGMATAGFIASVGYMYYFASFGYIEDSGGMILRFAII  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLT+ L S L G  +F
Sbjct  274  SIASALVESLPISTDIDDNLTISLTSALVGILLF  307



>ref|XP_009132278.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic 
[Brassica rapa]
Length=269

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 177/215 (82%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGL
Sbjct  55   WGEIGKRGIFDQKLIRKLVHINIGLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGL  114

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGPLYYAI +TLAC  YW++SPIAIA+VCNLCAGDGMA
Sbjct  115  GVYQDEGTIKSMSRHGDRRELLKGPLYYAIAVTLACIFYWKTSPIAIAVVCNLCAGDGMA  174

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR+ + KLP+N+NK+ AGSI MA  GFLAS+ +M+YF+SFG ++ +   M+  F +
Sbjct  175  DIVGRRLGTKKLPYNRNKTIAGSIGMAIAGFLASVAYMYYFASFGYIKNSGWDMMPRFFI  234

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST +DDNLTV L S L G+ +F
Sbjct  235  ISIASALVESLPISTAIDDNLTVSLTSALLGTLLF  269



>gb|KEH28892.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
             E +KRG FDQ L+RKLVH+S G++FMLCWP+FS+ R  +  AAL PG+ + ++L+  LG
Sbjct  27   RETSKRGLFDQKLHRKLVHISFGLLFMLCWPLFSNDRWASCYAALAPGVYMCRILVTKLG  86

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+  VKS+SR GDYR+LL+G LYY  TI  A  +YWR+SP++IA +CNLCAGDGMAD
Sbjct  87   IYKDEAIVKSLSRIGDYRQLLRGSLYYVATIVFASIIYWRTSPVSIAAICNLCAGDGMAD  146

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKS+AGSIAMA+ GFLASIG+M YFS FG +E+    V+GFLVVS
Sbjct  147  IVGRRFGGKKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSLFGYMEEGWSKVIGFLVVS  206

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +  A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  207  VITAVVESHPISTDLDDNLTVPLTSILVGSMVF  239



>ref|XP_009420002.1| PREDICTED: probable phytol kinase 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 175/214 (82%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE+AKRG F+Q LNRKLVH+S+G+VF+L WP+FSSG Q  L+AAL PG+NI ++LLLG 
Sbjct  85   WEELAKRGVFEQKLNRKLVHISIGLVFLLFWPLFSSGSQAPLLAALAPGINIIRMLLLGS  144

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI K+D  VKS+SR GDYRELLKGPLYYA TIT A  ++WR+SPIAIA +CNLCAGDGMA
Sbjct  145  GIWKNDAMVKSISRHGDYRELLKGPLYYACTITFATWLFWRTSPIAIAAICNLCAGDGMA  204

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KL +N NKSFAGS+ M   GFLAS+G+MHY+ +FG +E++  M++ F VV
Sbjct  205  DIVGRRFGRKKLFYNHNKSFAGSVTMTLAGFLASVGYMHYYHTFGFIEESWGMIIRFFVV  264

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+STE+DDNLTVP+ S+L G  +F
Sbjct  265  SLASALVESLPISTEVDDNLTVPVTSLLVGGLVF  298



>ref|XP_009132038.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=309

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VF+LCWP+FSSG QGAL A+LIPGLNI ++LLLGL
Sbjct  95   WGEIGKRGIFDQKLIRKLVHINIGLVFILCWPLFSSGLQGALFASLIPGLNIIRMLLLGL  154

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGP YYA++IT AC  YW++SPIAIA+VCNLCAGDGMA
Sbjct  155  GVYQDEGTIKSMSRHGDRRELLKGPFYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMA  214

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR+ + KLP+N+NKS AGS+ MA  GFLAS+ +M+YF+SFG ++ +   M+L F +
Sbjct  215  DIVGRRLGTKKLPYNRNKSVAGSVGMAISGFLASVAYMYYFASFGYIKNSGWDMILRFFI  274

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  275  ISIASALVESLPISTDIDDNLTVSLTSALVGTLLF  309



>emb|CBI15916.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W  IAKRG+  Q ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGL
Sbjct  80   WGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGL  139

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+  VKSMSR+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+A
Sbjct  140  GIWKDEAVVKSMSRYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLA  199

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            D++GRR    K+P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVV
Sbjct  200  DLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVV  259

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL + LVES P+S E+DDNLT+P+ S+L
Sbjct  260  SLGSTLVESLPISNEIDDNLTIPVTSLL  287



>emb|CDY70799.1| BnaAnng35070D [Brassica napus]
Length=309

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VF+LCWP+FSSG QGA  A+LIPGLNI ++LLLGL
Sbjct  95   WGEIGKRGIFDQKLIRKLVHINIGLVFILCWPLFSSGLQGAFFASLIPGLNIIRMLLLGL  154

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ +D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW++SPIAIA+VCNLCAGDGMA
Sbjct  155  GVYQDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMA  214

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLV  235
            DI+GRR+ + KLP+N+NK+ AGSI MA  GFLAS+ +M YF+SFG +E +   M+L F +
Sbjct  215  DIVGRRLGTKKLPYNRNKTIAGSIGMAISGFLASVAYMFYFASFGYIESSGWGMILRFFI  274

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  275  ISVASALVESLPISTDIDDNLTVSLTSALVGTLLF  309



>gb|KFK27385.1| hypothetical protein AALP_AA8G375800 [Arabis alpina]
Length=308

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 177/215 (82%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLG 
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGLQGALFASLVPGLNIIRMLLLGF  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELL GPLYYA++IT AC  YW++SPIAIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLTGPLYYALSITSACIFYWKTSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLV  235
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG ++ +   M+L F +
Sbjct  214  DIVGRRFGTEKLPYNKNKSFAGSIGMAIAGFLASVLYMYYFASFGYIKDSGADMILRFFI  273

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+ +ALVES P+ST++DDNLT+ L S L G+ +F
Sbjct  274  ISIISALVESLPISTDIDDNLTISLTSALVGTLLF  308



>gb|KCW54677.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=227

 Score =   265 bits (676),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 169/214 (79%), Gaps = 14/214 (7%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG 
Sbjct  28   FEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG A
Sbjct  88   GIWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAICNLCAGDGFA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGRR+   K+P+N+NKS AGSIAM   GFLAS+G+               M  GFLVV
Sbjct  148  DIIGRRLGQHKIPYNRNKSLAGSIAMGCAGFLASLGW--------------EMASGFLVV  193

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVESHPLS+ LDDNLTVPL   L GS +F
Sbjct  194  SLASALVESHPLSSRLDDNLTVPLTCALVGSLVF  227



>gb|KEH28894.1| phytol kinase [Medicago truncatula]
Length=239

 Score =   265 bits (677),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +E AKRG  D  L RKLVH S G+ FMLCWP+FS+ R  +  A L+PG+ +F++L+  LG
Sbjct  27   QETAKRGLIDHKLQRKLVHTSFGLAFMLCWPLFSNDRWASFFAVLVPGVYMFRILVTELG  86

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I KD+  VKS+SRFGDYR LL G LYYA TIT A  +YWR+SP++IA +CNLCAGDGMAD
Sbjct  87   IYKDEAIVKSLSRFGDYRVLLMGSLYYAATITFASIIYWRTSPVSIAAICNLCAGDGMAD  146

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVS  229
            I+GRR    KLP+NKNKS+AGSIAMA+ GFLASIG+M YFS FG +E     V+GFLVVS
Sbjct  147  IVGRRFGGKKLPYNKNKSYAGSIAMASAGFLASIGYMWYFSLFGYMEGGWSKVIGFLVVS  206

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            + +A+VESHP+ST+LDDNLTVPL S+L GS +F
Sbjct  207  VISAVVESHPISTDLDDNLTVPLTSILVGSTVF  239



>ref|XP_010412644.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=265

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 178/216 (82%), Gaps = 2/216 (1%)
 Frame = -2

Query  771  WEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCW-PMFSSGRQGALVAAlipglnifkllll  598
            W EI KRG  FDQ L RKLVH+++G+VF+LCW P+FSSG QGAL A+++PGLNI ++LLL
Sbjct  50   WGEIGKRGGIFDQKLIRKLVHINIGLVFLLCWRPLFSSGIQGALFASIVPGLNILRMLLL  109

Query  597  glgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDG  418
            GLG+  D+GT+KSMSR GD RELLKGPLYYA++ITLAC  +W++SPI+IA++CNLCAGDG
Sbjct  110  GLGVYHDEGTIKSMSRHGDRRELLKGPLYYALSITLACIFFWKTSPISIAVICNLCAGDG  169

Query  417  MADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL  238
            MADI+GRR  + +LP+N+NKSFAGSI M   GFLAS+G+M+YF+SFG +E +  M+L F 
Sbjct  170  MADIVGRRFGTERLPYNRNKSFAGSIGMVTAGFLASVGYMYYFASFGYIEVSVGMILRFA  229

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+S+A+ LVES P+ST++DDNLT+ L S   G  +F
Sbjct  230  VISIASTLVESLPISTQIDDNLTISLTSAFVGILLF  265



>gb|EPS57827.1| hypothetical protein M569_16990, partial [Genlisea aurea]
Length=253

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WE+ AK G  DQ LNRKLVH+++G  FMLCWPMFS G QGAL AALIP  ++ K+ L+GL
Sbjct  49   WEKTAKMG-VDQKLNRKLVHITVGSTFMLCWPMFSVGNQGALFAALIPIASMIKVGLIGL  107

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI KD+ TVKSMSR+GD+RELLKGPLYY  TI L+  +YW+  PIAIA +CNLCAGDGMA
Sbjct  108  GIWKDEATVKSMSRYGDHRELLKGPLYYGATIALSGIIYWKKLPIAIAAICNLCAGDGMA  167

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+N+NKS  GS+AMA+ GFLASIG+M YFS  G  E +  M  GFL+V
Sbjct  168  DIVGRRFGRTKLPYNENKSLVGSLAMASAGFLASIGYMWYFSMMGYFEGSREMGFGFLMV  227

Query  231  SLAAALVESHPLSTELDDNLTVPLAS  154
            S+AAALVESHP+ST LDDNLTVPL S
Sbjct  228  SIAAALVESHPVSTMLDDNLTVPLTS  253



>ref|XP_006425113.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38353.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=284

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  77   WEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  136

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG  
Sbjct  137  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDG--  194

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
                RR    KLP+N+NKS AGS AMA+ GFL+SIGFM+YF SFG ++ +  +V GFLVV
Sbjct  195  ----RRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVV  250

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLA+ALVES P+ST+LDDNLT+ + S+  GS +F
Sbjct  251  SLASALVESLPISTKLDDNLTITITSMAVGSLVF  284



>ref|XP_008811675.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=299

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 170/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE+AKRG F+Q LNRKLVH+S+G+ FML WP+FSSG Q   +AAL PG+N  ++LL+GL
Sbjct  86   WEELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFSSGSQAPYLAALAPGINAIRMLLMGL  145

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GI ++D  VKS+SR GDYRELLKGPLYYA TITLA +V+WR+SPI IA +CNLCAGDG+A
Sbjct  146  GIWRNDAMVKSISRNGDYRELLKGPLYYACTITLATSVFWRTSPIGIAAICNLCAGDGVA  205

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR    KLP+N NKSFAGS+AM   GF+AS+G+MHY+ SFG + ++  M L F  V
Sbjct  206  DIVGRRFGRHKLPYNPNKSFAGSLAMVFAGFIASVGYMHYYHSFGFVNESWDMALRFFFV  265

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA VES P+S+ELDDNLTVP  S+L    +F
Sbjct  266  SLAAAFVESLPISSELDDNLTVPFTSLLFSGLVF  299



>ref|XP_010910062.1| PREDICTED: probable phytol kinase 2, chloroplastic [Elaeis guineensis]
Length=307

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 169/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE+AKRG F+Q LNRKLVH+S+G+ FML WP+FSSG +   +AA+ PG+N  +++L+GL
Sbjct  94   WEELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFSSGSRAPFLAAVAPGINAIRMVLMGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GIL++D  VKSMSR GDYRELLKGP YYA TITLA +++WR+SPI IA +CNLCAGDGMA
Sbjct  154  GILRNDAMVKSMSRHGDYRELLKGPFYYACTITLATSIFWRTSPIGIAAICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DIIGRR    KLP+N NKS AGS+AM   GF+AS+G+MHYF SFG + ++  M + F  V
Sbjct  214  DIIGRRFGHHKLPYNPNKSIAGSLAMVFAGFIASVGYMHYFHSFGFVNESWGMAMRFFFV  273

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            SLAAA VES P+S++LDDNLTVP  S+L    +F
Sbjct  274  SLAAAFVESLPISSQLDDNLTVPFTSLLFAGLVF  307



>ref|XP_010426391.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=240

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 176/215 (82%), Gaps = 3/215 (1%)
 Frame = -2

Query  771  WEEIAKRG-YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllg  595
            W EI KRG  FDQ L RK VH+++G+VF+LCWP+FS G QGAL A+++PGLNI ++LLLG
Sbjct  28   WGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWPLFSYGIQGALFASIVPGLNILRMLLLG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG+ +D+GT+KSMSR GD RELLKGPLYYA++ITLAC  +W++SPI+IA++CNLCAGDGM
Sbjct  88   LGVYQDEGTIKSMSRHGDRRELLKGPLYYALSITLACIFFWKTSPISIAVICNLCAGDGM  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI+GRR  + +LP+N+NKSFAGSI M   GFLAS+ +M+YF+SFG +E +  M+L F V
Sbjct  148  ADIVGRRFGTERLPYNRNKSFAGSIGMVTVGFLASVVYMYYFASFGYIEVSVGMILRFAV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +S+A+ALVES P  T++DDNLT+ L S L G  +F
Sbjct  208  ISIASALVESLP--TDIDDNLTISLTSALVGFLLF  240



>ref|XP_010650879.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Vitis vinifera]
Length=229

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -2

Query  738  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKS  559
            + ++RK VH+S+G+VFML WP+FSSG +GAL+AALIPG+NI ++LLLGLGI KD+  VKS
Sbjct  27   RPVSRKFVHISVGLVFMLFWPLFSSGCRGALLAALIPGVNIIRMLLLGLGIWKDEAVVKS  86

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPK  379
            MSR+GD+RELLKGPL YA+ ITLACA+YWR+SPIAIA +CNLCAGDG+AD++GRR    K
Sbjct  87   MSRYGDHRELLKGPLCYALAITLACAIYWRTSPIAIAAICNLCAGDGLADLVGRRFGIQK  146

Query  378  LPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHP  199
            +P+N+NKSF+GS+AMA  GFLASIG+MHYF+SFG ++++  MV GFLVVSL + LVES P
Sbjct  147  IPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGFLVVSLGSTLVESLP  206

Query  198  LSTELDDNLTVPLASVLAGSCIF  130
            +S E+DDNLT+P+ S+L G+ +F
Sbjct  207  ISNEIDDNLTIPVTSLLLGTLVF  229



>emb|CDY65783.1| BnaA03g56270D [Brassica napus]
Length=321

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 180/227 (79%), Gaps = 13/227 (6%)
 Frame = -2

Query  771  WEEIAKRGYFDQ------------NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlip  628
            W EI KRG FDQ             L RKLVH+++G+VF+LCWP+FSSG QGAL A+LIP
Sbjct  95   WGEIGKRGIFDQYVLSDLGLKQNIKLIRKLVHINIGLVFILCWPLFSSGLQGALFASLIP  154

Query  627  glnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIA  448
            GLNI ++LLLGLG+ +D+GT+KSMSR GD RELLKGP YYA++IT AC  YW++SPIAIA
Sbjct  155  GLNIIRMLLLGLGVYQDEGTIKSMSRHGDRRELLKGPFYYALSITSACIFYWKTSPIAIA  214

Query  447  LVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE  268
            +VCNLCAGDGMADI+GRR+ + KLP+N+NKS AGS+ MA  GFLAS+ +M+YF+SFG ++
Sbjct  215  VVCNLCAGDGMADIVGRRLGTKKLPYNRNKSVAGSVGMAISGFLASVAYMYYFASFGYIK  274

Query  267  KTP-HMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +   M+L F ++S+A+ALVES P+ST++DDNLTV L S L G+ +F
Sbjct  275  NSGWDMILRFFIISIASALVESLPISTDIDDNLTVSLTSALVGTLLF  321



>gb|KCW57521.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
 gb|KCW57522.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=187

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWP+FSSG + AL+AA +PGLNI ++LL+G GI KD+  VKSMSRFGD+RELLKGPLY
Sbjct  1    MLCWPLFSSGHRSALLAATVPGLNIIRVLLVGSGIWKDEAIVKSMSRFGDHRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA TIT ACA YW++SPIAIA +CNLCAGDG ADIIGRR    KLP+N NKSFAGSIAMA
Sbjct  61   YASTITFACAYYWKTSPIAIAAICNLCAGDGFADIIGRRFGHHKLPYNSNKSFAGSIAMA  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
            + GFLAS+GFM YFSSFG ++ +  MV GFL+VSLA+ALVESHPLS+ELDDNLTVPL S+
Sbjct  121  SAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMVSLASALVESHPLSSELDDNLTVPLTSM  180

Query  150  LAGSCIF  130
            L GS +F
Sbjct  181  LVGSLVF  187



>emb|CDY65781.1| BnaA03g56250D [Brassica napus]
Length=263

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 168/201 (84%), Gaps = 1/201 (0%)
 Frame = -2

Query  729  NRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSR  550
             RKLVH+++G+VF LCWP+FSSG QGAL A+LI G+NI ++LLLGLG+ +D+GT+KSMSR
Sbjct  63   TRKLVHINIGLVFTLCWPLFSSGLQGALFASLIIGVNIIRMLLLGLGVYQDEGTIKSMSR  122

Query  549  FGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPH  370
             GD RELLKGPLYYAI +TLAC  YW++SPIAIA+VCNLCAGDG+ADI+GRR+ + KLP+
Sbjct  123  HGDRRELLKGPLYYAIAVTLACIFYWKTSPIAIAVVCNLCAGDGVADIVGRRLGTKKLPY  182

Query  369  NKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVSLAAALVESHPLS  193
            N+NK+ AGSI MA  GFLAS+ +M+YF+SFG +E +   M+L F ++S+A+ALVES P+S
Sbjct  183  NRNKTIAGSIGMAIAGFLASVAYMYYFASFGYIESSGWDMILRFFIISIASALVESLPIS  242

Query  192  TELDDNLTVPLASVLAGSCIF  130
            T +DDNLTV L S L G+ +F
Sbjct  243  TAIDDNLTVSLTSALLGTLLF  263



>gb|AFW84692.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=187

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            ML WP+FSSG     +AAL PG+NI ++LLLGLG++K++  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGWYTPFLAALAPGVNIIRMLLLGLGLMKNEAMVKSMSRSGDYRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA TIT A ++ WR+SP+AIAL+CNLCAGDG+AD++GRR+   KLP+N NKS+AGSIAMA
Sbjct  61   YAATITFATSLLWRTSPVAIALICNLCAGDGIADVVGRRLGKEKLPYNPNKSYAGSIAMA  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              GFLAS+G+MHYF +FG +E+T +M L FLVVS+AAALVESHP+STELDDNLTVPL S 
Sbjct  121  VAGFLASVGYMHYFHTFGFIEETWYMALSFLVVSVAAALVESHPISTELDDNLTVPLTSF  180

Query  150  LAGSCIF  130
            L GS IF
Sbjct  181  LVGSLIF  187



>gb|KCW54683.1| hypothetical protein EUGRSUZ_I00622 [Eucalyptus grandis]
Length=187

 Score =   238 bits (606),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWP+FSS  +GAL+AA IPG NI ++LL+G GI KD+ TVKSMSRFGD RELL+GPLY
Sbjct  1    MLCWPLFSSEHRGALLAATIPGFNIIRMLLVGSGIWKDEATVKSMSRFGDRRELLEGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y + IT ACA YWR+SP+AIA +CNLCAGDG ADIIGR+    K+P+N NKS AGSIAM 
Sbjct  61   YVLMITFACAYYWRTSPVAIAAICNLCAGDGFADIIGRQFGQHKIPYNPNKSVAGSIAMT  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
            + GFLAS+GF+ YFSSFG ++ +  MV GFL+VS A+ALVESHPLS+++DDNLTVPLA  
Sbjct  121  SAGFLASLGFLSYFSSFGYIQGSWEMVGGFLMVSFASALVESHPLSSQIDDNLTVPLACA  180

