BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017L05

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608692.1|  PREDICTED: V-type proton ATPase subunit H          203   1e-79   Nicotiana tomentosiformis
ref|XP_009792608.1|  PREDICTED: V-type proton ATPase subunit H          203   2e-79   Nicotiana sylvestris
ref|XP_011084696.1|  PREDICTED: V-type proton ATPase subunit H-like     203   3e-79   Sesamum indicum [beniseed]
ref|XP_006343605.1|  PREDICTED: V-type proton ATPase subunit H-li...    200   5e-78   Solanum tuberosum [potatoes]
ref|XP_004307846.1|  PREDICTED: V-type proton ATPase subunit H          201   6e-78   Fragaria vesca subsp. vesca
ref|XP_011077102.1|  PREDICTED: V-type proton ATPase subunit H-like     207   6e-78   Sesamum indicum [beniseed]
ref|XP_010251374.1|  PREDICTED: V-type proton ATPase subunit H          201   8e-78   Nelumbo nucifera [Indian lotus]
ref|XP_004242619.1|  PREDICTED: V-type proton ATPase subunit H          200   1e-77   Solanum lycopersicum
ref|XP_007156009.1|  hypothetical protein PHAVU_003G250900g             195   6e-77   Phaseolus vulgaris [French bean]
ref|XP_003548002.1|  PREDICTED: V-type proton ATPase subunit H-li...    194   1e-76   Glycine max [soybeans]
gb|KHN44512.1|  V-type proton ATPase subunit H                          194   1e-76   Glycine soja [wild soybean]
ref|XP_006858816.1|  hypothetical protein AMTR_s00066p00170500          197   1e-76   
ref|XP_008800912.1|  PREDICTED: probable V-type proton ATPase sub...    196   2e-76   Phoenix dactylifera
gb|KHN00570.1|  Protein DA1-related 1                                   196   3e-75   Glycine soja [wild soybean]
emb|CAD27445.1|  putative vacuolar ATPase subunit H                     197   3e-75   Mesembryanthemum crystallinum
gb|AFK35511.1|  unknown                                                 192   4e-75   Lotus japonicus
emb|CDX69032.1|  BnaC01g04210D                                          194   5e-75   
ref|XP_010912757.1|  PREDICTED: probable V-type proton ATPase sub...    194   5e-75   Elaeis guineensis
ref|XP_009115735.1|  PREDICTED: V-type proton ATPase subunit H-like     194   6e-75   Brassica rapa
ref|XP_010912758.1|  PREDICTED: probable V-type proton ATPase sub...    194   7e-75   
ref|XP_010912760.1|  PREDICTED: probable V-type proton ATPase sub...    194   9e-75   
gb|KCW59595.1|  hypothetical protein EUGRSUZ_H02340                     193   1e-74   Eucalyptus grandis [rose gum]
ref|XP_010023341.1|  PREDICTED: V-type proton ATPase subunit H          193   2e-74   Eucalyptus grandis [rose gum]
ref|XP_006574707.1|  PREDICTED: V-type proton ATPase subunit H-like     191   2e-74   Glycine max [soybeans]
ref|XP_008791823.1|  PREDICTED: probable V-type proton ATPase sub...    191   4e-74   Phoenix dactylifera
ref|XP_008791825.1|  PREDICTED: probable V-type proton ATPase sub...    191   4e-74   
gb|KFK33830.1|  hypothetical protein AALP_AA5G065600                    190   4e-74   Arabis alpina [alpine rockcress]
ref|XP_010437658.1|  PREDICTED: V-type proton ATPase subunit H-li...    191   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010432453.1|  PREDICTED: V-type proton ATPase subunit H-like     191   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010437659.1|  PREDICTED: V-type proton ATPase subunit H-li...    191   1e-73   
ref|XP_002869169.1|  vacuolar ATP synthase subunit H family protein     192   1e-73   
ref|XP_006283723.1|  hypothetical protein CARUB_v10004791mg             191   1e-73   Capsella rubella
ref|XP_010447124.1|  PREDICTED: V-type proton ATPase subunit H          191   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010930282.1|  PREDICTED: probable V-type proton ATPase sub...    186   7e-73   Elaeis guineensis
ref|XP_009416984.1|  PREDICTED: probable V-type proton ATPase sub...    186   7e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_189791.1|  V-type proton ATPase subunit H                        190   1e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20255.1|  AT3G42050                                              189   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59761.1|  AT3g42050/F4M19_10                                      189   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412262.1|  hypothetical protein EUTSA_v10025183mg             184   7e-72   
ref|XP_006657814.1|  PREDICTED: probable V-type proton ATPase sub...    187   1e-71   Oryza brachyantha
ref|XP_004957961.1|  PREDICTED: probable V-type proton ATPase sub...    186   1e-71   Setaria italica
gb|EMS54494.1|  putative V-type proton ATPase subunit H                 188   2e-71   Triticum urartu
ref|XP_010237225.1|  PREDICTED: probable V-type proton ATPase sub...    188   2e-71   Brachypodium distachyon [annual false brome]
gb|EMT32310.1|  Putative V-type proton ATPase subunit H                 187   2e-71   