Query  150  LAGSCIF  130
            L GS +F
Sbjct  181  LVGSLVF  187



>ref|NP_001065534.2| Os11g0105800 [Oryza sativa Japonica Group]
 gb|ABA91069.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99032.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68691.1| hypothetical protein OsI_37159 [Oryza sativa Indica Group]
 gb|EEE52600.1| hypothetical protein OsJ_34917 [Oryza sativa Japonica Group]
 dbj|BAF27379.2| Os11g0105800 [Oryza sativa Japonica Group]
Length=274

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+L+   NI K+ L+G
Sbjct  29   WEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASLVIAFNIIKVTLIG  88

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LGI+KDDG + SM+R GD RELLKGPLYYA  ITLA  ++WR+SPI+IA++CNLCAGDG+
Sbjct  89   LGIVKDDGVINSMTRNGDRRELLKGPLYYACAITLATVIFWRTSPISIAVICNLCAGDGV  148

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V
Sbjct  149  ADIAGRRFGHVKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWSMVIAFGV  208

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*YRTA  115
             SLAAA+VES P+ST LDDNLTVPLASVL G  +F Y  A
Sbjct  209  TSLAAAIVESLPISTRLDDNLTVPLASVLVGVLVFYYTGA  248



>ref|XP_002442649.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
 gb|EES16487.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
Length=274

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+A R   DQ L RKLVH+++G+V+ L WP+FS     A  +A LI  +NI K+ ++G
Sbjct  28   WEEVANRALLDQKLCRKLVHITVGLVYFLMWPLFSPDDVFAPFLAPLIIVINIIKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KD+G + SM+R GD+RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGLVKDEGVINSMTRHGDHRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YFS FG +EK+  MV  F V
Sbjct  148  ADIFGRRFGHVKLPHNPEKSYAGSIAMFLAGFVASVMFMCYFSIFGFVEKSWTMVAAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL AA+VES P+ST LDDNLTVP+ASVL G+ +F
Sbjct  208  ISLVAAVVESLPISTRLDDNLTVPVASVLLGALVF  242



>ref|XP_004977649.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=285

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++G
Sbjct  28   WEEVASRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIFVINIVKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KD+G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGVVKDEGVVNSMTRHGDCRELLKGPLYYACAITLTTMVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F V
Sbjct  148  ADIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVRFMCYFNIFGFVDKSWAMVGAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSLAAA+VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  208  VSLAAAVVESLPISTRLDDNLTVPLASVLVGALVF  242



>ref|XP_002864581.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40840.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KR   DQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  89   WGEIGKRDLLDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIIRMLLLGL  148

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYYA++IT AC  YW+SSPIAIA++CNLCAGDGMA
Sbjct  149  GVYHDEGTIKSMSRHGDRRELLKGPLYYALSITSACIFYWKSSPIAIAVICNLCAGDGMA  208

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L FL++
Sbjct  209  DIVGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVGYMYYFASFGYIEDSGGMILRFLII  268

Query  231  SLAAALV  211
            SLA+ALV
Sbjct  269  SLASALV  275



>ref|XP_004977648.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=285

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 164/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++G
Sbjct  28   WEEVASRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIFVINIVKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KD+G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGVVKDEGVVNSMTRHGDCRELLKGPLYYACAITLTTMVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F V
Sbjct  148  ADIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVLFMCYFNIFGFVDKSWAMVGAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSLAAA+VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  208  VSLAAAVVESLPISTRLDDNLTVPLASVLVGALVF  242



>ref|XP_004978591.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=276

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+L++G
Sbjct  28   WEEVANRALLDQTLCRKLVHITVGLVYFLMWPLFSSDDVYAPFLAPLIIVVNIIKVLVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KDDG V SM+R GD RELLKGPLYYA  ITL    +WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGVVKDDGVVNSMTRHGDCRELLKGPLYYACAITLTTIAFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI+GRR    KLPHN  KS+AGSIA    GF+AS+ FM YF+ FG ++K+  MV  F V
Sbjct  148  ADIVGRRFGQVKLPHNPEKSYAGSIANFMAGFIASVLFMCYFNIFGFVDKSWAMVGAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SLAAA VES P+ST LDDNLTVPLASVL G+ +F
Sbjct  208  ISLAAAAVESLPISTRLDDNLTVPLASVLVGALVF  242



>gb|EMT05708.1| Putative phytol kinase 2, chloroplastic [Aegilops tauschii]
Length=261

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 145/212 (68%), Gaps = 30/212 (14%)
 Frame = -2

Query  765  EIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgi  586
            E   +  F + LNRKLVH+++GMVF+L WP+FS                           
Sbjct  80   ESGDQRLFGKKLNRKLVHITIGMVFLLFWPLFSIS-------------------------  114

Query  585  LKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADI  406
                    + + +   RELLKGPLYYA TITLA +V WR+SPIAIALVCNLCAGDG+AD+
Sbjct  115  -----VFSTNALYSSGRELLKGPLYYATTITLATSVLWRTSPIAIALVCNLCAGDGIADV  169

Query  405  IGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSL  226
            +GRR    KLP+N NKS+AGSIAMA  GFLASIG+MHYF SFG +E++ +M LGFLVVS+
Sbjct  170  VGRRFGKEKLPYNPNKSYAGSIAMAVAGFLASIGYMHYFHSFGLMEESWYMTLGFLVVSV  229

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AAALVESHP+ST+LDDNLTVPL S L GS + 
Sbjct  230  AAALVESHPISTDLDDNLTVPLTSFLVGSLVL  261



>gb|ABA95607.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19373.1| hypothetical protein OsJ_34926 [Oryza sativa Japonica Group]
Length=271

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+G
Sbjct  26   WEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIG  85

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LGI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+
Sbjct  86   LGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGV  145

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V
Sbjct  146  ADIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGV  205

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
             SL+AA+VES P+ST LDDNLTVPLASVL G  +F Y
Sbjct  206  TSLSAAIVESLPISTRLDDNLTVPLASVLIGVLVFYY  242



>gb|EAY81967.1| hypothetical protein OsI_37144 [Oryza sativa Indica Group]
Length=271

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+G
Sbjct  26   WEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIG  85

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LGI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+
Sbjct  86   LGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGV  145

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V
Sbjct  146  ADIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGV  205

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
             SL+AA+VES P+ST LDDNLTVPLASVL G  +F Y
Sbjct  206  TSLSAAIVESLPISTRLDDNLTVPLASVLIGVLVFYY  242



>ref|XP_002450098.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
 gb|EES09086.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
Length=274

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+A R   DQ L RKLVH+++G+V+ L WP+FSS    A  +A LI  +NI K+ ++G
Sbjct  28   WEEVANRALLDQKLCRKLVHITVGLVYFLMWPLFSSDDAFAPFLAPLILVINIIKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KD+G V SM+R GD+RELLKGPLYYA  IT+   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGLVKDEGMVNSMTRHGDHRELLKGPLYYACAITVTTIVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V
Sbjct  148  ADIFGRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL AA+VES P+ST LDDNLTVP+ASVL  + +F
Sbjct  208  ISLVAAVVESLPISTCLDDNLTVPVASVLFSALVF  242



>ref|XP_008676758.1| PREDICTED: uncharacterized protein LOC100272684 isoform X1 [Zea 
mays]
 gb|AFW64551.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 161/215 (75%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEEIA R   DQ L RKLVH+++G+VF L WP+FSS    A  +A LI  +NI K+ ++G
Sbjct  28   WEEIANRALLDQKLCRKLVHITVGLVFFLMWPLFSSDDVFAPSLAPLIIIINIMKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG +K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGFVKAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V
Sbjct  148  ADIAGRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SLAAA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  208  ISLAAAVVESLPISTRLDDNLTVSVASVLVGALVF  242



>ref|NP_001065932.1| Os12g0105500 [Oryza sativa Japonica Group]
 dbj|BAF28951.1| Os12g0105500, partial [Oryza sativa Japonica Group]
Length=280

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+  R   DQ L RKLVH+++G+V+ L WP+FS+    A  +A+++   NI K+ L+G
Sbjct  35   WEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFSADDVYAPFLASIVIAFNIIKVTLIG  94

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LGI+KDDG + SM+R GD RELLKGPLYYA  +TLA  ++WR+SPI+IA++CNLCAGDG+
Sbjct  95   LGIVKDDGVINSMTRNGDPRELLKGPLYYACAMTLATVIFWRTSPISIAVICNLCAGDGV  154

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GR++   KLP+N +KS+AGSIAM   GFLASI +M YF  FG +E++  MV+ F V
Sbjct  155  ADIAGRQLGRIKLPYNPDKSYAGSIAMFLAGFLASILYMCYFHLFGFVEESWTMVIAFGV  214

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
             SL+AA+VES P+ST LDDNLTVPLASVL G  +F Y
Sbjct  215  TSLSAAIVESLPISTRLDDNLTVPLASVLIGVLVFYY  251



>gb|AFW84693.1| hypothetical protein ZEAMMB73_467064 [Zea mays]
Length=160

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K++  VKSMSR GDYRELLKGPLYYA TIT A ++ WR+SP+AIAL+CNLCAGDG+AD++
Sbjct  10   KNEAMVKSMSRSGDYRELLKGPLYYAATITFATSLLWRTSPVAIALICNLCAGDGIADVV  69

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR+   KLP+N NKS+AGSIAMA  GFLAS+G+MHYF +FG +E+T +M L FLVVS+A
Sbjct  70   GRRLGKEKLPYNPNKSYAGSIAMAVAGFLASVGYMHYFHTFGFIEETWYMALSFLVVSVA  129

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AALVESHP+STELDDNLTVPL S L GS IF
Sbjct  130  AALVESHPISTELDDNLTVPLTSFLVGSLIF  160



>gb|ACG40052.1| phytol kinase 2 [Zea mays]
Length=273

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 160/215 (74%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEEIA R   DQ L RKLVH+++G+VF L WP+FSS    A  +A LI  +NI K+ ++G
Sbjct  28   WEEIANRALLDQKLCRKLVHITVGLVFFLMWPLFSSDDVFAPSLAPLIIIINIMKVTVIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG +K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGFVKAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLPH   KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V
Sbjct  148  ADIAGRRFGHVKLPHXPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SLAAA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  208  ISLAAAVVESLPISTRLDDNLTVSVASVLVGALVF  242



>ref|XP_006662647.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=273

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WE +A R   DQ L RKLVH+++G+V+ L WP FS+    A  +A+++  LNI K+ L+G
Sbjct  28   WELVANRALLDQKLCRKLVHITVGLVYFLMWPFFSADDVYAPFLASIVIVLNIIKVTLIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LGI+KD+G V SM+R GD RELLKGPLYYA  ITL   ++WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGIVKDEGVVNSMTRNGDCRELLKGPLYYACAITLTTIIFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            ADI GRR    KLP+N +KS+AGS+AM   GFLASI +M YF  FG +E++  MV+ F V
Sbjct  148  ADIAGRRFGHAKLPYNPDKSYAGSVAMFLAGFLASIMYMCYFHLFGFVEESWRMVVAFGV  207

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +SLAAA+VES P+ST LDDNLTVP+ SV  G  IF Y
Sbjct  208  ISLAAAIVESLPISTRLDDNLTVPVTSVFVGVLIFYY  244



>dbj|BAA97326.1| unnamed protein product [Arabidopsis thaliana]
Length=517

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG FDQ L RKLVH+++G+VFMLCWP+FSSG QGAL A+L+PGLNI ++LLLGL
Sbjct  94   WGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPLFSSGIQGALFASLVPGLNIVRMLLLGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSMSR GD RELLKGPLYY ++IT AC  YW+SSPIAIA++CNLCAGDGMA
Sbjct  154  GVYHDEGTIKSMSRHGDRRELLKGPLYYVLSITSACIYYWKSSPIAIAVICNLCAGDGMA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR  + KLP+NKNKSFAGSI MA  GFLAS+ +M+YF+SFG +E +  M+L FLV 
Sbjct  214  DIVGRRFGTEKLPYNKNKSFAGSIGMATAGFLASVAYMYYFASFGYIEDSGGMILRFLVG  273

Query  231  SLAAALVESHPLSTELDDN  175
             +     ++     E +++
Sbjct  274  LVTVTAFQTRKQHEEQEED  292



>gb|KJB20421.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=160

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+ TVKSMSR+G+YRELLKGPLYYAIT+TLAC VYWR+SPI IA +CNLCAGDG+AD++
Sbjct  10   KDEATVKSMSRYGNYRELLKGPLYYAITVTLACVVYWRTSPIGIAALCNLCAGDGLADVV  69

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR+   KLP+N+NKS AGS+AMA  GFL+S+G+M+YFS FG ++    M+L FLVVSLA
Sbjct  70   GRRLGRKKLPYNRNKSIAGSVAMATAGFLSSVGYMYYFSYFGYIQDGWGMILRFLVVSLA  129

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +ALVES P+STELDDNLTV L S+  GS IF
Sbjct  130  SALVESLPISTELDDNLTVSLTSIFIGSLIF  160



>ref|XP_003579056.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=276

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllg  595
            WEE+  R   DQ L RKLVH+S G+V+ L WP+FS+    A  +AA++  LNI K++L+G
Sbjct  28   WEEVGNRALLDQKLCRKLVHISAGLVYFLMWPLFSADDVYAPFLAAIVIALNIVKVILIG  87

Query  594  lgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGM  415
            LG++KD+G V SM+R GD+RELLKGPLYYA  I L   V+WR+SPI+IA++CNLCAGDG+
Sbjct  88   LGVVKDEGVVNSMTRHGDHRELLKGPLYYACAIALTTVVFWRTSPISIAVICNLCAGDGV  147

Query  414  ADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLG-FL  238
            ADI+GRR+   KLPHN++KS+AGS+AM   GF+ASI FM YF  FG +++    V+G F 
Sbjct  148  ADIVGRRLGHAKLPHNRDKSYAGSVAMFFAGFVASILFMCYFHLFGFVDELSWAVVGAFG  207

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              SLAAA+VES P+ST LDDNLTVP+AS L G+  F
Sbjct  208  ATSLAAAVVESLPVSTSLDDNLTVPVASALVGALAF  243



>gb|KCW57523.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=143

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPK  379
            MSRFGD+RELLKGPLYYA TIT ACA YW++SPIAIA +CNLCAGDG ADIIGRR    K
Sbjct  1    MSRFGDHRELLKGPLYYASTITFACAYYWKTSPIAIAAICNLCAGDGFADIIGRRFGHHK  60

Query  378  LPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHP  199
            LP+N NKSFAGSIAMA+ GFLAS+GFM YFSSFG ++ +  MV GFL+VSLA+ALVESHP
Sbjct  61   LPYNSNKSFAGSIAMASAGFLASLGFMSYFSSFGYIQGSWEMVSGFLMVSLASALVESHP  120

Query  198  LSTELDDNLTVPLASVLAGSCIF  130
            LS+ELDDNLTVPL S+L GS +F
Sbjct  121  LSSELDDNLTVPLTSMLVGSLVF  143



>gb|ADE76360.1| unknown [Picea sitchensis]
Length=375

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 156/201 (78%), Gaps = 0/201 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E+AKR  FDQ LNRK VH+S+G++FML WP+FS+G Q   +AAL PGLNIF+++ LGL
Sbjct  162  WDEMAKRDVFDQKLNRKFVHISIGLIFMLFWPVFSTGPQAPYLAALAPGLNIFRMIGLGL  221

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            GILK++  VKSMSR G+ RELLKGPLYYA TITL   ++WR SPI    + NLCAGDG A
Sbjct  222  GILKNEAMVKSMSRHGNARELLKGPLYYASTITLVTVIFWRISPIGPVTISNLCAGDGFA  281

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GRR+ + KLP+NKNKSFAGS  M   GF+ S+G++ YF+SFG  E +  M+L  L++
Sbjct  282  DIVGRRLGTVKLPYNKNKSFAGSFTMLLMGFIFSVGYLFYFASFGYYEVSTRMILSSLLI  341

Query  231  SLAAALVESHPLSTELDDNLT  169
            S+ A +VES P+STELDDNLT
Sbjct  342  SIVATVVESLPISTELDDNLT  362



>ref|XP_007016938.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34557.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=250

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKR   DQ LNRKLVH+S+G+VFMLCWP+FSSG +GA++AA+ PG+NI ++LL+G 
Sbjct  94   WQETAKRRLCDQKLNRKLVHISIGLVFMLCWPLFSSGYRGAILAAITPGVNIIRMLLIGS  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GDYRELLKGPLYYA TITLACA+YWR+SPIA+A +CNLCAGDG+A
Sbjct  154  GLWKDEATVKSMSRYGDYRELLKGPLYYATTITLACALYWRTSPIAVAAICNLCAGDGIA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            D++GRR    KLP+N NKS AGS+AMA  GFLAS+G
Sbjct  214  DVVGRRFGRQKLPYNSNKSIAGSVAMATAGFLASVG  249



>gb|KJB83901.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=248

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G 
Sbjct  93   WQETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGS  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG A
Sbjct  153  GLWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDGFA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            DI+GR+    KLP+NKNKS AGS+AMA  GFL S+G
Sbjct  213  DIVGRQFGGQKLPYNKNKSIAGSVAMAIAGFLTSVG  248



>gb|KDO66964.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=254

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  77   WEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  136

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG A
Sbjct  137  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFA  196

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSS-FGQLEK  265
            D++GRR    KLP+N+NKS AGS AMA+ GFL+SIG  H  SS  G+ +K
Sbjct  197  DVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGSRHQVSSAMGKQKK  246



>ref|XP_008805007.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=186

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            ML WP+FSSG     +AA++PG+NI ++LL+GLGI ++D  VKSMSR GDYRELLKGPLY
Sbjct  1    MLFWPLFSSGSHAPFLAAVVPGINIIRMLLMGLGIWRNDAIVKSMSRHGDYRELLKGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA  +TLA +++WR+SPIAIA +CNLCAGDG+ADI+GRR  S KLP+N NKSFAG+ AM 
Sbjct  61   YACALTLA-SIFWRTSPIAIAAICNLCAGDGVADIVGRRFGSRKLPYNPNKSFAGTFAML  119

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              G +AS+G+MHY+  FG +E++  M + F  VSLAAA VES P+S++LDDNLTVP  S+
Sbjct  120  FAGLIASVGYMHYYHLFGFVEESWDMAMRFSFVSLAAAFVESLPISSKLDDNLTVPFTSI  179

Query  150  LAGSCIF  130
            L G  +F
Sbjct  180  LVGVLVF  186



>ref|XP_006387376.1| hypothetical protein POPTR_1135s00210g, partial [Populus trichocarpa]
 gb|ERP46290.1| hypothetical protein POPTR_1135s00210g, partial [Populus trichocarpa]
Length=135

 Score =   205 bits (522),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  534  ELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKS  355
            ELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMADI+GRR    K+P+NKNKS
Sbjct  1    ELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMADIVGRRFGRQKIPYNKNKS  60

Query  354  FAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDN  175
             AGS+AMA  GF+AS+GFM+YF+SFG ++K+  M+LGFLVVSLA+A VES P+STELDDN
Sbjct  61   IAGSVAMALSGFVASVGFMYYFASFGYVQKSWEMLLGFLVVSLASAFVESLPISTELDDN  120

Query  174  LTVPLASVLAGSCIF  130
            LTV L S+L G+ +F
Sbjct  121  LTVTLTSILLGNLVF  135



>gb|EYU45411.1| hypothetical protein MIMGU_mgv1a012281mg [Erythranthe guttata]
Length=255

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 3/211 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            ++   +G  + +L RKLVH+SMG++ MLCWPM S GR+  ++  L+P L ++++LL G G
Sbjct  42   KQSYDKGLLNVHLFRKLVHISMGLIIMLCWPMLSCGRRRRILGGLVPVLCMYRVLLAGFG  101

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               +   + S  R+ DYRELLK  L YA+ + LA   + RS+P+AIA + NLCAGDG+AD
Sbjct  102  --TNYKPMDSQGRYRDYRELLKAALGYALAVFLATIFHLRSTPLAIATISNLCAGDGIAD  159

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG-QLEKTPHMVLGFLVV  232
            I GRR  S KLP+NKNKSFAGSI MA  GF +SI FM YFS FG  +  +P+MVLGFL+V
Sbjct  160  IAGRRYGSWKLPYNKNKSFAGSIGMAISGFTSSILFMFYFSWFGYNIRVSPNMVLGFLMV  219

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGS  139
            S+A+ALVESHP ST LDDNLTVPLAS + G+
Sbjct  220  SVASALVESHPWSTRLDDNLTVPLASAVVGT  250



>ref|XP_006387375.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
 gb|ERP46289.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
Length=174

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AK G  DQ LNRKLVH+S+G+VFMLCWP+FSSGR+GAL AA  PG+NI ++LL+G 
Sbjct  29   WKETAKHG-LDQKLNRKLVHISIGLVFMLCWPIFSSGRRGALFAAFTPGVNIIQMLLIGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSRFGD RELLKGPLYYA+TIT ACA+YWR+SP+AIA +CNLCAGDGMA
Sbjct  88   GMWKDEATVKSMSRFGDRRELLKGPLYYALTITGACAIYWRTSPVAIAAICNLCAGDGMA  147

Query  411  DIIGRRIRSPKLPHNKNKSFAGSI  340
            DI+GRR    K+P+NKNKS AGS+
Sbjct  148  DIVGRRFGRQKIPYNKNKSIAGSV  171



>ref|XP_004977650.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X3 [Setaria italica]
Length=229

 Score =   201 bits (510),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = -2

Query  681  WPMFSSGRQGA-LVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYA  505
            WP+FSS    A  +A LI  +NI K+ ++GLG++KD+G V SM+R GD RELLKGPLYYA
Sbjct  2    WPLFSSDDVYAPFLAPLIFVINIVKVTVIGLGVVKDEGVVNSMTRHGDCRELLKGPLYYA  61

Query  504  ITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAF  325
              ITL   V+WR+SPI+IA++CNLCAGDG+ADI+GRR    KLPHN  KS+AGSIA    
Sbjct  62   CAITLTTMVFWRTSPISIAVICNLCAGDGVADIVGRRFGQVKLPHNPEKSYAGSIANFMA  121

Query  324  GFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLA  145
            GF+AS+ FM YF+ FG ++K+  MV  F VVSLAAA+VES P+ST LDDNLTVPLASVL 
Sbjct  122  GFIASVLFMCYFNIFGFVDKSWAMVGAFGVVSLAAAVVESLPISTRLDDNLTVPLASVLV  181

Query  144  GSCIF  130
            G+ +F
Sbjct  182  GALVF  186



>ref|XP_006292344.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
 gb|EOA25242.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
Length=207

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 147/214 (69%), Gaps = 34/214 (16%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W EI KRG  DQ L RKLVH+++G+VF+LCWP+FSSG QGAL A+L+ GLNI ++LLLGL
Sbjct  28   WGEIGKRGILDQKLIRKLVHINIGLVFLLCWPLFSSGIQGALFASLVTGLNIIRMLLLGL  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+  D+GT+KSM+R GD RELLKGPLYY +                              
Sbjct  88   GVYHDEGTIKSMTRHGDRRELLKGPLYYVL------------------------------  117

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
                RR+ + +LP+N+NKSFAGSI MA  GFLAS+G+M+YF+SFG +E +  M+L F V+
Sbjct  118  ----RRLGTERLPYNRNKSFAGSIGMATAGFLASVGYMYYFASFGYIEASGGMILRFAVI  173

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            S+A+ALVES P+ST++DDNLTV L S L G  +F
Sbjct  174  SIASALVESLPISTDIDDNLTVSLTSALVGFLLF  207



>gb|KCW54682.1| hypothetical protein EUGRSUZ_I00621 [Eucalyptus grandis]
Length=191

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 130/167 (78%), Gaps = 14/167 (8%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFS-----------SGRQGALVAAlipg  625
            +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FS           SG +GAL+AALI G
Sbjct  28   FEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSLARRLLLINCSSGHRGALLAALILG  87

Query  624  lnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIAL  445
            +NI ++LLLG GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA 
Sbjct  88   VNIIRMLLLGSGIWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAA  147

Query  444  VCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIG  304
            +CNLCAGD   DIIGRR+   K+P+N+NK  AGSIAM   GFLAS+G
Sbjct  148  MCNLCAGD---DIIGRRLGKHKIPYNRNKYLAGSIAMGCAGFLASLG  191



>ref|NP_001140612.1| uncharacterized protein LOC100272684 [Zea mays]
 gb|ACF84174.1| unknown [Zea mays]
 gb|AFW64550.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=193

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  12   KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  71

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+SLA
Sbjct  72   GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLA  131

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  132  AAVVESLPISTRLDDNLTVSVASVLVGALVF  162



>ref|XP_001766222.1| predicted protein [Physcomitrella patens]
 gb|EDQ68854.1| predicted protein, partial [Physcomitrella patens]
Length=234

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 3/215 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + K+ Y  Q L+RKLVH++ G++F  CWP +SS      +AAL+P  N  +LL+ GLG
Sbjct  21   DFLTKKKYLGQKLSRKLVHITSGLLFASCWPFYSSFPGAQYLAALVPVSNGIRLLVYGLG  80

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             LKD+G VKS+SR GD RELL+GPLYY + +  +  ++WR SP+ +  +  +C GDG+AD
Sbjct  81   FLKDEGLVKSVSREGDPRELLRGPLYYVVVLVFSTILFWRDSPVGVLALAMMCGGDGIAD  140

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLV  235
            I+GRR  S KLP+N  KS+AGSIAM  FGFL S G + YFS  G  QL+ T   +L   V
Sbjct  141  IVGRRFGSSKLPYNSGKSWAGSIAMFLFGFLVSYGCLWYFSLMGFYQLD-TRSALLRLSV  199

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSLAA +VES P+ST+LDDN+TVPL +V+ G  +F
Sbjct  200  VSLAATIVESLPISTKLDDNVTVPLTTVIVGMLLF  234



>gb|AFW64554.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=283

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  102  KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  161

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            GRR    KLPHN  KS+AGSIAM   GF+AS+ FM YF+ FG +EK+  MV  F V+SLA
Sbjct  162  GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLA  221

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            AA+VES P+ST LDDNLTV +ASVL G+ +F
Sbjct  222  AAVVESLPISTRLDDNLTVSVASVLVGALVF  252



>emb|CDY65782.1| BnaA03g56260D [Brassica napus]
Length=178

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  534  ELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKS  355
            ELLKGPLYYA++IT AC  YW++SPIAIA+VCNLCAGDGMADI+GRR+ + KLP+N+NK+
Sbjct  43   ELLKGPLYYALSITSACIFYWKTSPIAIAVVCNLCAGDGMADIVGRRLGTKKLPYNRNKT  102

Query  354  FAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HMVLGFLVVSLAAALVESHPLSTELDD  178
             AGSI MA  GFLAS+ +M YF+SFG +E +   M+L F ++S+A+ALVES P+ST++DD
Sbjct  103  IAGSIGMAISGFLASVAYMFYFASFGYIESSGWGMILRFFIISVASALVESLPISTDIDD  162

Query  177  NLTVPLASVLAGSCIF  130
            NLTV L S L G+ +F
Sbjct  163  NLTVSLTSALVGTLLF  178



>gb|EMT05709.1| Putative phytol kinase 2, chloroplastic [Aegilops tauschii]
Length=267

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 132/249 (53%), Gaps = 84/249 (34%)
 Frame = -2

Query  747  YFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGT  568
            Y    LNRKL+H+++GMV +L WP+FSSGR                              
Sbjct  60   YLIMKLNRKLMHITIGMVPLLFWPLFSSGR------------------------------  89

Query  567  VKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIR  388
                       E LK PLYY   I LA +V WR+SPIAIAL+CNLCAGDG+ADI+GRR+ 
Sbjct  90   -----------EFLKAPLYYVTAIALATSVLWRTSPIAIALICNLCAGDGVADIVGRRLG  138

Query  387  SPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL-----EKTPH-----------  256
              KLP+N  KS+AGSIAMA  GFLASIG MHYF +FG +     EK P+           
Sbjct  139  KEKLPYNPKKSYAGSIAMAIAGFLASIGCMHYFHTFGFIEESWKEKLPYNPKKSYAGSIA  198

Query  255  ---------------------------MVLGFLVVSLAAALVESHPLSTELDDNLTVPLA  157
                                       M  GF VVS+AA+LV+SHP +TELDDNLTVPLA
Sbjct  199  MAIAGFLASIGCMHYFHTFGFIEESWRMTFGFPVVSVAASLVQSHPNNTELDDNLTVPLA  258

Query  156  SVLAGSCIF  130
            S L GS I 
Sbjct  259  SFLVGSLIL  267



>ref|XP_002966017.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
 ref|XP_002971473.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ27222.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ33437.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
Length=247

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 138/210 (66%), Gaps = 0/210 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+AKR  FD+ L+RKLVH+ +G++FML WP+FS   +   +AA+ P  N  +++  G 
Sbjct  34   FDELAKRDVFDKKLSRKLVHICVGLIFMLFWPLFSDAPRARYLAAIAPLTNALRMVAFGT  93

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+L++   VK++SR G  RELLKGPLYYAITI++A   +WR+SP  +  + NLCAGDG A
Sbjct  94   GLLENKAFVKAVSRDGHPRELLKGPLYYAITISIATLFFWRNSPCGVVTIANLCAGDGFA  153

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI GR+    KLP+N NKS  GS+AM       S+ +   FS  G  +     ++G + V
Sbjct  154  DIFGRKYGRWKLPYNPNKSLQGSVAMFVMSAAFSMLYTFLFSQLGYFDMGVRTIIGIVAV  213

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAG  142
            SLA  +VES P+S+ LDDNLTVP  ++  G
Sbjct  214  SLATTVVESLPISSALDDNLTVPATAMAVG  243



>ref|XP_011098893.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=241

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -2

Query  735  NLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSM  556
            +L RKL+H+S G++ MLCWPMFS    G + AALIPGL +FKLL+  L   K+   +K +
Sbjct  39   HLYRKLIHISAGLIVMLCWPMFSGDLWGRVCAALIPGLCVFKLLVPALITQKEHQLIKLL  98

Query  555  SRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKL  376
             R+ D R+L++  L Y ++I      YWR+ P+AIA++C+LCAGDG+ADI GRR    KL
Sbjct  99   QRYRDSRDLVQATLAYVLSIAFTTVFYWRT-PLAIAVICSLCAGDGVADIAGRRFGGSKL  157

Query  375  PHNKNKSFAGSIAMAAFGFLASIGFMHYFS--SFGQLEKTPHMVLGFLVVSLAAALVESH  202
            P+NK+K+FAGS  MA   FLAS+ +M+YFS   + ++E TP+MVLGF +VS+A+ALVES 
Sbjct  158  PYNKSKTFAGSFGMALAAFLASLLYMYYFSWLEYIEIEATPNMVLGFFLVSVASALVESF  217

Query  201  PLSTELDDNLTVPLASVLAGS  139
            P S  LDDNLTVPLAS +  +
Sbjct  218  PFSPTLDDNLTVPLASFMLAT  238



>ref|XP_001780576.1| predicted protein [Physcomitrella patens]
 gb|EDQ54670.1| predicted protein, partial [Physcomitrella patens]
Length=240

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 141/218 (65%), Gaps = 10/218 (5%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+AKR   ++ L+RKL H+  GMVFML WP+FSS  Q   +AAL P  N  +++ LGL
Sbjct  21   FDELAKRDLLEKKLSRKLCHILSGMVFMLLWPLFSSAPQAKWLAALAPAANGLRMIGLGL  80

Query  591  giLKDDGTVKSMSRFGDYR--------ELLKGPLYYAITITLACAVYWRSSPIAIALVCN  436
            GI K++  VK++SR G  R        ELL GPLYYAITIT++   +WR+SP+    V  
Sbjct  81   GIWKNEALVKAISRGGSQRQYLRTFCSELLHGPLYYAITITISTLCFWRNSPVGAVAVAT  140

Query  435  LCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPH  256
            LCAGDG ADI+GR+  + KLP+N +KSF GS+A      LAS+G++ YFS+FG    T  
Sbjct  141  LCAGDGFADILGRKYGAHKLPYNNSKSFVGSVAFFVIASLASMGYLAYFSAFGFFTATTK  200

Query  255  MVLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLAG  142
            M    L V+ A+A+ ES PL   LDDN TVP  +++ G
Sbjct  201  MYFATLGVTFASAVAESLPL--PLDDNFTVPFTALVVG  236



>ref|XP_004496158.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cicer 
arietinum]
Length=309

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +++  ++   +Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  93   FDDFTRKNILNQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNFLRLLVNGL  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D G +KS++R GD +ELL+GPLYY + + L   V+WR SPI +  +  +C GDG+A
Sbjct  153  SLTSDQGLIKSVTRKGDPKELLRGPLYYVVILMLCAVVFWRDSPIGVVSLAMMCGGDGVA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DIIGRR  S K+P+N+ KS+AGSI+M  FGFL SIG ++Y+S+ G ++    ++V    +
Sbjct  213  DIIGRRYGSMKIPYNQKKSWAGSISMLIFGFLVSIGMLYYYSALGHVQFDWWNIVPRVAL  272

Query  234  VSLAAALVESHPLSTELDDNLTVPLASV  151
            VS+ A +VES P++  +DDN++VPLA++
Sbjct  273  VSIVATVVESLPITDVVDDNISVPLATI  300



>ref|XP_007144301.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
 gb|ESW16295.1| hypothetical protein PHAVU_007G144700g [Phaseolus vulgaris]
Length=303

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 141/212 (67%), Gaps = 9/212 (4%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R    Q L+RKLVH+  G++F+  WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  87   FDELTRRNILHQGLSRKLVHILSGLLFLFSWPIFSNSPKARYFAAFVPLVNCLRLLMNGL  146

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R GD  ELL+GPLYY + +TL   V+WR SPI +  +  +C GDG+A
Sbjct  147  SLASDEGLIKSLTREGDPEELLRGPLYYVLILTLCALVFWRESPIGVVSLAMMCGGDGVA  206

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVL  247
            DIIGR+  S K+P+N+NKS+AGSI+M  FGFL SIG ++Y+S  G ++       P +  
Sbjct  207  DIIGRKYGSMKIPYNQNKSWAGSISMLVFGFLVSIGILYYYSVLGHVQLDWASTVPRVAF  266

Query  246  GFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
                +S  A +VES P++  +DDN++VPL ++
Sbjct  267  ----ISFVATIVESLPITKIVDDNISVPLVTM  294



>gb|KEH43364.1| phytol kinase [Medicago truncatula]
Length=306

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 144/208 (69%), Gaps = 1/208 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++++ +R   DQ L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  90   FDDLTRRNVIDQGLSRKLVHILSGLLFLVSWPIFSNSLEARYFAAFVPLVNFLRLLVNGL  149

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ D G +KS++R GD +ELL+GPLYY   + L+  V+WR SPI +  +  +C GDG+A
Sbjct  150  SLVTDPGLIKSVTRKGDPKELLRGPLYYVGILMLSALVFWRESPIGVVALAMMCGGDGVA  209

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DIIGRR  S K+P+N+ KS+AGSIAM  FGFL SIG ++Y+S+ G ++    ++V     
Sbjct  210  DIIGRRYGSMKIPYNQKKSWAGSIAMLIFGFLVSIGMLYYYSALGHVQFDLWNIVPRVAF  269

Query  234  VSLAAALVESHPLSTELDDNLTVPLASV  151
            VS  A +VES P++  +DDN++VPL ++
Sbjct  270  VSFVATVVESLPITEVVDDNISVPLVTM  297



>ref|NP_001239775.1| probable phytol kinase 1, chloroplastic [Glycine max]
 sp|Q2N2K1.1|PHYK1_SOYBN RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42676.1| phytol kinase [Glycine max]
Length=302

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 143/212 (67%), Gaps = 9/212 (4%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  86   FDELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGL  145

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R GD  ELL+GPLYY + + L+  V+WR SPI +  +  +CAGDG+A
Sbjct  146  SLASDEGLIKSVTREGDPLELLRGPLYYVLILILSALVFWRESPIGVISLAMMCAGDGIA  205

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVL  247
            DIIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +  
Sbjct  206  DIIGRRYGSMKIPYNEHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTLPRVAF  265

Query  246  GFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
                +S  A LVES P++  +DDN++VPLA++
Sbjct  266  ----ISFVATLVESLPITKVVDDNISVPLATM  293



>ref|XP_003556292.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Glycine 
max]
Length=298

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 143/219 (65%), Gaps = 9/219 (4%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  82   FDELTRRNILQQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGL  141

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R GD  ELL+GPLYY + +     V+WR SP+ +  +  +CAGDG+A
Sbjct  142  SLASDEGLIKSVTREGDPLELLRGPLYYVLILIFCALVFWRESPVGVVSLAMMCAGDGIA  201

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVL  247
            DIIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +  
Sbjct  202  DIIGRRYGSLKIPYNQHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTVPRVAF  261

Query  246  GFLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
                +S  A LVES P++  +DDN++VPLA+++     F
Sbjct  262  ----ISFVATLVESLPITKVIDDNISVPLATMVVAFFTF  296



>ref|XP_009783010.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
sylvestris]
Length=321

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 142/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +++R   +QNL+RKLVH+  G++FM  WP+FS+ R     A+++P  N  +L++ GL
Sbjct  103  FDFLSERKLIEQNLSRKLVHILSGLLFMASWPIFSASRWARYFASVVPLTNCLRLVINGL  162

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  163  SLATDEGLLKSVTREGKPEELLRGPLYYVLVLILSALLFWRESPVGVISLAMMCGGDGIA  222

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DI+GRR  S K+P+NK KS AGS++M   GFL SIG ++YFS+ G L       V    V
Sbjct  223  DIVGRRFGSIKIPYNKQKSLAGSLSMFVLGFLVSIGMLYYFSALGYLHLDWVSTVERVAV  282

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VS  A +VES P++  +DDN++VPL S++  S  F
Sbjct  283  VSFIATMVESLPITPTVDDNISVPLVSMVVASLAF  317



>ref|XP_004234914.1| PREDICTED: probable phytol kinase 1, chloroplastic [Solanum lycopersicum]
Length=320

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 143/218 (66%), Gaps = 3/218 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +++R   +QNL+RKLVH+  G++FM  WP+FS   +    AA++P  N  +L++ GL
Sbjct  104  FDLLSERKLIEQNLSRKLVHILSGLLFMASWPIFSVSGRARYFAAVVPLTNCLRLVIHGL  163

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G VKS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  164  SLATDEGLVKSVTREGKPEELLRGPLYYVLVLILSAVLFWRESPVGVISLAMMCGGDGIA  223

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DI+GRR  S KLP+NK KS  GS++M   GFL SIG ++YFS+ G  QL+     V    
Sbjct  224  DIVGRRFGSTKLPYNKQKSLVGSLSMFVVGFLVSIGMLYYFSALGYFQLDWV-STVERVA  282

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +VS  A +VES P++  +DDN++VPL S++  S  F Y
Sbjct  283  LVSFVATMVESLPITGMVDDNISVPLVSMVVASLAFAY  320



>ref|XP_006436584.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 ref|XP_006485240.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 gb|ESR49824.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 gb|KDO55301.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis]
Length=301

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 153/220 (70%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +++R    Q+L+RKLVH+  G++FM+ WP+FS+  +    AAL+P +N  +L++ GL
Sbjct  85   FDNLSQRKLIQQSLSRKLVHILSGLLFMVSWPIFSTSTEARYFAALVPLVNCLRLVINGL  144

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++KDDG +KS++R G+ +ELL+GPLYY + + L+  V+WR SP+ +  +  +C GDG+A
Sbjct  145  SLVKDDGLIKSVTREGNPKELLRGPLYYVLMLILSALVFWRDSPVGVISLSMMCGGDGIA  204

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLE--KTPHMVLG  244
            D+IGRR  S K+ +N+ KS+AGSI+M  FGFL S G ++++S  G  QL+  +T   V  
Sbjct  205  DVIGRRFGSMKIFYNEKKSWAGSISMFVFGFLVSTGMLYFYSILGYYQLDWIETLQRV--  262

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VSL A +VES P++  +DDN++VPLAS++A    F Y
Sbjct  263  -ALVSLVATVVESLPITEVVDDNISVPLASMVAAYLSFGY  301



>ref|XP_009591844.1| PREDICTED: probable phytol kinase 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=350

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 141/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +++R    QNL+RKLVH+  G++FM  WP+FS+ R     A+++P  N  +L++ GL
Sbjct  132  FDFLSERKLIQQNLSRKLVHILSGLLFMASWPIFSASRWARYFASVVPLTNCLRLVIHGL  191

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  192  SLATDEGLLKSVTREGKPEELLRGPLYYVLVLILSALLFWRESPVGVISLAMMCGGDGIA  251

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLV  235
            DI+GRR  S K+P+NK KS AGS++M   GFL SIG ++YFS+ G L       V    V
Sbjct  252  DIVGRRFGSIKIPYNKQKSLAGSLSMFVLGFLVSIGMLYYFSALGYLHLDWVSTVERVAV  311

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VS  A +VES P++  +DDN++VPL S++  S  F
Sbjct  312  VSFIATMVESLPITPTVDDNISVPLVSMVVASLAF  346