sp|Q84ZC0.1|VATH_ORYSJ  RecName: Full=Probable V-type proton ATPa...    186   3e-71   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82241.1|  hypothetical protein OsI_26411                          186   3e-71   Oryza sativa Indica Group [Indian rice]
dbj|BAJ84958.1|  predicted protein                                      187   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460834.1|  hypothetical protein SORBIDRAFT_02g035880          185   7e-71   Sorghum bicolor [broomcorn]
tpg|DAA63056.1|  TPA: hypothetical protein ZEAMMB73_267119              184   2e-70   
ref|NP_001288363.1|  uncharacterized protein LOC103647744               184   2e-70   Zea mays [maize]
gb|ACF84665.1|  unknown                                                 184   3e-70   Zea mays [maize]
ref|NP_001146965.1|  vacuolar ATPase subunit H protein                  184   3e-70   Zea mays [maize]
gb|ABG75917.1|  vacuolar proton ATPase subunit H                        187   1e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009415033.1|  PREDICTED: probable V-type proton ATPase sub...    181   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX76266.1|  BnaA08g11340D                                          176   3e-69   
ref|XP_002453051.1|  hypothetical protein SORBIDRAFT_04g037430          182   7e-69   
emb|CDY57740.1|  BnaC03g77060D                                          174   1e-68   Brassica napus [oilseed rape]
tpg|DAA41086.1|  TPA: hypothetical protein ZEAMMB73_371057              185   2e-66   
gb|ABR17502.1|  unknown                                                 181   3e-66   Picea sitchensis
gb|AEG78652.1|  vacuolar H+-ATPase subunit H                            174   8e-62   Avena sativa [cultivated oat]
ref|XP_011044458.1|  PREDICTED: V-type proton ATPase subunit H is...    207   4e-60   Populus euphratica
emb|CDP04145.1|  unnamed protein product                                204   1e-59   Coffea canephora [robusta coffee]
ref|XP_011044454.1|  PREDICTED: V-type proton ATPase subunit H is...    207   1e-59   Populus euphratica
gb|KDP39537.1|  hypothetical protein JCGZ_02557                         205   2e-59   Jatropha curcas
gb|AIZ49542.1|  V-ATPase subunit H1                                     205   4e-59   Eriobotrya japonica [loquat]
ref|XP_008357071.1|  PREDICTED: V-type proton ATPase subunit H-like     205   4e-59   Malus domestica [apple tree]
ref|XP_002980222.1|  hypothetical protein SELMODRAFT_444469             164   5e-59   
ref|XP_009361140.1|  PREDICTED: V-type proton ATPase subunit H          204   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_002963102.1|  hypothetical protein SELMODRAFT_141399             163   8e-59   Selaginella moellendorffii
ref|XP_008234540.1|  PREDICTED: V-type proton ATPase subunit H          203   2e-58   Prunus mume [ume]
ref|XP_008343829.1|  PREDICTED: V-type proton ATPase subunit H-like     203   2e-58   
ref|XP_007217990.1|  hypothetical protein PRUPE_ppa005592mg             203   3e-58   Prunus persica
gb|EYU39750.1|  hypothetical protein MIMGU_mgv1a006219mg                202   4e-58   Erythranthe guttata [common monkey flower]
ref|XP_002325805.1|  putative vacuolar ATPase subunit H family pr...    201   1e-57   
gb|EYU39492.1|  hypothetical protein MIMGU_mgv1a006273mg                200   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_010662098.1|  PREDICTED: V-type proton ATPase subunit H          200   3e-57   Vitis vinifera
ref|XP_010087456.1|  V-type proton ATPase subunit H                     200   3e-57   Morus notabilis
ref|XP_001756205.1|  predicted protein                                  159   3e-57   
emb|CBI26482.3|  unnamed protein product                                201   4e-57   Vitis vinifera
ref|XP_006437440.1|  hypothetical protein CICLE_v10031531mg             199   5e-57   
gb|KJB26714.1|  hypothetical protein B456_004G256400                    197   5e-57   Gossypium raimondii
ref|XP_007029672.1|  Vacuolar ATP synthase subunit H family prote...    197   6e-56   
ref|XP_007029671.1|  Vacuolar ATP synthase subunit H family prote...    197   7e-56   
gb|EPS61013.1|  hypothetical protein M569_13786                         196   7e-56   Genlisea aurea
ref|XP_006484607.1|  PREDICTED: V-type proton ATPase subunit H-li...    196   9e-56   Citrus sinensis [apfelsine]
gb|KHG22602.1|  V-type proton ATPase subunit H -like protein            197   1e-55   Gossypium arboreum [tree cotton]
gb|KJB18498.1|  hypothetical protein B456_003G056300                    196   1e-55   Gossypium raimondii
gb|KJB26715.1|  hypothetical protein B456_004G256400                    197   1e-55   Gossypium raimondii
ref|XP_010526971.1|  PREDICTED: V-type proton ATPase subunit H-like     194   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_003629515.1|  V-type proton ATPase subunit H                     194   6e-55   
ref|XP_004509230.1|  PREDICTED: V-type proton ATPase subunit H-li...    194   1e-54   Cicer arietinum [garbanzo]