>gb|KJB83903.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=212

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+E AKRG FDQ LNRKLVH+S+G+VFMLCWP++SSG +GA++AA+ PG+NI +++L+G 
Sbjct  93   WQETAKRGLFDQKLNRKLVHISIGLVFMLCWPLYSSGYRGAILAAITPGVNIIRMILIGS  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDG  418
            G+ KD+ TVK+MSR+GDYRELLKGP+YYA TITLACA YWR+SPIAIA +CNLCAGDG
Sbjct  153  GLWKDEATVKAMSRYGDYRELLKGPVYYATTITLACAFYWRTSPIAIAAICNLCAGDG  210



>ref|XP_010067215.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+L+P +N F+L++ GL
Sbjct  93   FDTLTQRNLIQQSLSRKLVHILSGLLFMASWPIFSNSMEARYFASLVPLVNCFRLVVNGL  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+A
Sbjct  153  SLAADEGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DIIGRR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +
Sbjct  213  DIIGRRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQQVAL  272

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVL  148
            VSLAA +VES P++  LD+N++VPL+S+L
Sbjct  273  VSLAATVVESLPITEVLDNNISVPLSSML  301



>ref|XP_006398907.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
 gb|ESQ40360.1| hypothetical protein EUTSA_v10014196mg [Eutrema salsugineum]
Length=306

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 141/217 (65%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    QNL+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +L++ GL
Sbjct  90   FESLTKRNVIPQNLSRKLVHILSGLLFVISWPIFSASTEARYFAAFVPLVNGLRLVVNGL  149

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELLKGPL+Y I + ++   +WR SP  +  +  +C GDG+A
Sbjct  150  SVSPNSTLIKSVTREGRPEELLKGPLFYVIALLVSVVFFWRDSPTGMISLAMMCGGDGIA  209

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L          + +
Sbjct  210  DIMGRKFGSEKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAI  269

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VSL A +VES P++ +LDDN++VPLA++LA    F Y
Sbjct  270  VSLVATVVESLPITDQLDDNVSVPLATILAAYISFGY  306



>ref|XP_010067173.1| PREDICTED: probable phytol kinase 1, chloroplastic [Eucalyptus 
grandis]
Length=309

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 141/209 (67%), Gaps = 1/209 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++FM  WP+FS+  +    A+L+P +N F+L++ GL
Sbjct  93   FDTLTQRNLIQQSLSRKLVHILSGLLFMAAWPIFSNSMEARYFASLVPLVNCFRLVVNGL  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+A
Sbjct  153  SLAADKGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DIIGRR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +
Sbjct  213  DIIGRRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQRVAL  272

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVL  148
            VSL A +VES P++  LDDN++VPL+S+L
Sbjct  273  VSLVATVVESLPITEVLDDNISVPLSSML  301



>ref|XP_008456566.1| PREDICTED: probable phytol kinase 1, chloroplastic [Cucumis melo]
Length=302

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 142/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G++F + WP+FS+  +    A+++P +N  +L++ GL
Sbjct  85   FDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTEARYFASIVPSVNCLRLVINGL  144

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  145  SLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIA  204

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DI+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++Y+S  G LE      V    +
Sbjct  205  DIMGRKFGSKRLPYNQEKSWIGSISMFIFGFCVSIGMLYYYSVLGYLELDWVKAVQNVAL  264

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSL A +VES P++  +DDN++VPL S+ A    F
Sbjct  265  VSLVATVVESLPIAEVVDDNISVPLVSMAAAFLTF  299



>ref|XP_001764046.1| predicted protein [Physcomitrella patens]
 gb|EDQ71185.1| predicted protein [Physcomitrella patens]
Length=250

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 137/214 (64%), Gaps = 2/214 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+AKR + ++ L+RKL H+  G+VFML WP+FS+      +AA     N F+++ LGL
Sbjct  37   FDELAKRDFLEKTLSRKLCHILSGLVFMLFWPLFSTAPLAKYLAAFALVANGFRMIGLGL  96

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ K++  VK++SR G  RELL+GPLYYAI I +A   +WR SPI I  +  LCAGDG A
Sbjct  97   GLWKNESLVKAISRGGSRRELLQGPLYYAIAILVATLFFWRDSPIGICAIATLCAGDGFA  156

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVV  232
            DI+GR+    KLP+N +KS+ GS+A      LAS  ++  FS+ G    TP + +  L V
Sbjct  157  DIVGRKYGKLKLPYNSDKSYIGSVAFFMLASLASTVYIAIFSACGFFTATPGVYITSLAV  216

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LA A+VE  PL   +DDN TVP  ++  G  +F
Sbjct  217  ALAGAIVEGLPL--PIDDNFTVPFTAIGVGMLLF  248



>emb|CBI40186.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  79   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  138

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G   ELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  139  LATDEGLIKSVTREGKPEELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  198

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +  + ++
Sbjct  199  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  258

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  259  SLVATVVESLPTTKVVDDNISVPLASMV  286



>ref|XP_002269950.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Vitis vinifera]
Length=302

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N  +L++ GL 
Sbjct  87   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCLRLVIYGLS  146

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R G   ELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  147  LATDEGLIKSVTREGKPEELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  206

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +  + ++
Sbjct  207  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  266

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  267  SLVATVVESLPTTKVVDDNISVPLASMV  294



>ref|XP_006838740.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
 gb|ERN01309.1| hypothetical protein AMTR_s00002p00254420 [Amborella trichopoda]
Length=255

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 142/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + K+   +Q L+RKLVH+  G++F+  WP+FSS  +    AA++P +N  +L++ GL
Sbjct  37   FDVLTKKSIIEQKLSRKLVHILSGLLFLSSWPIFSSSVEARYFAAIVPLVNSLRLVVYGL  96

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I+ ++G V+S++R G   ELL+GPLYY + +      YWR SPI +  +  +CAGDG+A
Sbjct  97   SIVTNEGLVQSVTRDGRPEELLRGPLYYVLALIYCTLFYWRESPIGVISLAMMCAGDGVA  156

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            D++GRR  + KLP NK KS+ GSI M  FGF  S+G + YFS+ G ++      +   L+
Sbjct  157  DVLGRRFGNHKLPFNKQKSWVGSICMFVFGFSVSLGMLFYFSNLGYIQLDWGSTIEKVLI  216

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +++AA +VES P++  LDDN+TVPL+S+L  S  F
Sbjct  217  IAMAATIVESLPITGLLDDNITVPLSSMLVASFFF  251



>ref|XP_006588439.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Glycine max]
 ref|XP_006588440.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Glycine max]
Length=250

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 140/211 (66%), Gaps = 9/211 (4%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +  R    Q L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL 
Sbjct  35   DSLGLRKLIGQGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGLS  94

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +  D+G +KS++R GD  ELL+GPLYY + + L+  V+WR SPI +  +  +CAGDG+AD
Sbjct  95   LASDEGLIKSVTREGDPLELLRGPLYYVLILILSALVFWRESPIGVISLAMMCAGDGIAD  154

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVLG  244
            IIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +   
Sbjct  155  IIGRRYGSMKIPYNEHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTLPRVAF-  213

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASV  151
               +S  A LVES P++  +DDN++VPLA++
Sbjct  214  ---ISFVATLVESLPITKVVDDNISVPLATM  241



>ref|XP_002315347.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
 gb|EEF01518.2| hypothetical protein POPTR_0010s23890g [Populus trichocarpa]
Length=361

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 147/218 (67%), Gaps = 3/218 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q   +A+++P +N  +L++ G 
Sbjct  145  FDTLTQRNLIQQSLSRKLVHILSGLLFAACWPIFSTSTQARYLASVVPLVNCLRLIVNGF  204

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ D+G +KS++R G+ +ELL+GPLYY + + L   V+WR SP  +  +  +C GDG+A
Sbjct  205  SLVTDEGLIKSVTREGNPQELLRGPLYYVLILILCALVFWRESPTGVISLAMMCGGDGVA  264

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DIIGRR  S KLP+N++KS+AGSI+M   GFL SIG + Y+S+ G  QL+ T   +    
Sbjct  265  DIIGRRFGSLKLPYNQHKSWAGSISMFICGFLISIGMLFYYSALGYFQLDWT-WTIQRVA  323

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +V+L A +VES P++  +DDN+TVPL S++     F Y
Sbjct  324  LVALVATVVESLPITEVVDDNITVPLVSMVVSMLSFGY  361



>ref|XP_006364440.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=316

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 144/218 (66%), Gaps = 3/218 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +++R   +QNL+RKLVH+  G++FM  WP+FS+       A+++P  N  +L++ GL
Sbjct  100  FDFLSERKLIEQNLSRKLVHILSGLLFMASWPIFSASGWARYFASVVPLTNCLRLVIHGL  159

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R G   ELL+GPLYY + + L   ++WR SP+ +  +  +C GDG+A
Sbjct  160  SLATDEGLIKSVTREGKPEELLRGPLYYVLVLILCAVLFWRESPVGVISLAMMCGGDGIA  219

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DI+GRR  S KLP+NK KS+AGS++M   GFL S+G ++YFS+ G  QL+     V    
Sbjct  220  DIVGRRFGSTKLPYNKQKSWAGSLSMFVLGFLVSVGMLYYFSALGYFQLDWV-STVERVA  278

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +VS  A +VES P++  +DDN++VPL S++  S  F Y
Sbjct  279  LVSFIATMVESLPITGMVDDNISVPLVSMVVASLAFAY  316



>ref|XP_008218940.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Prunus mume]
Length=308

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 144/215 (67%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++FML WP+FS+       A+++P +N  +LLL GL
Sbjct  92   FDNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I+ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  152  SIVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGVVSLAMMCGGDGVA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLV  235
            DI+GR+  S K+P+N+ KS+AGSI+M  FGFL SIG ++Y+S  G  +      V    +
Sbjct  212  DIMGRKFGSIKIPYNQKKSWAGSISMFLFGFLISIGMLYYYSFLGYFQLNWVETVEKVAL  271

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL A +VES P++  LDDN++VPL S+ A    F
Sbjct  272  ISLVATIVESLPITEVLDDNISVPLVSMAAAYLSF  306



>ref|XP_010490961.1| PREDICTED: phytol kinase 1, chloroplastic [Camelina sativa]
Length=308

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 143/220 (65%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  92   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVVNGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  152  SVSPNSTLIKSVTREGRPEELLKGPLFYVLALLMSSVFFWRESPIGMISLAMMCGGDGIA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L    E T   V  
Sbjct  212  DIMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRV--  269

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VS+ A +VES P++ ++DDN++VPLA++LA    F Y
Sbjct  270  -AIVSMVATVVESLPITDQVDDNVSVPLATILAAYLCFEY  308



>ref|XP_011024295.1| PREDICTED: probable phytol kinase 1, chloroplastic [Populus euphratica]
Length=307

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 146/218 (67%), Gaps = 3/218 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++F  CWP+FS+  Q    A+++P +N  +L++ G 
Sbjct  91   FDTLTQRNLIQQSLSRKLVHILSGLLFAGCWPIFSTSAQARYFASVVPLVNCLRLIVHGF  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ D+G +KS++R G+ +ELL+GPLYY + + L   V+WR SP  +  +  +C GDG+A
Sbjct  151  SLVTDEGLIKSVTREGNPQELLRGPLYYVLILILCALVFWRESPTGVISLAMMCGGDGVA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DIIGRR  S KLP+N++KS+AGS++M   GFL SIG + Y+S+ G  QL+ T   +    
Sbjct  211  DIIGRRFGSLKLPYNQHKSWAGSLSMLTCGFLISIGMLSYYSALGYFQLDWT-WTIQRVA  269

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +V+L A +VES P++  +DDN+TVPL S++     F Y
Sbjct  270  LVALVATVVESLPITEVVDDNITVPLVSMVVSMLSFGY  307



>emb|CDY44860.1| BnaC09g50600D [Brassica napus]
Length=299

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 142/217 (65%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q L+RKLVH+  G++F+L WP+FS+ ++     AL+P +N  +L++ GL
Sbjct  83   FESLTKRNVISQRLSRKLVHILSGLLFVLSWPIFSASKEARYFTALVPLVNCVRLVVNGL  142

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  +   +KS++R G   ELL+GPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  143  SISPNSTLIKSVTREGRPEELLRGPLFYVLALLVSAVFFWRDSPIGMISLAMMCGGDGIA  202

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS AGSI+M  FGF+ SIG ++Y+SS G L          + +
Sbjct  203  DIMGRKFGSQKIPYNPRKSLAGSISMFIFGFIISIGLLYYYSSLGYLHMNWETTFTKVAI  262

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VS+ A LVES P++ ++DDN++VPLA+++A    F Y
Sbjct  263  VSMVATLVESLPIADQIDDNVSVPLATIMAAYVSFGY  299



>ref|XP_009122590.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 emb|CDX70220.1| BnaA10g25690D [Brassica napus]
Length=299

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 141/217 (65%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q  +RKLVH+  G++F+L WP+FS  ++    AAL+P +N  +L++ GL
Sbjct  83   FESLTKRNVISQRFSRKLVHILSGLLFVLSWPIFSPSKEARYFAALVPLVNCVRLVVNGL  142

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELL+GPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  143  SVSPNSTLIKSVTREGRPEELLRGPLFYVLALLVSAVFFWRDSPIGMISLAMMCGGDGIA  202

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS AGSI+M  FGF+ SIG ++Y+SS G L          + +
Sbjct  203  DIMGRKFGSQKIPYNPRKSLAGSISMFIFGFIISIGLLYYYSSLGYLHMNWETTFTKVAI  262

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VS+ A LVES P++ ++DDN++VPLA+++A    F Y
Sbjct  263  VSMVATLVESLPITDQIDDNVSVPLATIMAAYVSFGY  299



>ref|XP_010423571.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=308

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 143/220 (65%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  92   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVVNGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  152  SVSPNSTLIKSVTREGRPEELLKGPLFYVLALLMSAVFFWRESPIGMISLAMMCGGDGIA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L    E T   V  
Sbjct  212  DIMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRV--  269

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VS+ A +VES P++ ++DDN++VPLA++LA    F Y
Sbjct  270  -ALVSMVATVVESLPITDQVDDNVSVPLATILAAYLCFEY  308



>ref|XP_009361416.1| PREDICTED: probable phytol kinase 1, chloroplastic [Pyrus x bretschneideri]
Length=308

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 143/218 (66%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G+ FML WP+FS+       A+++P +N  +LLL G 
Sbjct  92   FDNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTNARYFASVVPLVNCLRLLLHGF  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  152  SLVPNEGLVKSVTREGNPKELLRGPLYYVLVLILCALVFWRESPVGLISLAMMCGGDGVA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGFL S+G ++Y+S  G  E    +T   V  
Sbjct  212  DIMGRKFGSIKIPYNPKKSWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKV--  269

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               V+L A LVES P++  LDDN++VPLAS+ A    F
Sbjct  270  -AFVALVATLVESLPITEVLDDNISVPLASMAAAYLSF  306



>ref|XP_008375637.1| PREDICTED: probable phytol kinase 1, chloroplastic [Malus domestica]
Length=305

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 143/218 (66%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G+ FML WP+FS+       A+++P +N  +LLL G 
Sbjct  89   FDNLTQRNLLRQNLSRKLVHILSGIFFMLSWPIFSTSTDARYFASVVPLVNCLRLLLHGF  148

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  149  SLVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVA  208

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGFL S+G ++Y+S  G  E    +T   V  
Sbjct  209  DIMGRKFGSIKIPYNPKKSWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKV--  266

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               V+L A LVES P++  LDDN++VPLAS+ A    F
Sbjct  267  -AFVALVATLVESLPITEVLDDNVSVPLASMAAAYLSF  303



>ref|XP_011094481.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Sesamum indicum]
Length=308

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 144/220 (65%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +Q L+RKLVH+  G++F+  WP+FS+       A+++P LN  +L++ GL
Sbjct  92   FDNLTRRNIIEQTLSRKLVHILSGLLFLASWPIFSASTGARYFASVVPSLNCLRLVMNGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS+SR G   ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  152  SLTTDEGLIKSVSREGKPEELLRGPLYYVLVLILCAIVFWRESPVGMISLAMMCGGDGIA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLE--KTPHMVLG  244
            DI+GRR  S K+P+N  KS+AGSI+M  FGFL SIG ++YF+  G  QLE  +T   V  
Sbjct  212  DIMGRRFGSVKIPYNPQKSWAGSISMFLFGFLVSIGMLYYFAVLGYIQLEWMQTLERV--  269

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VS  A L+ES P +  +DDN++VPLAS++    +F Y
Sbjct  270  -ALVSFVATLIESLPTTGIVDDNISVPLASMVTSLLVFGY  308



>ref|NP_196069.1| phytol kinase 1 [Arabidopsis thaliana]
 sp|Q9LZ76.1|PHYK1_ARATH RecName: Full=Phytol kinase 1, chloroplastic; AltName: Full=Vitamin 
E pathway gene 5 protein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85555.1| putative protein [Arabidopsis thaliana]
 gb|AAX22258.1| At5g04490 [Arabidopsis thaliana]
 gb|AED90752.1| phytol kinase 1 [Arabidopsis thaliana]
Length=304

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 140/217 (65%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  88   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+A
Sbjct  148  SISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +
Sbjct  208  DIMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTLQRVAM  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VS+ A +VES P++ +LDDN++VPLA++LA    F Y
Sbjct  268  VSMVATVVESLPITDQLDDNISVPLATILAAYLSFGY  304



>gb|AAO42044.1| unknown protein [Arabidopsis thaliana]
Length=304

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 140/217 (65%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  88   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+A
Sbjct  148  SISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +
Sbjct  208  DIMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTLQRVAM  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VS+ A +VES P++ +LDDN++VPLA++LA    F Y
Sbjct  268  VSMVATVVESLPITDQLDDNISVPLATILAAYLSFGY  304



>gb|KGN63038.1| hypothetical protein Csa_2G385070 [Cucumis sativus]
Length=300

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 140/215 (65%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL
Sbjct  84   FDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFASIVPTVNCLRLVINGL  143

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  144  SLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIA  203

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DI+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++YFS  G LE      V    +
Sbjct  204  DIMGRKFGSKRLPYNQEKSWVGSISMFIFGFCVSIGMLYYFSVLGYLELDWVKAVQNVAL  263

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL A +VES P +  +DDN++VPL S+ A    F
Sbjct  264  ISLVATVVESLPSAGVVDDNISVPLVSMAAAFLTF  298



>gb|KHN00934.1| Putative phytol kinase 1, chloroplastic [Glycine soja]
Length=227

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 140/219 (64%), Gaps = 9/219 (4%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +  + +R      L+RKLVH+  G++F++ WP+FS+  +    AA +P +N  +LL+ GL
Sbjct  11   FSAVHRRAPPPSGLSRKLVHILSGLLFLVSWPIFSNSPKARYFAAFVPLVNCLRLLVNGL  70

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R GD  ELL+GPLYY + +     V+WR SP+ +  +  +CAGDG+A
Sbjct  71   SLASDEGLIKSVTREGDPLELLRGPLYYVLILIFCALVFWRESPVGVVSLAMMCAGDGIA  130

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-----KTPHMVL  247
            DIIGRR  S K+P+N++KS AGS++M  FGFL SIG ++Y+S  G ++       P +  
Sbjct  131  DIIGRRYGSLKIPYNQHKSLAGSMSMLVFGFLVSIGMLYYYSVLGHVQLDWASTVPRVAF  190

Query  246  GFLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
                +S  A LVES P++  +DDN++VPLA+++     F
Sbjct  191  ----ISFVATLVESLPITKVIDDNISVPLATMVVAFFTF  225



>ref|XP_010028018.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=148

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALI G+NI ++LLLG 
Sbjct  28   FEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALILGVNIIRMLLLGS  87

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDG  418
            GI KD+ TVKSM+RFGD RELL+GPL+Y +TIT ACA YWR+SPIAIA +CNLCAGDG
Sbjct  88   GIWKDEATVKSMTRFGDRRELLEGPLFYVLTITFACAYYWRTSPIAIAAMCNLCAGDG  145



>ref|XP_010452347.1| PREDICTED: phytol kinase 1, chloroplastic-like [Camelina sativa]
Length=307

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 143/220 (65%), Gaps = 8/220 (4%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  92   FESLTKRNVIQQRLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVINGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELL+GPL+Y + + L  AV+WR SPI +  +  +C GDG+A
Sbjct  152  SVSPNSTLIKSVTREGRPEELLEGPLFYVLAL-LMSAVFWRESPIGMISLAMMCGGDGIA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L    E T   V  
Sbjct  211  DIMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLNMNWETTFQRV--  268