ref|XP_010547995.1|  PREDICTED: V-type proton ATPase subunit H          194   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_002520072.1|  vacuolar ATP synthase subunit h, putative          193   1e-54   
gb|AET03991.2|  vacuolar H+-ATPase subunit H, putative                  194   2e-54   Medicago truncatula
ref|XP_004136630.1|  PREDICTED: V-type proton ATPase subunit H-like     192   2e-54   Cucumis sativus [cucumbers]
ref|XP_006437446.1|  hypothetical protein CICLE_v10032936mg             184   4e-54   
gb|ACJ85007.1|  unknown                                                 192   4e-54   Medicago truncatula
ref|XP_008443235.1|  PREDICTED: V-type proton ATPase subunit H          192   4e-54   Cucumis melo [Oriental melon]
ref|XP_009615905.1|  PREDICTED: V-type proton ATPase subunit H-like     187   5e-54   Nicotiana tomentosiformis
ref|XP_001761877.1|  predicted protein                                  147   6e-54   
gb|ACN34691.1|  unknown                                                 184   6e-54   Zea mays [maize]
emb|CDX72455.1|  BnaC07g44770D                                          189   3e-53   
emb|CDY49280.1|  BnaA03g50930D                                          189   3e-53   Brassica napus [oilseed rape]
ref|XP_009138267.1|  PREDICTED: V-type proton ATPase subunit H          189   3e-53   Brassica rapa
ref|XP_010673864.1|  PREDICTED: V-type proton ATPase subunit H          188   1e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO65974.1|  putative vacuolar ATPase subunit H protein              187   3e-52   Suaeda salsa
ref|XP_004251740.1|  PREDICTED: V-type proton ATPase subunit H-like     182   3e-50   Solanum lycopersicum
ref|XP_006350112.1|  PREDICTED: V-type proton ATPase subunit H-like     181   6e-50   Solanum tuberosum [potatoes]
gb|ABF50108.1|  vacuolar ATPase subunit H                               169   2e-49   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002319248.2|  hypothetical protein POPTR_0013s07630g             177   5e-49   
ref|XP_009778019.1|  PREDICTED: V-type proton ATPase subunit H-like     170   2e-46   Nicotiana sylvestris
ref|XP_006855968.1|  hypothetical protein AMTR_s00037p00233030          152   4e-42   
ref|XP_002955475.1|  vacuolar ATP synthase, subunit H                   109   4e-36   Volvox carteri f. nagariensis
ref|XP_001689562.1|  vacuolar ATP synthase subunit H                    109   1e-35   Chlamydomonas reinhardtii
ref|XP_005646211.1|  vacuolar ATP synthase subunit H                    108   5e-34   Coccomyxa subellipsoidea C-169
ref|XP_006437443.1|  hypothetical protein CICLE_v10033985mg             123   2e-31   
gb|KDO49208.1|  hypothetical protein CISIN_1g0474481mg                  119   3e-30   Citrus sinensis [apfelsine]
gb|KDO40338.1|  hypothetical protein CISIN_1g034103mg                   119   8e-30   Citrus sinensis [apfelsine]
gb|KDO40336.1|  hypothetical protein CISIN_1g034106mg                   118   9e-30   Citrus sinensis [apfelsine]
gb|KDO40334.1|  hypothetical protein CISIN_1g034108mg                   117   3e-29   Citrus sinensis [apfelsine]
emb|CAG27620.1|  putative vacuolar ATPase subunit H                     114   4e-28   Populus deltoides x Populus maximowiczii
ref|XP_007029673.1|  Vacuolar ATP synthase subunit H family prote...    116   8e-27   
ref|XP_002500993.1|  H+-or Na+-translocating f-type, v-type and A...  87.0    1e-26   Micromonas commoda
ref|XP_002680972.1|  vacuolar ATP synthase subunit H                  94.0    3e-26   Naegleria gruberi strain NEG-M
emb|CDO69013.1|  hypothetical protein BN946_scf184834.g20             91.3    3e-25   Trametes cinnabarina
ref|XP_008869403.1|  hypothetical protein H310_06210                  87.0    6e-25   Aphanomyces invadans
ref|XP_011500008.1|  PREDICTED: V-type proton ATPase subunit H        84.3    9e-25   Ceratosolen solmsi marchali
ref|XP_008901144.1|  hypothetical protein PPTG_07998                  86.3    2e-24   Phytophthora parasitica INRA-310
gb|EFN88781.1|  Vacuolar proton pump subunit H                        85.9    2e-24   Harpegnathos saltator
ref|XP_011150661.1|  PREDICTED: V-type proton ATPase subunit H is...  85.9    3e-24   Harpegnathos saltator
dbj|GAM29018.1|  hypothetical protein SAMD00019534_121940             87.0    3e-24   Acytostelium subglobosum LB1
ref|XP_011150670.1|  PREDICTED: V-type proton ATPase subunit H is...  85.5    3e-24   Harpegnathos saltator
ref|XP_011302355.1|  PREDICTED: V-type proton ATPase subunit H is...  86.7    3e-24   Fopius arisanus
ref|XP_011302354.1|  PREDICTED: V-type proton ATPase subunit H is...  86.7    3e-24   Fopius arisanus
ref|XP_002909335.1|  V-type proton ATPase subunit H, putative         84.7    5e-24   Phytophthora infestans T30-4
ref|XP_007863478.1|  ATPase, V1 complex, subunit H                    84.0    5e-24   Gloeophyllum trabeum ATCC 11539
ref|XP_009529196.1|  hypothetical protein PHYSODRAFT_505321           82.8    6e-24   Phytophthora sojae
gb|KFO20474.1|  V-type proton ATPase subunit H                        93.2    7e-24   Fukomys damarensis [Damara mole rat]
ref|XP_008547204.1|  PREDICTED: V-type proton ATPase subunit H is...  84.3    2e-23   Microplitis demolitor
gb|KIP10325.1|  hypothetical protein PHLGIDRAFT_125667                87.4    2e-23   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_008547205.1|  PREDICTED: V-type proton ATPase subunit H is...  84.3    2e-23   Microplitis demolitor
ref|XP_009308551.1|  ATP synthase                                     83.2    3e-23   Trypanosoma grayi
ref|XP_007321482.1|  hypothetical protein SERLADRAFT_474431           89.7    4e-23   Serpula lacrymans var. lacrymans S7.9
gb|EKF99745.1|  ATP synthase, putative                                84.7    4e-23   Trypanosoma cruzi
ref|XP_007338813.1|  ATPase, V1 complex, subunit H                    86.7    4e-23   
gb|KIM53725.1|  hypothetical protein SCLCIDRAFT_1222591               84.3    4e-23   Scleroderma citrinum Foug A
gb|KFM65821.1|  V-type proton ATPase subunit H                        85.1    5e-23   Stegodyphus mimosarum
ref|NP_001016182.1|  V-type proton ATPase subunit H                   91.7    7e-23   Xenopus tropicalis [western clawed frog]
gb|ERE85970.1|  V-type proton ATPase subunit H                        90.1    8e-23   Cricetulus griseus [Chinese hamsters]
gb|EGW09777.1|  V-type proton ATPase subunit H                        89.7    9e-23   Cricetulus griseus [Chinese hamsters]
gb|AFN11665.1|  vacuolar ATPase subunit H                             84.7    9e-23   Locusta migratoria manilensis
ref|XP_811617.1|  ATP synthase                                        83.2    1e-22   Trypanosoma cruzi strain CL Brener
gb|EKF31005.1|  ATP synthase, putative                                83.2    1e-22   Trypanosoma cruzi marinkellei
ref|XP_004329545.1|  PREDICTED: V-type proton ATPase subunit H-like   90.9    1e-22   
gb|KIM87633.1|  hypothetical protein PILCRDRAFT_815209                82.4    1e-22   Piloderma croceum F 1598
sp|Q9TVC1.1|VATH_PIG  RecName: Full=V-type proton ATPase subunit ...  90.9    1e-22   Sus scrofa [pigs]
gb|EPZ30805.1|  V-type proton ATPase subunit H-like protein           83.2    1e-22   Rozella allomycis CSF55
ref|NP_999405.1|  V-type proton ATPase subunit H                      90.9    1e-22   Sus scrofa [pigs]
gb|KIK18316.1|  hypothetical protein PISMIDRAFT_14479                 84.7    1e-22   Pisolithus microcarpus 441
ref|XP_820568.1|  ATP synthase                                        84.7    2e-22   Trypanosoma cruzi strain CL Brener
ref|XP_006924025.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Pteropus alecto
ref|XP_006924026.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_006994248.1|  PREDICTED: V-type proton ATPase subunit H-li...  90.5    2e-22   Peromyscus maniculatus bairdii
ref|XP_007090621.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Panthera tigris altaica
ref|XP_007090622.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Panthera tigris altaica
ref|XP_006495498.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_003999861.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Felis catus [cat]
gb|AFM90690.1|  ATPase, H+ transporting, lysosomal, V1 subunit H      90.5    2e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_004679936.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Condylura cristata
gb|ELK02307.1|  V-type proton ATPase subunit H                        90.1    2e-22   Pteropus alecto
ref|XP_004479904.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Dasypus novemcinctus
ref|XP_005613222.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Equus caballus [domestic horse]
ref|XP_005215461.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Bos taurus [bovine]
ref|XP_006994249.1|  PREDICTED: V-type proton ATPase subunit H-li...  90.5    2e-22   Peromyscus maniculatus bairdii
ref|XP_006077050.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Bubalus bubalis [domestic water buffalo]
ref|XP_544082.2|  PREDICTED: V-type proton ATPase subunit H isofo...  90.1    2e-22   Canis lupus familiaris [dogs]
ref|XP_005892054.1|  PREDICTED: V-type proton ATPase subunit H-like   90.5    2e-22   Bos mutus
ref|XP_006769145.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Myotis davidii
ref|XP_004602396.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Sorex araneus [Eurasian shrew]
ref|XP_004011727.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Ovis aries [domestic sheep]
ref|XP_004602395.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Sorex araneus [Eurasian shrew]
ref|XP_004011726.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Ovis aries [domestic sheep]
ref|XP_007105305.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Physeter catodon
sp|O46563.2|VATH_BOVIN  RecName: Full=V-type proton ATPase subuni...  90.1    2e-22   Bos taurus [bovine]
ref|XP_004275066.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Orcinus orca [Orca]