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VS+ A +VES P++ ++DDN++VPLA++LA    F Y
Sbjct  269  -AIVSMVATVVESLPITDQVDDNVSVPLATILAAYLCFEY  307



>gb|AAM61593.1| unknown [Arabidopsis thaliana]
Length=304

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 139/217 (64%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  88   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  +   +KS++R G   ELLKGPL+Y + +  +   +WR SPI +  +  +C GDG+A
Sbjct  148  SISPNSMLIKSVTREGRAEELLKGPLFYVLALLFSAVFFWRESPIGMISLAMMCGGDGIA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L       L  + +
Sbjct  208  DIMGRKFGSTKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHINWETTLQRVAI  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VS+ A +VES P++ +LDDN++VPLA++L     F Y
Sbjct  268  VSMVATVVESLPITDQLDDNVSVPLATILTAYLSFGY  304



>ref|XP_006288296.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
 gb|EOA21194.1| hypothetical protein CARUB_v10001540mg [Capsella rubella]
Length=307

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 141/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  91   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSSEARYFAAFVPLVNGLRLVINGL  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  151  SLSPNSTLIKSVTREGRPEELLKGPLFYVLALLISVVFFWRDSPIGMMSLAMMCGGDGIA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L+         + +
Sbjct  211  DIMGRKYGSVKIPYNPRKSWAGSISMFIFGFSISIGLLYYYSSLGYLDMNWGTTFQRVAI  270

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VS+ A +VES P++ +LDDN++VPLA++LA    F
Sbjct  271  VSMVATVVESLPITDQLDDNVSVPLATILAAYLSF  305



>ref|XP_002871097.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47356.1| hypothetical protein ARALYDRAFT_325092 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 142/220 (65%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  88   FESLTKRNVIQQSLSRKLVHILSGLLFVLAWPIFSGSTEARYFAAFVPLVNGLRLVINGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELLKGPL+Y + + ++   +WR SPI +  +  +C GDG+A
Sbjct  148  SVSPNSTLIKSVTREGRPEELLKGPLFYVLALLISAIFFWRESPIGMISLAMMCGGDGIA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SI  ++Y+SS G L    E T   V  
Sbjct  208  DIMGRKFGSAKIPYNPRKSWAGSISMFIFGFFISIALLYYYSSLGYLHMNWETTFQRV--  265

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              ++S+ A +VES P++ +LDDN++VPLA++LA    F Y
Sbjct  266  -AMISMVATVVESLPITDQLDDNVSVPLATILAAYLSFGY  304



>ref|XP_009130827.1| PREDICTED: phytol kinase 1, chloroplastic-like [Brassica rapa]
 gb|AFB74217.1| phytol kinase [Brassica napus]
Length=307

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 139/217 (64%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q L+RKLVH+  G++F+L WP+FS+  +    AA +P +N  +L++ GL
Sbjct  91   FESLTKRDVIPQRLSRKLVHILSGLLFVLSWPIFSASTEARYFAAFVPLVNGLRLVVNGL  150

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   ++S++R G   ELLKGPL+Y + + +A   +WR SP  +  +  +C GDG+A
Sbjct  151  SVSPNSTLIQSVTREGRPEELLKGPLFYVLALLVAAVFFWRDSPTGMISLAMMCGGDGIA  210

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS AGSI+M  FGF  SIG ++Y+SS G L          + +
Sbjct  211  DIMGRKYGSYKIPYNPRKSLAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAI  270

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VSL A LVES P++ ++DDN++VPLA++LA    F Y
Sbjct  271  VSLVATLVESLPITDQIDDNVSVPLATILAAYLSFGY  307



>emb|CDO99832.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 143/218 (66%), Gaps = 3/218 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++++       QNL+RKLVH+  G++FM  WPMFS+       A+L+P +N  +L++ GL
Sbjct  110  FDKLTSANLIQQNLSRKLVHILSGLLFMASWPMFSTSTGARYFASLVPLINCLRLVVYGL  169

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             + KD+G V S++R G   ELL+GPLYY + + L+   +WR SP+ +  V  +C GDG+A
Sbjct  170  SLAKDEGLVNSVTREGKPEELLRGPLYYVMILILSAIFFWRDSPVGVVSVSMMCGGDGIA  229

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DI+GRR  S KLP+N+ KS+AGS++M   GFL SIG ++YFS+ G  QL+ +   +    
Sbjct  230  DIMGRRFGSLKLPYNQQKSWAGSLSMFVLGFLISIGMLYYFSALGCFQLDWS-CTIQRVA  288

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +VSL A LVES P +  +DDN++VP+AS++     F Y
Sbjct  289  LVSLVATLVESLPTTGIVDDNISVPIASMVTAFLSFGY  326



>ref|XP_007218720.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
 gb|EMJ19919.1| hypothetical protein PRUPE_ppa009034mg [Prunus persica]
Length=308

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 142/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++FML WP+FS+       A ++P +N  +LLL GL
Sbjct  92   FDNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFATVVPLVNCLRLLLHGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I+ ++G VKS++R G+ +ELL+GPLYY + + L    +WR SP+ +  +  +C GDG+A
Sbjct  152  SIVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALAFWRESPVGVVSLAMMCGGDGVA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLV  235
            DI+GR+  S K+P+N+ KS+AGSI+M  FGF+ SIG ++Y+S  G  +      V    +
Sbjct  212  DIMGRKFGSIKIPYNQKKSWAGSISMFLFGFVISIGMLYYYSFLGYFQLNWVETVEKVAL  271

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SL A +VES P++  LDDN++VPL S+ A    F
Sbjct  272  ISLVATIVESLPITDVLDDNISVPLVSMAAAYLSF  306



>ref|XP_010906567.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X3 
[Elaeis guineensis]
Length=256

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 134/205 (65%), Gaps = 1/205 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            +Q+L+RK+VHV  G++FM  WP+FSS  +    AA++P +N  +L+  GL I  D+G +K
Sbjct  49   EQSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAAIVPLVNCIRLVTYGLRIFTDEGLIK  108

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            S++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG ADI+GRR  + 
Sbjct  109  SVTREGKPEELLRGPLYYVMVLMFCSVVFWRESPVGVVSLAMMSGGDGFADILGRRYGAT  168

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSLAAALVES  205
            KLP+N+ KS+ GSI+M  FGFL SIG ++YFS+ G         V    VVSLAA +VES
Sbjct  169  KLPYNRQKSWIGSISMFIFGFLFSIGMLYYFSALGCFHLDWNKAVERVAVVSLAATVVES  228

Query  204  HPLSTELDDNLTVPLASVLAGSCIF  130
             P+S  +DDN++VPL  +L  S +F
Sbjct  229  LPISDFVDDNISVPLTCMLTASLLF  253



>ref|XP_004138682.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004159238.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Cucumis 
sativus]
Length=297

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 138/209 (66%), Gaps = 1/209 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL
Sbjct  84   FDNLTRRNLIQQNLSRKLVHILSGLLFTMSWPIFSTSTGARYFASIVPTVNCLRLVINGL  143

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             + KD+G +KS++R G   ELL+GPLYY + + L+  ++WR SP+ +  +  +C GDG+A
Sbjct  144  SLTKDEGLLKSLTREGKPEELLRGPLYYVLILILSAVIFWRESPVGLISLGMMCGGDGIA  203

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DI+GR+  S +LP+N+ KS+ GSI+M  FGF  SIG ++YFS  G LE      V    +
Sbjct  204  DIMGRKFGSKRLPYNQEKSWVGSISMFIFGFCVSIGMLYYFSVLGYLELDWVKAVQNVAL  263

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVL  148
            +SL A +VES P +  +DDN++VPL  ++
Sbjct  264  ISLVATVVESLPSAGVVDDNISVPLTEMM  292



>emb|CDY69673.1| BnaCnng64700D [Brassica napus]
Length=304

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 138/217 (64%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +E + KR    Q L+RKLVH+  G++F L WP+FS+  +    AA +P +N  +L++ GL
Sbjct  88   FESLTKRDVIPQRLSRKLVHILSGLLFALSWPIFSASTEARYFAAFVPLVNGLRLVVNGL  147

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   ++S++R G   ELLKGPL+Y + + +A   +WR SP  +  +  +C GDG+A
Sbjct  148  SVSPNSTLIQSVTREGRPEELLKGPLFYVLALLVAAVFFWRDSPTGMISLAMMCGGDGIA  207

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GR+  S K+P+N  KS AGSI+M  FGF  SIG ++Y+SS G L          + +
Sbjct  208  DIMGRKYGSYKIPYNPRKSLAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFTRVAI  267

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VSL A LVES P++ ++DDN++VPLA++LA    F Y
Sbjct  268  VSLVATLVESLPITDQIDDNVSVPLATILAAYLSFGY  304



>ref|XP_006364441.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=313

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 137/204 (67%), Gaps = 3/204 (1%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +++R   +QNL+RKLVH+  G++FM  WP+FS+       A+++P  N  +L++ GL + 
Sbjct  103  LSERKLIEQNLSRKLVHILSGLLFMASWPIFSASGWARYFASVVPLTNCLRLVIHGLSLA  162

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS++R G   ELL+GPLYY + + L   ++WR SP+ +  +  +C GDG+ADI+
Sbjct  163  TDEGLIKSVTREGKPEELLRGPLYYVLVLILCAVLFWRESPVGVISLAMMCGGDGIADIV  222

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S KLP+NK KS+AGS++M   GFL S+G ++YFS+ G  QL+     V    +VS
Sbjct  223  GRRFGSTKLPYNKQKSWAGSLSMFVLGFLVSVGMLYYFSALGYFQLDWV-STVERVALVS  281

Query  228  LAAALVESHPLSTELDDNLTVPLA  157
              A +VES P++  +DDN++VPLA
Sbjct  282  FIATMVESLPITGMVDDNISVPLA  305



>ref|XP_010906565.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=323

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 139/215 (65%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA++P +N  +L+  GL
Sbjct  106  FDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSTEARYFAAIVPLVNCIRLVTYGL  165

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG A
Sbjct  166  RIFTDEGLIKSVTREGKPEELLRGPLYYVMVLMFCSVVFWRESPVGVVSLAMMSGGDGFA  225

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLV  235
            DI+GRR  + KLP+N+ KS+ GSI+M  FGFL SIG ++YFS+ G         V    V
Sbjct  226  DILGRRYGATKLPYNRQKSWIGSISMFIFGFLFSIGMLYYFSALGCFHLDWNKAVERVAV  285

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            VSLAA +VES P+S  +DDN++VPL  +L  S +F
Sbjct  286  VSLAATVVESLPISDFVDDNISVPLTCMLTASLLF  320



>gb|KHG03995.1| putative phytol kinase 1, chloroplastic [Gossypium arboreum]
Length=334

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 144/218 (66%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+L+P +N  +L++ GL
Sbjct  118  FDILTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFASLVPLINCLRLVIHGL  177

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D   +KS++R G+ +ELL+GPLYY   + L    +WR SP+ +  + N+C GDG A
Sbjct  178  SLSDDQSLIKSVTREGNPKELLRGPLYYVAMLMLCALAFWRESPVGVICLANMCGGDGFA  237

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DIIGR+  S K+P+N++KS+ GSI+M   GF+ SIG ++Y+S+ G L+     T H V  
Sbjct  238  DIIGRKYGSSKIPYNQSKSWVGSISMFVSGFIISIGMLYYYSALGYLQLDWGYTMHRV--  295

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              ++SL A +VES P++  +DDN++VPLAS+LA    F
Sbjct  296  -ALISLVATVVESLPITMLIDDNISVPLASMLAAYLTF  332



>ref|XP_004307151.1| PREDICTED: phytol kinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=311

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 143/218 (66%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + KR    Q+L+RKLVH+S G++F+L WP+FS+  +    A ++P  N  +LLL GL
Sbjct  95   FDYLTKRNVLQQSLSRKLVHISSGLLFVLSWPIFSTSTEARYFATVVPLFNGLRLLLSGL  154

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ ++G VKS++R G+ +ELL+GPLYY + + +   V+WR SP+ +  +  +C GDG+A
Sbjct  155  SLVPNEGLVKSVTREGNPKELLRGPLYYVLILIVCALVFWRESPVGVISLAMMCGGDGVA  214

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DI+GRR  S K+P+N+ KS+AGSI+M  FG L S+  ++Y+S  G       KT   V  
Sbjct  215  DIMGRRFGSIKIPYNQKKSWAGSISMFVFGSLVSLAMLYYYSCLGYFNLDWAKTVQKV--  272

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             + VSL A  VES P++  +DDN++VPLAS+ A    F
Sbjct  273  -VFVSLVATAVESIPITEVVDDNISVPLASMAAAYLSF  309



>ref|XP_009396489.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 138/215 (64%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +A+R    ++L+RK VHV  G+++M  WP FSS       AA++P LN  +LL  GL
Sbjct  101  FDTLAERNIIQKSLSRKAVHVLSGLLYMATWPFFSSSMVARYFAAVVPLLNCIRLLCYGL  160

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +L D+G VKS++R G   ELL+GPLYY I + L   V+WR SP+ +  +  +  GDG A
Sbjct  161  RLLTDEGVVKSVAREGRPEELLRGPLYYVIVLLLCTLVFWRESPVGVVSLTMMSGGDGFA  220

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR    KLP+N+ KS+ GSI+M  FG   S+G ++YFS FG +   P   +  + +
Sbjct  221  DIVGRRYGVTKLPYNQQKSWVGSISMFVFGLFFSVGMLYYFSVFGYVHFDPEQTITRVAL  280

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +SLAA +VES P+S  +DDN++VPL S+L    +F
Sbjct  281  ISLAATVVESLPISDVVDDNVSVPLTSMLTSVLLF  315



>gb|EPS60714.1| phytol kinase, partial [Genlisea aurea]
Length=241

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 139/212 (66%), Gaps = 1/212 (0%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            +  R   ++ L+RKLVH+  G++F+  WP+FS+      +A+L+P +N  +LLL GL + 
Sbjct  30   LTSRKIVEKALSRKLVHILSGLLFLAAWPIFSTSTGARYLASLVPTMNFLRLLLNGLSLT  89

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KD+  + S+SR G   ELL+GPLYY + + L    +WR SP+ I  +  +CAGDG+ADI+
Sbjct  90   KDEALIASVSREGKPEELLRGPLYYVVVLMLCTISFWRDSPVGIISLSMMCAGDGIADIV  149

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSL  226
            GRR  + K+P+N +KS+AGS++M  FGFL SIG ++Y+   G +E +    +    +VS+
Sbjct  150  GRRFGNVKIPYNADKSWAGSVSMFLFGFLVSIGMLYYYWILGYIELEWIQTIENVALVSV  209

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             A +VES P  + LDDN++VPL+S++    +F
Sbjct  210  VATVVESLPTKSTLDDNISVPLSSIITSLLLF  241



>gb|KJB60478.1| hypothetical protein B456_009G307400 [Gossypium raimondii]
Length=298

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 143/218 (66%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + ++    QNL+RKLVH+  G++F + WP+FS+  +    A+L+P  N  +L++ GL
Sbjct  82   FDILTQKELIQQNLSRKLVHILSGLLFAISWPIFSNADEARYFASLVPLFNCLRLVIHGL  141

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D   +KS++R G+ +ELL+GPLYY   + L   V+WR SP+ +  +  +C GDG+A
Sbjct  142  SLTDDQSLIKSVTREGNPKELLRGPLYYVAMLMLCALVFWRESPVGVICLAMMCGGDGVA  201

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DIIGR+  S K+P+N++KS+ GSI+M   GF+ SIG ++Y+S+ G L+     T H V  
Sbjct  202  DIIGRKYGSSKIPYNQSKSWVGSISMFVSGFIISIGMLYYYSALGYLQLDWGYTLHRV--  259

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
               +SL A +VES P++  +DDN++VPLAS+LA    F
Sbjct  260  -AFISLVATVVESLPITMLIDDNISVPLASMLAAYLTF  296



>ref|XP_007010114.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
 gb|EOY18924.1| Vitamin E pathway gene 5 isoform 1 [Theobroma cacao]
Length=348

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 142/212 (67%), Gaps = 3/212 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + ++    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL
Sbjct  132  FDTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFASVVPLVNCVRLVIHGL  191

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D   +KS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  192  SLADDQRLIKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVA  251

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DI+GRR  S KLP+N+NKS+ GSI+M  FGF  S+G ++Y+S  G  QL+    M    L
Sbjct  252  DILGRRFGSSKLPYNRNKSWVGSISMFVFGFFISVGMLYYYSVLGYFQLDWGWTMCRVAL  311

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAG  142
             VSL A +VES P +T +DDN++VPLA+++A 
Sbjct  312  -VSLVATVVESLPFTTVVDDNISVPLATMIAA  342



>gb|KFK24895.1| hypothetical protein AALP_AA8G038700 [Arabis alpina]
Length=302

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 141/220 (64%), Gaps = 7/220 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + KR    Q+L+RKLVH+  G++F+L WP+FS   +    AA +P +N  +L++ GL
Sbjct  86   FDNLTKRNVIPQSLSRKLVHILSGLLFVLSWPIFSESTEARYFAAFVPLVNCLRLVVNGL  145

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +   +KS++R G   ELL+GPL+Y   + ++   +WR SP  +  +  +C GDG+A
Sbjct  146  SVTPNSTLIKSVTREGRPEELLRGPLFYVFALLVSVVFFWRDSPTGMLSLAMMCGGDGIA  205

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL----EKTPHMVLG  244
            DI+GR+  S K+P+N  KS+AGSI+M  FGF  SIG ++Y+SS G L    E T   V  
Sbjct  206  DIMGRKFGSVKIPYNPRKSWAGSISMFIFGFFISIGLLYYYSSLGYLHMNWETTFQRV--  263

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              +VS+ A +VES P++ +LDDN++VPLA++LA    F Y
Sbjct  264  -AMVSMVATVVESLPITDQLDDNVSVPLATILAAYVSFGY  302



>ref|XP_010552940.1| PREDICTED: phytol kinase 1, chloroplastic [Tarenaya hassleriana]
Length=313

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 138/217 (64%), Gaps = 1/217 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + KR    Q+L+RKLVH+  G++F L WP+FS+  +    AAL+P +N  +LL+ GL
Sbjct  97   FKNLTKRDLIPQSLSRKLVHILSGLLFALSWPIFSASTEARYFAALVPLVNCLRLLVNGL  156

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D   ++S++R G   ELLKGPLYY I + +   ++WR SPI +  +  +C GDG+A
Sbjct  157  SVSPDASLIQSVTREGKAEELLKGPLYYVIVLIITVLMFWRDSPIGMITLAMMCGGDGIA  216

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S K+P+N  KS+ GS++M   GF  S G ++Y+S  G L       L  + +
Sbjct  217  DIMGRRFGSQKIPYNPRKSWVGSVSMFIVGFTISTGVLYYYSKLGYLNLNWDTALQRVAL  276

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VSL A +VES P++  LDDNL+VP+AS++A    F Y
Sbjct  277  VSLVATIVESLPITDRLDDNLSVPMASIVAAYVSFGY  313



>gb|KDP45055.1| hypothetical protein JCGZ_01555 [Jatropha curcas]
Length=319

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 140/215 (65%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    QNL+RKLVH+  G++F + WP+FS+  +    A L+P +N  +L++ GL
Sbjct  103  FDTLTQRKLIQQNLSRKLVHILSGLLFAVSWPIFSTSTEARYFATLVPLVNGLRLVIHGL  162

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  +DG +KS++R G   ELLKGPLYY + + L   V+WR SPI +  +  +C GDG+A
Sbjct  163  SLATNDGLIKSVTREGKPEELLKGPLYYVLMLILCALVFWRESPIGLISLAMMCGGDGVA  222

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP+N+ KS+ GSI+M   GFL S+G ++Y+S+ G  +      +  + +
Sbjct  223  DIMGRRFGSMKLPYNQQKSWVGSISMFISGFLISMGMLYYYSALGYFDFDWIWTMKRVAL  282

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            ++L A +VES P +  +DDN++VPL S+LA    F
Sbjct  283  IALVATIVESLPTTETIDDNISVPLTSILAAYLSF  317



>gb|KDO66966.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=244

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 117/162 (72%), Gaps = 16/162 (10%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            WEE A+R  FDQ LNRKLVH+S+G++FMLCWP+FSSG +GA++A+L PG+NI ++LL+G 
Sbjct  77   WEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGS  136

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G+ KD+ TVKSMSR+GD RELL GPLYYAITITLAC +YWR+SP  IA +CNLCAGDG  
Sbjct  137  GMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDG--  194