ref|XP_005638031.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Canis lupus familiaris [dogs]
ref|XP_010586613.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Loxodonta africana [African bush elephant]
ref|XP_006495502.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Mus musculus [mouse]
ref|XP_003975495.1|  PREDICTED: V-type proton ATPase subunit H-like   89.7    2e-22   Takifugu rubripes [tiger puffer]
ref|XP_008141569.1|  PREDICTED: V-type proton ATPase subunit H        90.1    2e-22   Eptesicus fuscus
ref|XP_004697612.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004410073.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Odobenus rosmarus divergens
gb|ADI40571.1|  lysosomal H+-transporting ATPase V1 subunit H         90.1    2e-22   Scotophilus kuhlii
ref|XP_004410075.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Odobenus rosmarus divergens
tpg|DAA22751.1|  TPA: V-type proton ATPase subunit H                  90.5    2e-22   Bos taurus [bovine]
ref|XP_010586612.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_005638032.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_008253747.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007516038.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Erinaceus europaeus [common hedgehog]
ref|XP_005362304.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Microtus ochrogaster [prairie voles]
ref|XP_004435755.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
gb|ADI40572.1|  lysosomal H+-transporting ATPase V1 subunit H         90.1    2e-22   Miniopterus schreibersii [Common bent-wing bat]
ref|XP_003999862.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_004410076.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Odobenus rosmarus divergens
ref|XP_005966485.1|  PREDICTED: V-type proton ATPase subunit H        90.5    2e-22   
ref|XP_007950398.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Orycteropus afer afer
ref|XP_005857374.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Myotis brandtii
ref|XP_003793748.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_008542739.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Equus przewalskii [Przewalski horse]
ref|XP_006900599.1|  PREDICTED: V-type proton ATPase subunit H-like   90.1    2e-22   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004375664.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_004375665.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Trichechus manatus latirostris
ref|XP_006871918.1|  PREDICTED: V-type proton ATPase subunit H-li...  90.1    2e-22   Chrysochloris asiatica
ref|XP_006745755.1|  PREDICTED: V-type proton ATPase subunit H        90.5    2e-22   Leptonychotes weddellii
ref|XP_004479905.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Dasypus novemcinctus
ref|XP_006237863.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Rattus norvegicus [brown rat]
ref|XP_006140948.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Tupaia chinensis
ref|XP_003408364.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Loxodonta africana [African bush elephant]
ref|XP_007464083.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Lipotes vexillifer [baiji]
ref|XP_004479906.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
gb|ELK26175.1|  V-type proton ATPase subunit H                        90.5    2e-22   Myotis davidii
ref|XP_007168671.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Balaenoptera acutorostrata scammoni
ref|XP_004887507.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_007090623.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Panthera tigris altaica
ref|XP_010586611.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Loxodonta africana [African bush elephant]
ref|XP_007904109.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_008842646.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_005085988.1|  PREDICTED: V-type proton ATPase subunit H        90.5    2e-22   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005322961.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Ictidomys tridecemlineatus
gb|AAH09154.1|  ATPase, H+ transporting, lysosomal V1 subunit H       90.1    2e-22   Mus musculus [mouse]
ref|XP_006495497.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_004679937.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Condylura cristata
ref|XP_002758941.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Callithrix jacchus [common marmoset]
ref|XP_004633431.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Octodon degus
ref|XP_003793747.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Otolemur garnettii
ref|XP_008842643.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Nannospalax galili
ref|NP_598587.2|  V-type proton ATPase subunit H                      90.1    2e-22   Mus musculus [mouse]