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
                           + +S    +  + F  L+++ +++ FS
Sbjct  195  --------------KETESLCMPVLSSLFTGLSAVQYLNLFS  222



>gb|ACP43458.1| phytol kinase [Lactuca sativa]
Length=309

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%), Gaps = 7/218 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +QNL+RKLVH+  G+++M CWP+FS+       A + P LN  +LL+ GL
Sbjct  93   FDYLTQRQIIEQNLSRKLVHILSGLLYMGCWPIFSTSTDARYFAVIAPLLNCTRLLVHGL  152

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             ++ ++  +KS++R G   ELL+GPLYY + + L+  ++WR SPI +  +  +C GDG+A
Sbjct  153  SLVPNEDLIKSVTREGKPEELLRGPLYYVLMLILSSLLFWRDSPIGVVSLSMMCGGDGIA  212

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE----KTPHMVLG  244
            DI+GRR    K+P+NK KS+ GSI+M   GFL S+G ++YFS  G  E    KT   V  
Sbjct  213  DIMGRRFGLHKIPYNKQKSWVGSISMFMVGFLVSVGMLYYFSKLGYFELDWLKTMERV--  270

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              +V++ A LVES P    LDDN++VPL S+L     F
Sbjct  271  -AMVAIVATLVESLPTKGGLDDNISVPLVSMLTAYLSF  307



>ref|XP_010665627.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=317

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 137/215 (64%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +  R    + L+RKLVH+  G++F+  WP+FS+  +    A+L P  N  +L++ GL
Sbjct  101  FDYLTDRNIISKKLSRKLVHIFSGLLFVASWPLFSTSSEARYFASLAPLANCLRLVVYGL  160

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R G   ELL GPLYY +T+ +   V+WR SP+ +  +  +C GDG+A
Sbjct  161  SLATDEGLIKSVTREGKPEELLTGPLYYVLTLAVCAIVFWRESPVGLLSLAMMCGGDGVA  220

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHM-VLGFLV  235
            DI+GR+    KLP+N+ KS+AGSI+M AFGFL SIG ++Y+S+ G  +   ++  +   V
Sbjct  221  DIMGRKFGHVKLPYNQKKSWAGSISMFAFGFLISIGMLYYYSALGYFQLDWNITTIRVAV  280

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V   A +VES P +  +DDN++VPL ++L     F
Sbjct  281  VCFIATIVESLPTTEIIDDNISVPLVTLLTAYICF  315



>gb|ACF84080.1| unknown [Zea mays]
Length=170

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            YA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI GRR    KLPHN  KS+AGSIAM 
Sbjct  13   YACAITLTTIVFWRTSPISIAVICNLCAGDGVADIAGRRFGHVKLPHNPEKSYAGSIAMF  72

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLASV  151
              GF+AS+ FM YF+ FG +EK+  MV  F V+SLAAA+VES P+ST LDDNLTV +ASV
Sbjct  73   LAGFIASVLFMCYFNIFGFVEKSWTMVAAFGVISLAAAVVESLPISTRLDDNLTVSVASV  132

Query  150  LAGSCIF  130
            L G+ +F
Sbjct  133  LVGALVF  139



>ref|XP_002447301.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
 gb|EES11629.1| hypothetical protein SORBIDRAFT_06g032370 [Sorghum bicolor]
Length=304

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 141/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL
Sbjct  85   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPLLNSIRLLIYGL  144

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SP+ I  +  +  GDG A
Sbjct  145  RLYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPVGIVSLSMMSGGDGFA  204

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP NK KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  205  DIVGRRYGSVKLPFNKKKSWAGSISMFISGFLLSAMMMFYFSSLGYIDVIWQEALGKLAL  264

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  265  VALAATVVECIPVTEVVDDNISVPLATMLVAFLLF  299



>ref|XP_001418836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97129.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=251

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 128/215 (60%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +A RG F    +RKLVHV+ G  F   WP+FS+       AA IP     +L  +G 
Sbjct  37   FDALADRGAFASTTSRKLVHVTSGTFFACTWPLFSASGAARFFAAAIPLAQGVRLFGIGS  96

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K+   V+++SR G   ELLKGPLYY   +    + YWR++PI I  +  +C GDG A
Sbjct  97   GMIKNASAVRAVSREGGKEELLKGPLYYTAVLAACTSAYWRTNPIGIVAMAMMCGGDGFA  156

Query  411  DIIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            D++GR+  +   LP N+ KSFAGS    A GF  + G + YF +FG +E TP      L+
Sbjct  157  DLVGRKFGKGNALPWNEEKSFAGSAGFVAGGFGVASGLLAYFDAFGFIEATPTTYFVTLI  216

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            ++ A ALVES P+++ +DDN +V + ++  GS ++
Sbjct  217  IAFACALVESLPITSIVDDNFSVAITAIACGSLLY  251



>emb|CDP05574.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            MLCWPMFSSG QG  +AA++PG N FKLLLLGL + KD+  VK MS  GD+  +L    Y
Sbjct  1    MLCWPMFSSGNQGGFLAAMVPGFNAFKLLLLGLEMRKDEKAVKLMSGLGDHCSVLNASFY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y   I+LA  VYWR+SP+A+A VCNLC    +A I+GRR  S +LP+N+NKS AG+ +M 
Sbjct  61   YLTAISLASVVYWRTSPVAVAAVCNLC----IAPIVGRRFGSLELPYNRNKSVAGTFSMV  116

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLAAALVESHP  199
            A  FLASI +M YFS FG L+++  MV  F VVSL A L ESHP
Sbjct  117  AASFLASIWYMQYFSIFGYLQESWKMVYKFFVVSLVAGLGESHP  160



>ref|XP_003580789.1| PREDICTED: probable phytol kinase, chloroplastic [Brachypodium 
distachyon]
Length=312

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 133/214 (62%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GLG
Sbjct  92   DALTERRLVEQSLSRKIVHVLSGVMFMSSWPLFSNSNEARFFAAVVPFLNGIRLLTYGLG  151

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+  VKS++R G   ELL+GPLYY I + L    +WR SPI I  +  +  GDG AD
Sbjct  152  FYSDEALVKSVTREGKREELLRGPLYYVIVLLLIVLAFWRDSPIGIVSLSMMSGGDGFAD  211

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-V  232
            I+GRR  S KLP NK KS+AGS+AM   GFL S   + YFS  G +        G LV V
Sbjct  212  IVGRRYGSLKLPFNKKKSWAGSVAMFISGFLLSALMLSYFSWLGYIHVNWEETFGKLVLV  271

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++     +F
Sbjct  272  ALAATVVECIPVTDVVDDNISVPLATMFVAFMLF  305



>ref|NP_001105847.1| probable phytol kinase, chloroplastic precursor [Zea mays]
 sp|Q2N2K4.1|PHYK_MAIZE RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Zea mays]
 gb|ABA42673.1| phytol kinase [Zea mays]
 gb|ACG37691.1| phytol kinase 2 [Zea mays]
 tpg|DAA35443.1| TPA: putative phytol kinase, Precursor [Zea mays]
Length=303

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 141/215 (66%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL
Sbjct  81   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLIYGL  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG A
Sbjct  141  RLYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFA  200

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  201  DIVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLAL  260

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  261  VALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  295



>sp|Q7XR51.1|PHYK1_ORYSJ RecName: Full=Probable phytol kinase 1, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 emb|CAE02829.1| OSJNBa0043A12.34 [Oryza sativa Japonica Group]
 emb|CAH67696.1| H0624F09.4 [Oryza sativa Indica Group]
 gb|EEC78224.1| hypothetical protein OsI_17864 [Oryza sativa Indica Group]
Length=314

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 140/219 (64%), Gaps = 1/219 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL
Sbjct  94   FDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG A
Sbjct  154  RLSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +
Sbjct  214  DIVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLAL  273

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*YRT  118
            V+LAA +VE  P++  +DDN++VPLA++LA   +F Y +
Sbjct  274  VALAATVVECIPVNDVVDDNISVPLATMLAAYLLFGYSS  312



>gb|AIE88275.1| hypothetical protein OG_BBa0063K01.6 [Oryza glaberrima]
Length=314

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 140/219 (64%), Gaps = 1/219 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL
Sbjct  94   FDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG A
Sbjct  154  RLSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +
Sbjct  214  DIVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLAL  273

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*YRT  118
            V+LAA +VE  P++  +DDN++VPLA++LA   +F Y +
Sbjct  274  VALAATVVECIPVNDVVDDNISVPLATMLAAYLLFGYSS  312



>gb|EEE61880.1| hypothetical protein OsJ_16572 [Oryza sativa Japonica Group]
Length=314

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 140/219 (64%), Gaps = 1/219 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +  R   +QNL+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL
Sbjct  94   FDGLTARRLIEQNLSRKIVHVLSGVLFMSSWPLFSNSTEARFFAAIVPLLNCIRLLTYGL  153

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY I + ++  V+WR SPI I  +  +  GDG A
Sbjct  154  RLSTDEALVKSVTREGKPEELLRGPLYYVIVLLVSVLVFWRQSPIGIVSLSMMSGGDGFA  213

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+NKS+ GSI+M   GFL S   + YFS  G       + LG L +
Sbjct  214  DIVGRRYGSAKLPFNENKSWIGSISMFISGFLLSALMLFYFSCLGYFTVCWDLALGKLAL  273

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*YRT  118
            V+LAA +VE  P++  +DDN++VPLA++LA   +F Y +
Sbjct  274  VALAATVVECIPVNDVVDDNISVPLATMLAAYLLFGYSS  312



>ref|XP_005643081.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18537.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
Length=281

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 132/212 (62%), Gaps = 2/212 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +  ++ RG  DQ L+RKLVH+  G  F LCWP+FS+       AA++P LN+ ++L LG 
Sbjct  60   FRALSSRGIVDQKLSRKLVHILAGPGFALCWPLFSADPNARFFAAIVPCLNLLRVLALGT  119

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++ D  TV +MSR GD  ELL+GPLYY + +  A  VYWR SP+ + +   +C GDG+A
Sbjct  120  GVIDDPKTVNAMSREGDKSELLRGPLYYVVVLLGATLVYWRESPVGVVVFSLMCGGDGLA  179

Query  411  DIIGRRIRSP-KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFL  238
            DI+GRR+    KLP N +KS+AGS AM   G   +I F+ +F S G  E     M LG  
Sbjct  180  DIVGRRLGGRHKLPWNSSKSWAGSGAMFLGGSSMAIAFIAFFCSMGYFECDIAAMALGVA  239

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAG  142
             ++  A L+ES P++ ++DDN++VP    L G
Sbjct  240  AIAAVATLIESLPINQKIDDNISVPGTVALLG  271



>gb|ABA42672.1| phytol kinase [Zea mays]
Length=268

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 140/215 (65%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+ S+  +    AA++P LN  +LL+ GL
Sbjct  46   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLVSNSTEARYFAAVVPFLNSMRLLIYGL  105

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG A
Sbjct  106  RLYTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFA  165

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  166  DIVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLAL  225

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  226  VALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  260



>ref|XP_007010115.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
 gb|EOY18925.1| Vitamin E pathway gene 5 isoform 2 [Theobroma cacao]
Length=345

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 139/212 (66%), Gaps = 6/212 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + ++    QNL+RKLVH+  G++F + WP+FS+       A+++P +N  +L++ GL
Sbjct  132  FDTLTQKELIQQNLSRKLVHILSGLLFAVSWPIFSNSLLARYFASVVPLVNCVRLVIHGL  191

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D   +KS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GD   
Sbjct  192  SLADDQRLIKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGD---  248

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFL  238
            DI+GRR  S KLP+N+NKS+ GSI+M  FGF  S+G ++Y+S  G  QL+    M    L
Sbjct  249  DILGRRFGSSKLPYNRNKSWVGSISMFVFGFFISVGMLYYYSVLGYFQLDWGWTMCRVAL  308

Query  237  VVSLAAALVESHPLSTELDDNLTVPLASVLAG  142
             VSL A +VES P +T +DDN++VPLA+++A 
Sbjct  309  -VSLVATVVESLPFTTVVDDNISVPLATMIAA  339



>ref|XP_009396497.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=328

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 138/227 (61%), Gaps = 13/227 (6%)
 Frame = -2

Query  771  WEEIAKRGYFD-QNLNRKLVHVSMGMVFMLCWPMF-----------SSGRQGALVAAlip  628
            ++ +A+R     Q+L+RK VHV  G+++M  WP F           SS       AA++P
Sbjct  101  FDTLAERNIIQKQSLSRKAVHVLSGLLYMATWPFFRSVIVLTQSICSSSMVARYFAAVVP  160

Query  627  glnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIA  448
             LN  +LL  GL +L D+G VKS++R G   ELL+GPLYY I + L   V+WR SP+ + 
Sbjct  161  LLNCIRLLCYGLRLLTDEGVVKSVAREGRPEELLRGPLYYVIVLLLCTLVFWRESPVGVV  220

Query  447  LVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE  268
             +  +  GDG ADI+GRR    KLP+N+ KS+ GSI+M  FG   S+G ++YFS FG + 
Sbjct  221  SLTMMSGGDGFADIVGRRYGVTKLPYNQQKSWVGSISMFVFGLFFSVGMLYYFSVFGYVH  280

Query  267  KTPHMVLGFL-VVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
              P   +  + ++SLAA +VES P+S  +DDN++VPL S+L    +F
Sbjct  281  FDPEQTITRVALISLAATVVESLPISDVVDDNVSVPLTSMLTSVLLF  327



>ref|XP_010278283.1| PREDICTED: probable phytol kinase, chloroplastic [Nelumbo nucifera]
Length=326

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 131/205 (64%), Gaps = 1/205 (0%)
 Frame = -2

Query  741  DQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVK  562
            +Q  +RKLVH+  G+++M  WP+FS+       AAL+P LN  +L++ GL +  D+G VK
Sbjct  115  EQTFSRKLVHILSGLLYMFSWPIFSTSITARFFAALVPFLNCVRLVVYGLSLANDEGLVK  174

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            S++R G+  ELL+GPLYY + + L   ++WR SPI +  +  +  GDG ADI+GRR  S 
Sbjct  175  SVTREGNPEELLRGPLYYVLILILCAVIFWRESPIGVISLAMMAGGDGFADIMGRRFGSL  234

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVVSLAAALVES  205
            KLP+N++KS+ GSI+M   GFL S+G ++YFS+ G  +      V    +VSL A +VES
Sbjct  235  KLPYNQHKSWIGSISMFLSGFLISMGMLYYFSALGYFQLDWVWTVEKVALVSLVATVVES  294

Query  204  HPLSTELDDNLTVPLASVLAGSCIF  130
             P    +DDN++VP+ S+L     F
Sbjct  295  FPNKEGIDDNISVPITSMLMSLLFF  319



>gb|KCW65249.1| hypothetical protein EUGRSUZ_G02725 [Eucalyptus grandis]
Length=190

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            M  WP+FS+  +    A+L+P +N F+L++ GL +  D G VKS++R G  +ELL+GPLY
Sbjct  1    MAAWPIFSNSMEARYFASLVPLVNCFRLVVNGLSLAADKGLVKSVTREGSPQELLRGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y + + L   VYWR SP  +  +  +C GDG+ADIIGRR  S KLP+N  KS+AGSI+M 
Sbjct  61   YVLILILCAIVYWRESPTGVISLAMMCGGDGIADIIGRRFGSQKLPYNHKKSWAGSISMF  120

Query  330  AFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSLAAALVESHPLSTELDDNLTVPLAS  154
              GFL SIG + YFSS G  +    M L  + +VSL A +VES P++  LDDN++VPL+S
Sbjct  121  VCGFLISIGMLCYFSSLGYFQLDWTMTLQRVALVSLVATVVESLPITEVLDDNISVPLSS  180

Query  153  VL  148
            +L
Sbjct  181  ML  182



>ref|XP_010658680.1| PREDICTED: phytol kinase 1, chloroplastic isoform X2 [Vitis vinifera]
Length=277

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 125/208 (60%), Gaps = 26/208 (13%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +Q+L+RKLVH+  G++FM+ W +FS+  +    A+L+P +N          
Sbjct  87   DNLTQRKIIEQSLSRKLVHILSGLLFMVSWSIFSTSTEARYFASLVPVVNCL--------  138

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + + +   V+WR SPI +  +  +C GDG+AD
Sbjct  139  -----------------RELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIAD  181

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL-GFLVV  232
            I+GRR  S KLP+N+ KS+AGSI+M  FGFL SIG +HYFS+ G  +      +    ++
Sbjct  182  IMGRRFGSLKLPYNQQKSWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALI  241

Query  231  SLAAALVESHPLSTELDDNLTVPLASVL  148
            SL A +VES P +  +DDN++VPLAS++
Sbjct  242  SLVATVVESLPTTKVVDDNISVPLASMV  269



>ref|XP_002500009.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61267.1| predicted protein, partial [Micromonas sp. RCC299]
Length=235

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 134/216 (62%), Gaps = 2/216 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +A +   ++ L+RK++H + G  F L WP+FSS       AA +P L   +L  +G 
Sbjct  20   FDVLASKKILERKLSRKVIHTTSGPFFALTWPLFSSSPAACYFAACVPALQAVRLFGIGS  79

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++K++  V+++SR GD  ELLKGPL Y I + +  A+YWR SP  +A +  +C GDGMA
Sbjct  80   GLIKNENAVRAVSREGDKGELLKGPLIYTIVLVVTTALYWRGSPEGVAALALMCGGDGMA  139

Query  411  DIIGRRIRS-PKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV  235
            DI+GRR+ +  KLP N++KS AGS+A    GF  S+GF+  F   G +E       G L 
Sbjct  140  DIVGRRLGAGNKLPFNEDKSAAGSLAFFIVGFGMSVGFVALFHHLGYMEMDAGAAAGRLA  199

Query  234  VSLAAALV-ESHPLSTELDDNLTVPLASVLAGSCIF  130
            V  AA  V E+ P++  LDDN++VP+ +++ GS +F
Sbjct  200  VLAAACTVAEALPVTGVLDDNISVPVLALVLGSFLF  235



>ref|XP_008795886.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=309

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 140/217 (65%), Gaps = 7/217 (3%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +L+  GL 
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIRLVTYGLR  152

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  153  IFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  212

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  213  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  269

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  270  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  306



>ref|XP_002968111.1| hypothetical protein SELMODRAFT_440293 [Selaginella moellendorffii]
 gb|EFJ30365.1| hypothetical protein SELMODRAFT_440293 [Selaginella moellendorffii]
Length=195

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 125/195 (64%), Gaps = 1/195 (1%)
 Frame = -2

Query  711  VSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRE  532
            ++ G +FML WP+FSS      + +L+P  N  +LL+LGLG+  ++G VKSMSR GD +E
Sbjct  1    MTTGPLFMLSWPLFSSSSASRYICSLVPLANAVRLLILGLGLRTNEGVVKSMSRDGDAKE  60

Query  531  LLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSF  352
            LL+GPLYY   + ++   +WR SP+ +  +  +C GDG+ADIIGR+    KLP+N+ KS+
Sbjct  61   LLRGPLYYVAVLFISTVCFWRDSPVGMIALSVMCGGDGIADIIGRKFGREKLPYNEKKSW  120

Query  351  AGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-VSLAAALVESHPLSTELDDN  175
            AGS AM   G   S   ++YF+  G     P   L  +  +SLAA LVES P+++ LDDN
Sbjct  121  AGSTAMFVCGTALSFASIYYFTYLGFYALDPLDTLARVTFISLAATLVESLPITSSLDDN  180

Query  174  LTVPLASVLAGSCIF  130
            L VP  ++L GS +F
Sbjct  181  LMVPTTAMLLGSILF  195



>gb|KCW65250.1| hypothetical protein EUGRSUZ_G02725 [Eucalyptus grandis]
Length=180

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = -2

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D G VKS++R G  +ELL+GPLYY + + L   VYWR SP  +  +  +C GDG+ADIIG
Sbjct  28   DKGLVKSVTREGSPQELLRGPLYYVLILILCAIVYWRESPTGVISLAMMCGGDGIADIIG  87

Query  399  RRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSLA  223
            RR  S KLP+N  KS+AGSI+M   GFL SIG + YFSS G  +    M L  + +VSL 
Sbjct  88   RRFGSQKLPYNHKKSWAGSISMFVCGFLISIGMLCYFSSLGYFQLDWTMTLQRVALVSLV  147

Query  222  AALVESHPLSTELDDNLTVPLASVL  148
            A +VES P++  LDDN++VPL+S+L
Sbjct  148  ATVVESLPITEVLDDNISVPLSSML  172