ref|NP_001279139.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...  90.5    2e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_004435757.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_004653416.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Jaculus jaculus
ref|XP_006237866.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Rattus norvegicus [brown rat]
ref|XP_007464084.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Lipotes vexillifer [baiji]
ref|XP_007998823.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Chlorocebus sabaeus
ref|XP_010609402.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Fukomys damarensis [Damara mole rat]
ref|XP_004887509.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   
ref|XP_003734984.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Callithrix jacchus [common marmoset]
ref|XP_007516039.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_006077052.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Bubalus bubalis [domestic water buffalo]
ref|XP_005362305.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Microtus ochrogaster [prairie voles]
ref|XP_003902802.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Papio anubis [baboon]
emb|CAG12279.1|  unnamed protein product                              89.7    2e-22   Tetraodon nigroviridis
ref|XP_008253748.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007105306.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Physeter catodon
ref|XP_007950399.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Orycteropus afer afer
ref|XP_005857375.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Myotis brandtii
ref|XP_005613224.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Equus caballus [domestic horse]
ref|XP_004697613.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004275067.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
ref|XP_007168672.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Balaenoptera acutorostrata scammoni
ref|XP_006769146.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Myotis davidii
ref|XP_005322963.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Ictidomys tridecemlineatus
ref|NP_998785.1|  V-type proton ATPase subunit H isoform 1            90.1    2e-22   Homo sapiens [man]
ref|XP_005396122.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Chinchilla lanigera
gb|AAD27720.1|AF132945_1  CGI-11 protein                              90.1    2e-22   Homo sapiens [man]
ref|XP_005396120.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Chinchilla lanigera
ref|XP_003940899.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Saimiri boliviensis boliviensis
ref|XP_004653417.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Jaculus jaculus
dbj|BAG53609.1|  unnamed protein product                              90.5    2e-22   Homo sapiens [man]
ref|XP_006495500.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Mus musculus [mouse]
ref|XP_008842645.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    2e-22   Nannospalax galili
ref|NP_001270161.1|  uncharacterized protein LOC101926423             90.5    2e-22   Macaca fascicularis [crab eating macaque]
ref|XP_008761746.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Rattus norvegicus [brown rat]
ref|XP_008542740.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Equus przewalskii [Przewalski horse]
gb|EHH28502.1|  V-type proton ATPase subunit H                        90.1    2e-22   Macaca mulatta [rhesus macaque]
ref|NP_001126091.1|  V-type proton ATPase subunit H                   90.5    2e-22   Pongo abelii [orang utan]
ref|NP_998784.1|  V-type proton ATPase subunit H isoform 2            90.5    2e-22   Homo sapiens [man]
ref|XP_003506606.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Cricetulus griseus [Chinese hamsters]
ref|NP_001089309.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...  89.7    2e-22   Xenopus laevis [clawed frog]
ref|XP_004633432.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   Octodon degus
ref|XP_003793749.1|  PREDICTED: V-type proton ATPase subunit H is...  89.7    2e-22   
ref|XP_006495499.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-22   
gb|EAW86730.1|  ATPase, H+ transporting, lysosomal 50/57kDa, V1 s...  90.1    3e-22   
ref|XP_007645254.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    3e-22   
gb|EPT05401.1|  ATPase V1 complex subunit H                           81.3    3e-22   
ref|XP_003466039.2|  PREDICTED: V-type proton ATPase subunit H        90.1    3e-22   
dbj|BAG64316.1|  unnamed protein product                              90.1    3e-22   
ref|XP_003759824.1|  PREDICTED: V-type proton ATPase subunit H        89.7    3e-22   
ref|XP_002079663.1|  GD21903                                          83.6    3e-22   
gb|ESA21230.1|  hypothetical protein GLOINDRAFT_343254                81.6    3e-22   
dbj|BAN20615.1|  vacuolar H[+] ATPase subunit                         82.0    3e-22   
ref|XP_001965291.1|  GF24362                                          83.6    3e-22   
ref|XP_009453663.1|  PREDICTED: V-type proton ATPase subunit H        90.1    3e-22   
gb|ELW71992.1|  V-type proton ATPase subunit H                        89.7    3e-22   
gb|KDD71741.1|  V-ATPase subunit H                                    78.2    3e-22   
emb|CCC93300.1|  putative ATP synthase                                80.9    3e-22   
ref|XP_002038845.1|  GM17165                                          83.6    3e-22   
gb|AAC02987.1|  vacuolar proton pump subunit SFD alpha isoform        89.7    3e-22   
gb|EXX71257.1|  Vma13p                                                81.6    3e-22   
ref|XP_008048661.1|  PREDICTED: V-type proton ATPase subunit H        89.7    3e-22   
ref|XP_001988830.1|  GH10362                                          83.6    3e-22   
ref|NP_723992.1|  vacuolar H[+]-ATPase SFD subunit, isoform B         83.6    3e-22   
gb|AAC02986.1|  vacuolar proton pump subunit SFD beta isoform         89.7    3e-22   
gb|KDQ33755.1|  hypothetical protein PLEOSDRAFT_1052588               82.8    3e-22   
ref|XP_002014753.1|  GL19340                                          83.6    4e-22   
ref|XP_002003753.1|  GI21354                                          83.6    4e-22   
ref|XP_010214153.1|  PREDICTED: V-type proton ATPase subunit H        89.7    4e-22   
ref|XP_008495780.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    4e-22   
ref|XP_002736386.1|  PREDICTED: V-type proton ATPase subunit H-like   90.1    4e-22   
gb|AHM92104.1|  vATPase subunit H                                     85.5    4e-22   
gb|KGL78057.1|  V-type proton ATPase subunit H                        89.4    4e-22   
ref|XP_010185105.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    4e-22   
ref|XP_008495781.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    4e-22   
ref|XP_010185106.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    4e-22   
ref|NP_523585.2|  vacuolar H[+]-ATPase SFD subunit, isoform A         83.6    4e-22   
ref|XP_009671845.1|  PREDICTED: V-type proton ATPase subunit H        89.4    5e-22   
ref|XP_009838905.1|  hypothetical protein H257_13146                  75.5    5e-22   
ref|XP_007428279.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    5e-22   
ref|XP_005993507.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    5e-22   
sp|Q9U5N0.1|VATH_MANSE  RecName: Full=V-type proton ATPase subuni...  78.6    5e-22   
ref|NP_723993.1|  vacuolar H[+]-ATPase SFD subunit, isoform D         83.6    5e-22   
emb|CCO31419.1|  V-type H+-transporting ATPase 54 kD subunit          79.7    5e-22   
gb|KDR12485.1|  V-type proton ATPase subunit H                        85.1    6e-22   
ref|XP_005993508.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    6e-22   
ref|XP_006112245.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    6e-22   
ref|XP_002808526.1|  PREDICTED: LOW QUALITY PROTEIN: v-type proto...  89.7    6e-22   
ref|XP_006191105.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    6e-22   
ref|XP_010014842.1|  PREDICTED: V-type proton ATPase subunit H        88.2    6e-22   
ref|XP_006112246.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    6e-22   
ref|XP_005301264.1|  PREDICTED: V-type proton ATPase subunit H        88.6    6e-22   
ref|XP_010987846.1|  PREDICTED: V-type proton ATPase subunit H        90.5    6e-22   
ref|XP_007064175.1|  PREDICTED: V-type proton ATPase subunit H        88.6    6e-22   
emb|CCI49390.1|  unnamed protein product                              78.6    7e-22   
ref|XP_008217755.1|  PREDICTED: V-type proton ATPase subunit H is...  76.3    7e-22   
ref|XP_008217756.1|  PREDICTED: V-type proton ATPase subunit H is...  76.3    7e-22   
ref|XP_002064801.1|  GK15126                                          82.4    7e-22   
ref|XP_009078245.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    7e-22   
ref|XP_003425170.1|  PREDICTED: V-type proton ATPase subunit H is...  76.3    7e-22   
ref|XP_010968999.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  90.1    7e-22   
ref|XP_003428501.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    7e-22   
ref|XP_001949116.3|  PREDICTED: V-type proton ATPase subunit H        85.9    7e-22   
ref|XP_006191106.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    7e-22   
gb|ESL11474.1|  ATP synthase                                          80.1    7e-22   
ref|XP_009078254.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    7e-22   
gb|ETE73254.1|  V-type proton ATPase subunit H                        88.6    8e-22   
gb|EMP31779.1|  V-type proton ATPase subunit H                        88.6    8e-22   
ref|XP_001515221.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    8e-22   
emb|CCA18464.1|  Vtype proton ATPase subunit H putative               76.6    8e-22   
emb|CAB39532.1|  54 kDa vacuolar H(+)-ATPase subunit                  88.6    8e-22   