>ref|XP_004960241.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=300

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 135/215 (63%), Gaps = 1/215 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL
Sbjct  81   FDVLTERRLVEKSLSRKIVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLTYGL  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+  VKS++R G   ELL+GPLYY + +  +  V+WR S I I  +  +  GDG A
Sbjct  141  RLSTDEALVKSVTREGKPEELLRGPLYYVLVLLFSVLVFWRESAIGIVSLSMMSGGDGFA  200

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+ GSI+M   GFL S   + YFSS G +  +     G L +
Sbjct  201  DIVGRRYGSVKLPFNEKKSWIGSISMFISGFLLSAIMLFYFSSLGYIHVSWEEAFGKLAL  260

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P+   +DDN++VPLA++L    +F
Sbjct  261  VALAATVVECIPVIDVVDDNISVPLATMLVAFLLF  295



>ref|XP_003080172.1| Predicted ER membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL54339.1| Phosphatidate cytidylyltransferase [Ostreococcus tauri]
Length=298

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 121/211 (57%), Gaps = 1/211 (0%)
 Frame = -2

Query  759  AKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLK  580
            A  G F    +RKLVHV+ G+ F   WP+FS+       A  IP +   +L  +G GI+K
Sbjct  88   ADAGTFASTTSRKLVHVTSGVGFACAWPLFSAAASAKAFACAIPVIQGARLFGIGSGIIK  147

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            ++  V+++SR G   ELLKGPLYY   ++   + YWR+SPI I  +  +C GDG ADI+G
Sbjct  148  NESAVRAVSRAGGKEELLKGPLYYTAALSALTSGYWRTSPIGIVAIAMMCGGDGFADIVG  207

Query  399  RRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLVVSLA  223
            RR      LP N +KSFAGS    A GF  + G + YF  FG +E T         +S A
Sbjct  208  RRFGEGNALPWNGDKSFAGSAGFVAGGFGIASGLLAYFQHFGFIETTGSTYAATFAISCA  267

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             ALVES P+S+ LDDN TV   +V  G+ +F
Sbjct  268  CALVESLPVSSVLDDNFTVVFTAVALGTLLF  298



>emb|CDP04896.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  705  MGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGD-YREL  529
            MG+VF LCWP FSSG QG  +AA++PG N FK+LLLGL + KD+  VK MS  GD YR++
Sbjct  1    MGLVFTLCWPRFSSGNQGGFLAAMVPGFNAFKMLLLGLEMRKDEKAVKLMSGLGDHYRQI  60

Query  528  LKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFA  349
            LK   Y+   I+LA  VYWR+SP+A+A VC LCAGD +A I+GRR  S KLP+NKNKS A
Sbjct  61   LKASFYFLTAISLASVVYWRTSPVAVAAVCKLCAGDRIAPIVGRRFGSLKLPYNKNKSIA  120

Query  348  GSIAMAAFGFLASIGF  301
            G+IAM A  FLASI F
Sbjct  121  GTIAMVAASFLASIFF  136



>ref|XP_011094482.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Sesamum indicum]
Length=221

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G +KS+SR G   ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+ADI+
Sbjct  68   TDEGLIKSVSREGKPEELLRGPLYYVLVLILCAIVFWRESPVGMISLAMMCGGDGIADIM  127

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VVSL  226
            GRR  S K+P+N  KS+AGSI+M  FGFL SIG ++YF+  G ++      L  + +VS 
Sbjct  128  GRRFGSVKIPYNPQKSWAGSISMFLFGFLVSIGMLYYFAVLGYIQLEWMQTLERVALVSF  187

Query  225  AAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
             A L+ES P +  +DDN++VPLAS++    +F Y
Sbjct  188  VATLIESLPTTGIVDDNISVPLASMVTSLLVFGY  221



>gb|EYU39693.1| hypothetical protein MIMGU_mgv1a014475mg [Erythranthe guttata]
Length=188

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 101/155 (65%), Gaps = 4/155 (3%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
             D+G  KS+SR G   ELLKGPLYY + + L   ++WR SPI +  +  +C GDG+ADI+
Sbjct  36   TDEGLTKSVSRLGKPEELLKGPLYYVLVLILCAILFWRESPIGMISLAMMCGGDGIADIM  95

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLEKTPHMVLGFLVVS  229
            GRR  S K+P+N  KS AGSI+M  FGFL SIG ++YF + G  QLE  P  V    +V+
Sbjct  96   GRRFGSVKIPYNPEKSLAGSISMFLFGFLVSIGMLYYFVALGYIQLEWVPT-VERVALVA  154

Query  228  LAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
              A LVES P +  +DDN++VPLAS++    +F Y
Sbjct  155  FVATLVESLP-NRIVDDNISVPLASMVTSFLVFGY  188



>sp|Q2N2K3.1|PHYK_WHEAT RecName: Full=Probable phytol kinase, chloroplastic; Flags: Precursor 
[Triticum aestivum]
 gb|ABA42674.1| phytol kinase [Triticum aestivum]
Length=300

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 132/214 (62%), Gaps = 1/214 (0%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R    Q+L+RK+VHV  G+ FM  WP+FS+       AA++P LN  +LL  GLG
Sbjct  82   DALTERRLVQQSLSRKVVHVLSGVFFMASWPLFSNSTSARFFAAVVPFLNCVRLLTYGLG  141

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+  VKS++R G   ELL+GPLYY I + +   V+WR SPI I  +  +  GDG AD
Sbjct  142  FYSDEALVKSVTREGKREELLRGPLYYVIVLLIIVLVFWRDSPIGIVSLSMMSGGDGFAD  201

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFLV-V  232
            I+GRR  S KLP NK KS+ GS AM   GFL S   + YFS  G +  +    LG LV V
Sbjct  202  IVGRRFGSLKLPFNKKKSWVGSAAMFISGFLLSALMLSYFSWLGYIHVSWDQALGKLVLV  261

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            +LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  262  ALAATVVECIPVTDVVDDNISVPLATMLVAFLLF  295



>sp|Q2N2K2.1|PHYK2_SOYBN RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42675.1| phytol kinase [Glycine max]
Length=292

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 134/215 (62%), Gaps = 12/215 (6%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL+ GL
Sbjct  81   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLIYGL  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+             ELL+GPLYY + +  +  V+WR SPI I  +  +  GDG A
Sbjct  141  RLYTDEAL-----------ELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFA  189

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  190  DIVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLAL  249

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  250  VALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  284



>ref|XP_006436583.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 ref|XP_006485241.1| PREDICTED: probable phytol kinase 1, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR49823.1| hypothetical protein CICLE_v10032240mg [Citrus clementina]
 gb|KDO55302.1| hypothetical protein CISIN_1g022218mg [Citrus sinensis]
Length=280

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            KDDG +KS++R G+ +ELL+GPLYY + + L+  V+WR SP+ +  +  +C GDG+AD+I
Sbjct  127  KDDGLIKSVTREGNPKELLRGPLYYVLMLILSALVFWRDSPVGVISLSMMCGGDGIADVI  186

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG--QLE--KTPHMVLGFLV  235
            GRR  S K+ +N+ KS+AGSI+M  FGFL S G ++++S  G  QL+  +T   V    +
Sbjct  187  GRRFGSMKIFYNEKKSWAGSISMFVFGFLVSTGMLYFYSILGYYQLDWIETLQRV---AL  243

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            VSL A +VES P++  +DDN++VPLAS++A    F Y
Sbjct  244  VSLVATVVESLPITEVVDDNISVPLASMVAAYLSFGY  280



>ref|XP_008795887.1| PREDICTED: probable phytol kinase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=280

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 126/217 (58%), Gaps = 36/217 (17%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+FS                          
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFS--------------------------  126

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
               D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  127  ---DEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  183

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  184  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  240

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  241  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  277



>ref|XP_010556037.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=85

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPK  379
            MSR GD RELLKGPLYYA +ITLAC  YWR+SPIAIA++CNLCAGDGMADI+GRR+ + K
Sbjct  1    MSRHGDRRELLKGPLYYASSITLACVFYWRTSPIAIAVICNLCAGDGMADIVGRRLGTEK  60

Query  378  LPHNKNKSFAGSIAMAAFGFLASI  307
            LP+N++KS AGSIAMA  GF AS+
Sbjct  61   LPYNRSKSIAGSIAMATSGFTASV  84



>ref|XP_002955247.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
 gb|EFJ43766.1| hypothetical protein VOLCADRAFT_45651 [Volvox carteri f. nagariensis]
Length=198

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 123/198 (62%), Gaps = 3/198 (2%)
 Frame = -2

Query  738  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKS  559
            Q L+RKLVH + G +F+L W +FS+      +AA++P LN  +L+ +G G++ D G VKS
Sbjct  1    QKLSRKLVHTTTGPIFVLTWILFSASPDARYLAAVVPMLNFSRLMAVGTGLISDPGLVKS  60

Query  558  MSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRI-RSP  382
            +SR GD  ELLKGPL+Y +T+  A  + WR +P  +  V  +C GDG+ADI+GRR     
Sbjct  61   VSRSGDRGELLKGPLFYVVTLVAATVLCWRDNPAGLIAVAMMCGGDGLADIVGRRWGGGA  120

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP--HMVLGFLVVSLAAALVE  208
            KLP NK KS+AGS AM   GF  S G +  F + G     P   M+     V+L A +VE
Sbjct  121  KLPINKAKSWAGSFAMLLGGFGMSYGLISLFCNLGFFSCYPPATMLSCLGAVALGATIVE  180

Query  207  SHPLSTELDDNLTVPLAS  154
            + P++  +DDN++VP+ +
Sbjct  181  ALPINQYVDDNVSVPVVA  198



>ref|XP_002532923.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29465.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=249

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q L+RKLVH+  G++F + WP+FS+  +    A+++P +N  +L++ GL
Sbjct  92   FDTLTQRNIIQQTLSRKLVHILSGLLFAVSWPIFSNSVEARYFASIVPLVNCLRLVINGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+G +KS++R G+ +ELL+GPLYY + +     V+WR SP+ +  +  +C GDG+A
Sbjct  152  TLATDEGLIKSVTREGNPKELLRGPLYYVLVLIFCALVFWRESPVGVMALAMMCGGDGVA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGF  301
            DI+GRR  S KLPHN  KS+AGSI+M   GFL SIGF
Sbjct  212  DIMGRRFGSAKLPHNHQKSWAGSISMFISGFLISIGF  248



>ref|XP_001694607.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
 gb|EDP02602.1| phytol kinase-related protein [Chlamydomonas reinhardtii]
Length=304

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 123/202 (61%), Gaps = 3/202 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +A  G  +Q L+RKLVH + G +F+L W +FS+     ++AA++P LN  +L  +G 
Sbjct  73   FDYLAANGTLEQKLSRKLVHTTTGPIFVLTWALFSANPMARVLAAVVPMLNFMRLFAVGT  132

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++ D G V S+SR GD  ELLKGPL+Y +T+  A  + WR +P  +  V  +C GDG+A
Sbjct  133  GLVSDPGLVNSVSRSGDRTELLKGPLFYVVTLVAATVLCWRDNPAGLIAVSMMCGGDGLA  192

Query  411  DIIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL-GFL  238
            DI+GRR+ R   LP+N  KS AGS+AM   G+  + G +  F   G     P   L G L
Sbjct  193  DIVGRRLGRGNPLPYNTQKSVAGSVAMLVGGYGMAYGLISLFCGLGFFACYPPATLFGCL  252

Query  237  -VVSLAAALVESHPLSTELDDN  175
              V+LAA  VES P++  +DDN
Sbjct  253  GAVALAATAVESLPINKWVDDN  274



>ref|XP_010665628.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=296

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D+G +KS++R G   ELL GPLYY +T+ +   V+WR SP+ +  +  +C GDG+ADI+G
Sbjct  144  DEGLIKSVTREGKPEELLTGPLYYVLTLAVCAIVFWRESPVGLLSLAMMCGGDGVADIMG  203

Query  399  RRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHM-VLGFLVVSLA  223
            R+    KLP+N+ KS+AGSI+M AFGFL SIG ++Y+S+ G  +   ++  +   VV   
Sbjct  204  RKFGHVKLPYNQKKSWAGSISMFAFGFLISIGMLYYYSALGYFQLDWNITTIRVAVVCFI  263

Query  222  AALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            A +VES P +  +DDN++VPL ++L     F
Sbjct  264  ATIVESLPTTEIIDDNISVPLVTLLTAYICF  294



>ref|XP_004344106.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR20703.1| phytol kinase 2, putative [Acanthamoeba castellanii str. Neff]
Length=238

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 126/211 (60%), Gaps = 12/211 (6%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            E +  RG    N  RK +HV  G +F+LCW  F    Q    AA++PGL   +  LLGLG
Sbjct  24   ETLRDRGVLSANACRKWIHVGTGPLFILCWLAFPQDAQARYWAAVVPGLITLRFALLGLG  83

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            +LKD+ TV+S+SR GD  ELLKGPL Y I   +   VYWR S + I+++  LCAGDG AD
Sbjct  84   VLKDEKTVRSLSRTGDRTELLKGPLIYGIIFVVCTCVYWRDSSVGISILLILCAGDGFAD  143

Query  408  IIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFM----HYFSSFGQLEKTPHMVLG  244
            + GR+   + +LPHN++KS+AGS A     F+AS+ F     H F + G L       L 
Sbjct  144  LAGRKYGGAARLPHNRSKSWAGSCAF----FVASLAFQCAYAHLFHAQGWLRVGLAQSLP  199

Query  243  FLV-VSLAAALVESHPLSTELDDNLTVPLAS  154
             +V V+L + +VES P+S    DNLTV LA+
Sbjct  200  TIVAVTLVSTVVESLPVSDW--DNLTVSLAA  228



>ref|XP_003057921.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57872.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=248

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 123/203 (61%), Gaps = 2/203 (1%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ +A     ++ L+RKL+H S G  F+L WP+FS+       AA +P L   +L+ +G+
Sbjct  33   FDVLASNDVLERKLSRKLIHTSCGPFFVLLWPLFSASPSAKYFAAAVPVLQGIRLMAIGV  92

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G ++++  ++++SR GD  ELL+GPLYY   + +  AV+WR SP  IA +  +C GDG+A
Sbjct  93   GAIENEDAIRAVSREGDRTELLRGPLYYTAVLVVCTAVFWRGSPSGIAALSLMCGGDGLA  152

Query  411  DIIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-  238
            DI+GRR+ +   LP N +KS+AGS AM   GF  S+    +F + G +   P    G L 
Sbjct  153  DIVGRRLGKGNPLPFNADKSYAGSAAMFLGGFGLSLALCAFFHALGYMSVDPGSAAGRLA  212

Query  237  VVSLAAALVESHPLSTELDDNLT  169
            +++ A   +E+ P  + LDDN++
Sbjct  213  LIAAACTAIEALPAGSFLDDNIS  235



>ref|WP_012164598.1| phosphatidate cytidylyltransferase [Acaryochloris marina]
 gb|ABW29270.1| phosphatidate cytidylyltransferase [Acaryochloris marina MBIC11017]
Length=244

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 123/210 (59%), Gaps = 3/210 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A  G  +Q L+RK++H+  G +F+LCWP FS        AAL+P     + + +G+G
Sbjct  33   DALAANGILEQKLSRKIIHMGTGPLFVLCWPFFSPQPTACYFAALVPLAITLQFIGIGVG  92

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             ++D   V++M+R G+ +E+LKGPL+Y +   +    +WR+SP+ +  +  +C GDG+AD
Sbjct  93   WIQDPDAVQAMTRTGNPKEILKGPLFYGLVFVVCTIGFWRTSPVGMLALMMMCGGDGLAD  152

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-VV  232
            I+GRR+   KLP +  KS+AGS AM A  FL +  F+  F+     +      +G +  +
Sbjct  153  IVGRRLGVHKLPFSPEKSWAGSAAMFAGSFLFAFSFLSLFNRLNYFQPPLVGTVGIVAAI  212

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAG  142
            +L A LVES P      DNLT+   +V+ G
Sbjct  213  ALIATLVESLPFRD--IDNLTLTGVAVVLG  240



>gb|ACG23902.1| hypothetical protein [Zea mays]
Length=259

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 116/215 (54%), Gaps = 45/215 (21%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+F                          
Sbjct  81   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLF--------------------------  114

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
                              RELL+GPLYY + +  +  V+WR SPI I  +  +  GDG A
Sbjct  115  ------------------RELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFA  156

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  157  DIVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLAL  216

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  217  VALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  251



>ref|XP_008668661.1| PREDICTED: probable phytol kinase, chloroplastic isoform X1 [Zea 
mays]
 tpg|DAA35441.1| TPA: hypothetical protein ZEAMMB73_657762 [Zea mays]
Length=259

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 116/215 (54%), Gaps = 45/215 (21%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+ +R   +++L+RK+VHV  G++FM  WP+F                          
Sbjct  81   FDELTERRLIEKSLSRKVVHVLSGVLFMSSWPLF--------------------------  114

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
                              RELL+GPLYY + +  +  V+WR SPI I  +  +  GDG A
Sbjct  115  ------------------RELLRGPLYYVLVLLFSVLVFWRESPIGIVSLSMMSGGDGFA  156

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+AGSI+M   GFL S   M YFSS G ++      LG L +
Sbjct  157  DIVGRRYGSAKLPFNRKKSWAGSISMFISGFLLSAMMMLYFSSLGYIDVIWEEALGKLAL  216

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P++  +DDN++VPLA++L    +F
Sbjct  217  VALAATVVECVPVTEVVDDNISVPLATMLVAFLLF  251



>ref|WP_010480729.1| phosphatidate cytidylyltransferase [Acaryochloris sp. CCMEE 5410]
Length=244

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 127/215 (59%), Gaps = 5/215 (2%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A  G  +Q L+RK++H+  G +F+LCWP FS        AAL+P     + + +G+G
Sbjct  33   DALAANGMLEQKLSRKIIHMGTGPLFVLCWPFFSPQPTARYFAALVPLAITLQFIAIGVG  92

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAV-YWRSSPIAIALVCNLCAGDGMA  412
             ++D   V++M+R G+ +E+LKGPL+Y + + +AC + +WR+SP+ +  +  +C GDG+A
Sbjct  93   WIQDPDAVQAMTRTGNPKEILKGPLFYGL-VFVACTIGFWRTSPVGMLALMMMCGGDGLA  151

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR+   KLP +  KS+AGS AM A  FL +  F+  F+     +      +G +  
Sbjct  152  DIVGRRLGVHKLPFSPEKSWAGSAAMFAGSFLFAFSFLSLFNRLNYFQPPLAGTIGIVAA  211

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            ++L A LVE+ P      DNLT+   +V  G   F
Sbjct  212  IALIATLVEALPFRD--IDNLTLTGVAVALGLWWF  244



>gb|AFW64553.1| hypothetical protein ZEAMMB73_110888 [Zea mays]
Length=214

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            K +G V SM+R GD RELLKGPLYYA  ITL   V+WR+SPI+IA++CNLCAGDG+ADI 
Sbjct  102  KAEGVVNSMTRHGDRRELLKGPLYYACAITLTTIVFWRTSPISIAVICNLCAGDGVADIA  161

Query  402  GRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
            GRR    KLPHN  KS+AGSIAM   GF+AS+ + +  S
Sbjct  162  GRRFGHVKLPHNPEKSYAGSIAMFLAGFIASVLYANRLS  200



>ref|WP_013560255.1| phosphatidate cytidylyltransferase [Anaerolinea thermophila]
 dbj|BAJ63878.1| putative phosphatidate cytidylyltransferase [Anaerolinea thermophila 
UNI-1]
Length=233

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 120/214 (56%), Gaps = 3/214 (1%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + +A RG+   +L+RK++H+  G +F+LCW  F +      +AAL+P L   +  L+G G
Sbjct  22   DYLAYRGWVSSSLSRKIIHLGTGPIFVLCWLFFPNTPLSKWLAALVPLLITLQFFLVGTG  81

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
             ++D   V +MSR GD RE+L+GPLYY +   L   ++W+ SPI +  +  L  GDG+AD
Sbjct  82   WIRDPQAVSAMSRTGDRREILRGPLYYGVVFVLLTLIFWKDSPIGVVALMILSGGDGLAD  141

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLE-KTPHMVLGFLVV  232
            IIG+R  S  L  +  K+  GS+++   G   SI  +  F   G  + +     L  + +
Sbjct  142  IIGKRFPSSSLAWSPRKTVWGSLSVFVGGVFFSILVLSVFRLLGVFQFEWWDTFLKVVGI  201

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             +AA +VES P      DNLTVPL SV  G  +F
Sbjct  202  GIAATVVESLPFQDI--DNLTVPLVSVFLGYFLF  233



>ref|WP_040625197.1| phosphatidate cytidylyltransferase [Smithella sp. ME-1]
Length=233

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 122/218 (56%), Gaps = 11/218 (5%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            +  A +G   + L+RK++H+  G +F+L W +F        +AA+IP     +  L+G+G
Sbjct  22   DYFASKGLISKKLSRKIIHIGTGPIFVLSWLLFPEDPLSRYLAAIIPLFITIQFFLIGIG  81

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
            ++ D  +V +MSR GD +E+LKGP +Y +   L   ++WR SPI I  +  LC GDG AD
Sbjct  82   VINDQASVDAMSRTGDPKEILKGPFFYGVIFVLLTILFWRESPIGIIALMILCGGDGFAD  141

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQL-----EKTPHMVLG  244
            II RR+ S  L  +  KSFAG+I+M   G + S   +  F  FG L     +  P +   
Sbjct  142  IISRRVPSFALKWSPGKSFAGTISMFFGGLIFSSILIFIFIKFGFLNIIFWDGFPKI---  198

Query  243  FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             L++++ A +VES PL     DN+TVP   VL G  +F
Sbjct  199  -LLLNILATIVESLPLRDW--DNITVPAIVVLDGLILF  233



>ref|XP_004960242.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=289

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 128/215 (60%), Gaps = 12/215 (6%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +++L+RK+VHV  G++FM  WP+FS+  +    AA++P LN  +LL  GL
Sbjct  81   FDVLTERRLVEKSLSRKIVHVLSGVLFMSSWPLFSNSTEARYFAAVVPFLNSMRLLTYGL  140

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             +  D+             ELL+GPLYY + +  +  V+WR S I I  +  +  GDG A
Sbjct  141  RLSTDEAL-----------ELLRGPLYYVLVLLFSVLVFWRESAIGIVSLSMMSGGDGFA  189

Query  411  DIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVLGFL-V  235
            DI+GRR  S KLP N+ KS+ GSI+M   GFL S   + YFSS G +  +     G L +
Sbjct  190  DIVGRRYGSVKLPFNEKKSWIGSISMFISGFLLSAIMLFYFSSLGYIHVSWEEAFGKLAL  249

Query  234  VSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            V+LAA +VE  P+   +DDN++VPLA++L    +F
Sbjct  250  VALAATVVECIPVIDVVDDNISVPLATMLVAFLLF  284



>ref|XP_005645987.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21443.1| hypothetical protein COCSUDRAFT_53992 [Coccomyxa subellipsoidea 
C-169]
Length=238

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 123/216 (57%), Gaps = 6/216 (3%)
 Frame = -2

Query  759  AKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiLK  580
            ++R   DQ L+RK++H+  G++F+L WP ++       + A +P +      ++GLG + 
Sbjct  25   SRRKVMDQTLSRKVMHIGNGILFVLFWPCYTEHAVSKYLCASVPLVAALHFAMVGLGAVT  84

Query  579  DDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIG  400
            D+  V S +R GD RELL+GPL Y   I     ++WR SP  +  +  LCAGDG+ADI+G
Sbjct  85   DESLVASATRTGDRRELLRGPLLYGTIIGTLTIIFWRESPSGVTAIAVLCAGDGLADIVG  144

Query  399  RRIRSP-KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEK---TPHMVLGFLVV  232
            RR+ +  +LP++ +KS AGS+A    G +A+   + Y   +  L +   T  + LG ++ 
Sbjct  145  RRLGAANRLPYSPDKSAAGSMACFLGGAVAAGACLVYLRKWNCLSQELGTWEIALGSIIT  204

Query  231  SLAAALVESHPLSTELDDNLTVPLASVLAGSCIF*Y  124
            +   A VES PL+    DN TVPLA+ L     F Y
Sbjct  205  AGVGAAVESLPLAEV--DNWTVPLAAALTARAFFGY  238



>ref|XP_008795889.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X4 
[Phoenix dactylifera]
Length=265

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 51/217 (24%)
 Frame = -2

Query  768  EEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglg  589
            + + +R   +++L+RK+VHV  G++FM  WP+F                           
Sbjct  93   DTLTERNLIERSLSRKVVHVLSGLLFMSSWPIF---------------------------  125

Query  588  iLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMAD  409
                             RELL+GPLYY + +     V+WR SP+ +  +  +  GDG AD
Sbjct  126  -----------------RELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFAD  168

Query  408  IIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG----QLEKTPHMVLGF  241
            I+GRR  + KLP+N+ KS+ GSI+M  FGF  SIG ++YFS+FG      +K    V   
Sbjct  169  ILGRRYGATKLPYNRQKSWIGSISMFIFGFFFSIGMLYYFSAFGCFHLDWDKAVERV---  225

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
             VVSLAA +VES P++  +DDN++VPL S+L  S +F
Sbjct  226  AVVSLAATVVESLPVTEFVDDNISVPLTSMLTASLLF  262



>ref|XP_007514499.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14739.1| predicted protein [Bathycoccus prasinos]
Length=345

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 128/229 (56%), Gaps = 19/229 (8%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++E+A+R   +  L+RKLVHV+ G  F + W +F         A L+P L  F+L  +G 
Sbjct  120  FDELARREILEAKLSRKLVHVTSGTFFAMTWCLFGDQWYSKAFATLVPSLQAFRLFAIGS  179

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
            G++++   V+++SR G   ELL GP YY I + +   ++WR SP+   +V  +C GDG+A
Sbjct  180  GLIENKNAVRAVSRGGGKEELLYGPFYYTIVLMVTTLLFWRESPVGFLVVSLMCGGDGVA  239

Query  411  DIIGRRI-----RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL  247
            DI+GRR+     + PK P ++ KSFAGS AM   GFL ++   H F   G      + V 
Sbjct  240  DIVGRRLGKTGKKWPK-PFDERKSFAGSAAMVITGFLFTVSLTHLFGVMGFFPN--NRVF  296

Query  246  G----------FLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
            G           L+  L+ A+VE+ P ++++DDN++V   + L GS  F
Sbjct  297  GGPDDIGYYAVILLACLSCAVVEALP-ASKVDDNISVAAVAALLGSLAF  344



>ref|XP_008218941.1| PREDICTED: probable phytol kinase 1, chloroplastic isoform X2 
[Prunus mume]
Length=239

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R    Q+L+RKLVH+  G++FML WP+FS+       A+++P +N  +LLL GL
Sbjct  92   FDNLTQRNLLQQSLSRKLVHILSGLLFMLSWPIFSTSTAARYFASVVPLVNCLRLLLHGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I+ ++G VKS++R G+ +ELL+GPLYY + + L   V+WR SP+ +  +  +C GDG+A
Sbjct  152  SIVTNEGLVKSVTREGNPKELLRGPLYYVLILILCALVFWRESPVGVVSLAMMCGGDGVA  211

Query  411  DIIGRRIRSPKLPHNKNKSFA  349
            DI+GR+  S K+P+N+ KS+A
Sbjct  212  DIMGRKFGSIKIPYNQKKSWA  232



>gb|EWM28810.1| Phosphatidate cytidylyltransferase [Nannochloropsis gaditana]
Length=344

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 119/229 (52%), Gaps = 23/229 (10%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W  +A  G  D   +RKL+H   G +F+LCWP FS+     L AA +P L I  ++  GL
Sbjct  115  WTSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARLFAAGVPLLQIVAMIASGL  174

Query  591  giL------------------KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRS  466
                                 K  G V ++SR G+  E+L+GPL Y + + LA  V+WR 
Sbjct  175  AKAPSPAKNDSGIRAGESAMGKPSGLVAAISRSGNPAEVLRGPLIYVVILLLATVVFWRE  234

Query  465  SPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
            S + +  V  + AGDGMADI+GRR  + K   +  KS+AGS A A  GF+ S+  + +F+
Sbjct  235  SVVGLVAVAQMAAGDGMADIVGRRWGAQKWSFSSTKSYAGSSAFALSGFVVSVALIAWFN  294

Query  285  SFGQLEK-TPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPL-ASVLA  145
             +G +   T  +     ++S+  A VE  P     DDN+ VP+ AS LA
Sbjct  295  FWGLVPALTAGVACKVALISILCAAVELVPWG---DDNIFVPMVASALA  340



>ref|XP_005854647.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
 gb|EKU21713.1| hypothetical protein NGA_2086500 [Nannochloropsis gaditana CCMP526]
Length=344

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 119/229 (52%), Gaps = 23/229 (10%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W  +A  G  D   +RKL+H   G +F+LCWP FS+     L AA +P L I  ++  GL
Sbjct  115  WTSLAISGAIDSKDSRKLIHCGSGPLFLLCWPFFSAEGTARLFAAGVPLLQIVAMIASGL  174

Query  591  giL------------------KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRS  466
                                 K  G V ++SR G+  E+L+GPL Y + + LA  V+WR 
Sbjct  175  AKAPSPAKNDSGIGAGESAMGKPSGLVAAISRSGNPAEVLRGPLIYVVILLLATVVFWRE  234

Query  465  SPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFS  286
            S + +  V  + AGDGMADI+GRR  + K   +  KS+AGS A A  GF+ S+  + +F+
Sbjct  235  SVVGLVAVAQMAAGDGMADIVGRRWGAQKWSFSSTKSYAGSSAFALSGFVVSVALIAWFN  294

Query  285  SFGQLEK-TPHMVLGFLVVSLAAALVESHPLSTELDDNLTVPL-ASVLA  145
             +G +   T  +     ++S+  A VE  P     DDN+ VP+ AS LA
Sbjct  295  FWGLVPALTAGVACKVALISILCAAVELVPWG---DDNIFVPMVASALA  340



>ref|XP_006653001.1| PREDICTED: probable phytol kinase 1, chloroplastic-like [Oryza 
brachyantha]
Length=194

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 113/188 (60%), Gaps = 1/188 (1%)
 Frame = -2

Query  690  MLCWPMFSSGRQGALVAAlipglnifkllllglgiLKDDGTVKSMSRFGDYRELLKGPLY  511
            M  WP+FS+       AA++P LN  +LL  GL +  D+  VKS++R G   ELL+GPLY
Sbjct  1    MSSWPLFSNSPGARFFAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLY  60

Query  510  YAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMA  331
            Y I + ++  V+WR SPI I  +  +  GDG ADI+GRR  S KLP NK KS+ GSI+M 
Sbjct  61   YVIVLLVSVLVFWRESPIGIISLSMMSGGDGFADIVGRRFGSMKLPFNKKKSWIGSISMF  120

Query  330  AFGFLASIGFMHYFSSFGQLEKT-PHMVLGFLVVSLAAALVESHPLSTELDDNLTVPLAS  154
              G+L S   + YFS  G         +    + +LAA +VE  P++  +DDN++VPLA+
Sbjct  121  ISGYLLSALMLFYFSCLGYFNVCWELALGKLALAALAATVVECIPVTDVVDDNISVPLAT  180

Query  153  VLAGSCIF  130
            +LA   +F
Sbjct  181  MLAAFLLF  188



>dbj|GAM20177.1| hypothetical protein SAMD00019534_033520, partial [Acytostelium 
subglobosum LB1]
Length=227

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 114/201 (57%), Gaps = 5/201 (2%)
 Frame = -2

Query  738  QNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVA-AlipglnifkllllglgiLKDDGTVK  562
            Q L+ + +H+  G V++ CW ++      A  A A++P   + +  L+GLG++KD+  VK
Sbjct  23   QTLSAQKIHIGTGFVYICCWGLYYKDDIYAKYAVAMVPAGVVLQFSLIGLGLIKDEKAVK  82

Query  561  SMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSP  382
            SMSR G   ELL GP+ Y I I L+  +YW  SPI I     LC GDG A ++G  I   
Sbjct  83   SMSRSGAPHELLYGPVTYGIVIVLSTIIYWVDSPIGITATSVLCCGDGFAGLVGEAIGKH  142

Query  381  KLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTPHMVL--GFLVVSLAAALVE  208
            +LP+NK+KS  G++A  A  F+ SI ++    S+G L +   +      L+V +   LVE
Sbjct  143  RLPYNKHKSMNGTMAFFAASFVGSIVYLMIIQSYGYLAQLSILAFIPSLLLVCIVCTLVE  202

Query  207  SHPLSTELDDNLTVPLASVLA  145
            S P+     DN+TV L+ V+A
Sbjct  203  SLPIDNW--DNVTVFLSCVVA  221



>ref|XP_005706670.1| phosphatidate cytidylyltransferase/ phytol kinase [Galdieria 
sulphuraria]
 gb|EME30150.1| phosphatidate cytidylyltransferase/ phytol kinase [Galdieria 
sulphuraria]
Length=332

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 115/214 (54%), Gaps = 7/214 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W+ +A + + ++ ++RK+VH++   +F+L WP F+    G+   A +  L +   L +  
Sbjct  117  WQWVASKNWIERTISRKIVHMTCTPLFVLTWPFFTDS-SGSRWVACLVPLIMGLRLWIAG  175

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
                 D   K +SR G   E LKGPLYY I   L     W+ SP+ I  +  LC GDG A
Sbjct  176  KGWSSDTISKIVSRKGSIEEALKGPLYYVIVTFLVTLFCWKDSPLGIVALMQLCLGDGFA  235

Query  411  DIIGRRI-RSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFG-QLEKTPHM-VLGF  241
            +++GRR  +S   P  ++KS  G++A +  GFLAS   + YF+  G +   T  +     
Sbjct  236  EVVGRRWGKSLTWPFCRDKSVIGTLAFSIAGFLASYCAVVYFNIVGMKFYGTEELSTFSL  295

Query  240  LVVSLAAALVESHPLSTELDDNLTVPLASVLAGS  139
            L+++LA + VE   L    DDN +VPL ++L G+
Sbjct  296  LIITLACSAVE---LVNFWDDNFSVPLMAILIGA  326



>ref|XP_008795888.1| PREDICTED: probable phytol kinase, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=278

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 93/143 (65%), Gaps = 0/143 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            ++ + +R   +++L+RK+VHV  G++FM  WP+FSS  +    AA +P +N  +L+  GL
Sbjct  92   FDTLTERNLIERSLSRKVVHVLSGLLFMSSWPIFSSSIEARYFAAFVPLVNCIRLVTYGL  151

Query  591  giLKDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMA  412
             I  D+G +KS++R G   ELL+GPLYY + +     V+WR SP+ +  +  +  GDG A
Sbjct  152  RIFSDEGLIKSVTREGKPEELLRGPLYYVVVLMFCSVVFWRDSPVGVVSLAMMSGGDGFA  211

Query  411  DIIGRRIRSPKLPHNKNKSFAGS  343
            DI+GRR  + KLP+N+ KS+ GS
Sbjct  212  DILGRRYGATKLPYNRQKSWIGS  234



>gb|KCW54678.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=185

 Score = 97.4 bits (241),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            +EE AKRG FDQ LNRKLVHVS G+VFMLCWP+FSSG +GAL+AALIPG+NI ++LLLG 
Sbjct  28   FEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPLFSSGHRGALLAALIPGVNIIRMLLLGS  87

Query  591  giLKDDGTVKSMSRFGDYR  535
            GI KD+ TVKSM+RFGD R
Sbjct  88   GIWKDEATVKSMTRFGDRR  106


 Score = 48.5 bits (114),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -3

Query  551  DLETTGNF*RGLYTMLSQSLWLVLSIGEVPQLQLP*FATSVLVTVWLTLSAGGSEARSFP  372
            D   +GNF +G Y+M SQS  L   IG + Q QL  +ATS    V  T S GG     FP
Sbjct  120  DRGESGNFLKGRYSMFSQSHLLARIIGGLRQSQLQQYATSAPEMVLRTSSEGGLANIKFP  179

Query  371  TTRTNP  354
            TT TNP
Sbjct  180  TTVTNP  185



>emb|CBJ48773.1| Probable phytol kinase, chloroplast precursor, carboxyterminal 
half [Ectocarpus siliculosus]
Length=308

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 113/221 (51%), Gaps = 7/221 (3%)
 Frame = -2

Query  771  WEEIAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllgl  592
            W  +A+R      ++RK+VH +   +FM+ WP F++     L AA +P L   +L   GL
Sbjct  86   WTGLARRDKMKPQVSRKVVHTTAAPLFMILWPFFTNRPCARLFAAAVPMLQAVRLAAAGL  145

Query  591  giLKDDGT------VKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLC  430
                ++        VK++SR G   E L GPL Y++ I L   V WR+S + +  +  + 
Sbjct  146  SGDPENNDSSSNELVKAISRSGKASETLDGPLKYSLAIVLITVVEWRTSVVGLIAMMQMA  205

Query  429  AGDGMADIIGRRIRSPKLPHNKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP-HM  253
             GDGMAD++GR+    K      KS  GS A  +  FLAS+  + +F  FG L  TP   
Sbjct  206  VGDGMADLVGRQFGKHKWRKGGEKSMEGSAAFVSGSFLASVAMIQWFHHFGLLSVTPTEA  265

Query  252  VLGFLVVSLAAALVESHPLSTELDDNLTVPLASVLAGSCIF  130
                  +S A+A VE  P     DDN++VP+ +++ G  +F
Sbjct  266  AARAAAISFASAAVELFPPRLVGDDNISVPVTALVLGRLLF  306



>ref|XP_004351203.1| hypothetical protein DFA_10953 [Dictyostelium fasciculatum]
 gb|EGG14695.1| hypothetical protein DFA_10953 [Dictyostelium fasciculatum]
Length=242

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -2

Query  726  RKLVHVSMGMVFMLCWPMFSSGRQGA-LVAAlipglnifkllllglgiLKDDGTVKSMSR  550
            RKLVH+  G+++++ W ++      + L  ++IP L  F+  L+G+G+LKD   V SMSR
Sbjct  37   RKLVHIGTGIIYVMSWGLYPINDPSSRLYCSIIPALVTFQFTLVGMGLLKDKKVVDSMSR  96

Query  549  FGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADIIGRRIRSPKLPH  370
             G+ RELL GP  Y I   L+  +YW +SP+ I  +  LC GDG A +IG      ++P+
Sbjct  97   SGNPRELLFGPATYGIIFVLSTIIYWANSPVGITALSLLCFGDGFAGLIGSEFGRARIPY  156

Query  369  NKNKSFAGSIAMAAFGFLASIGFMHYFSSFGQLEKTP--HMVLGFLVVSLAAALVESHPL  196
            N++K+  GS++   F  + S+  +    S+G L        +   +VVS+  A+VES P+
Sbjct  157  NRSKTIVGSVSFVIFSVVGSLMLLTIIQSYGYLIHFSLYAFIPSLIVVSIIGAIVESLPI  216

Query  195  STELDDNLTVPLASVLA  145
              E  DN+TV +  VL 
Sbjct  217  --EDWDNITVFMCCVLV  231



>ref|XP_005850569.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
 gb|EFN58467.1| hypothetical protein CHLNCDRAFT_140477 [Chlorella variabilis]
Length=286

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 117/246 (48%), Gaps = 45/246 (18%)
 Frame = -2

Query  762  IAKRGYFDQNLNRKLVHVSMGMVFMLCWPMFSSGRQGALVAAlipglnifkllllglgiL  583
            + + G     L RK++H+  G ++MLCWP++S+      +AA +P L   + +L+G GI+
Sbjct  31   VGRLGLLPTRLARKMMHIGTGPLYMLCWPLYSAAPSSRWLAASVPALAGVQFMLVGTGIV  90

Query  582  KDDGTVKSMSRFGDYRELLKGPLYYAITITLACAVYWRSSPIAIALVCNLCAGDGMADII  403
            +DD  V   SR G   ELL+GPL YA     A  ++WR SP  +  +  LCAGDG+A+++
Sbjct  91   RDDTLVAGASRSGRREELLRGPLLYAAVHVAATLIWWRHSPCGVLALAILCAGDGLAEVV  150

Query  402  GR--------------------------------RIRSPKLPHNKNKSFAGSIAMAAFGF  319
            GR                                R  +  LPHN +K+  G++A    G 
Sbjct  151  GRACSSAAASADAPARGGKKGSVDSGSTWRRSVLRALARPLPHNCDKTVGGTLACWLGGA  210

Query  318  LASIGFMHYFSSFGQ------------LEKTPHMVLGFLVVSLAAALVESHPLSTELDDN  175
             AS+  + YF   G             L+    +V G L+ S   AL ES PL  E  DN
Sbjct  211  AASLPLLLYFMRHGMFASAGPAAAGGVLQWGWPLVRGVLLCSGFGALAESLPLGGE-ADN  269

Query  174  LTVPLA  157
            +T+ LA
Sbjct  270  VTIALA  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310