ref|XP_001605466.1|  PREDICTED: V-type proton ATPase subunit H is...  75.9    8e-22   
ref|XP_009499916.1|  PREDICTED: V-type proton ATPase subunit H        88.2    8e-22   
ref|XP_009860941.1|  PREDICTED: V-type proton ATPase subunit H is...  83.6    9e-22   
ref|XP_003224355.1|  PREDICTED: V-type proton ATPase subunit H        88.2    9e-22   
ref|XP_002123830.1|  PREDICTED: V-type proton ATPase subunit H is...  83.2    1e-21   
emb|CEL55783.1|  V-type H+-transporting ATPase 54 kD subunit          79.7    1e-21   
ref|XP_010707226.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_002051650.1|  GJ11146                                          82.0    1e-21   
ref|XP_004079489.1|  PREDICTED: V-type proton ATPase subunit H is...  90.5    1e-21   
ref|XP_009478934.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_010141561.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_010789726.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    1e-21   
ref|XP_006023922.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_009935988.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_009901987.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_010125506.1|  PREDICTED: V-type proton ATPase subunit H        87.8    1e-21   
ref|XP_822331.1|  ATP synthase                                        81.6    1e-21   
ref|NP_001133475.1|  Vacuolar proton pump subunit H                   90.1    1e-21   
ref|XP_008938694.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_009946371.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
gb|EPY76341.1|  V-type proton ATPase subunit H                        89.7    1e-21   
ref|XP_005152605.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_009935989.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_009925475.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_005418370.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_005042123.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_011485363.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    1e-21   
emb|CBH14994.1|  ATP synthase, putative                               81.6    1e-21   
ref|XP_011049528.1|  PREDICTED: V-type proton ATPase subunit H-like   76.6    1e-21   
ref|XP_008643145.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_002197593.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_009568732.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_005479350.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_010285565.1|  PREDICTED: V-type proton ATPase subunit H        87.8    1e-21   
ref|XP_009984629.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_005240812.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|XP_009925491.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    1e-21   
ref|XP_009287620.1|  PREDICTED: V-type proton ATPase subunit H        87.4    1e-21   
ref|NP_001184255.1|  V-type proton ATPase subunit H                   87.4    1e-21   
ref|XP_010199764.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|XP_010789727.1|  PREDICTED: V-type proton ATPase subunit H is...  90.1    2e-21   
ref|XP_009638644.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_005025556.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_005025557.1|  PREDICTED: V-type proton ATPase subunit H is...  87.8    2e-21   
gb|EOA97074.1|  Vacuolar proton pump subunit H                        87.4    2e-21   
gb|KIJ17095.1|  hypothetical protein PAXINDRAFT_111825                77.0    2e-21   
gb|EMC87078.1|  V-type proton ATPase subunit H                        87.4    2e-21   
ref|XP_006259999.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|NP_777129.2|  V-type proton ATPase subunit H                      90.1    2e-21   
ref|XP_009984630.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_009575443.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|XP_010169924.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_009969574.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|XP_009811839.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|XP_005506565.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_011168339.1|  PREDICTED: V-type proton ATPase subunit H-like   76.6    2e-21   
ref|XP_009638645.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_009706097.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
ref|XP_009925501.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_003438111.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
ref|XP_008285726.1|  PREDICTED: V-type proton ATPase subunit H        89.7    2e-21   
ref|XP_005025558.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_006634089.1|  PREDICTED: V-type proton ATPase subunit H-like   87.4    2e-21   
ref|XP_005742564.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
ref|XP_004542994.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
ref|XP_006023923.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_009925483.1|  PREDICTED: V-type proton ATPase subunit H is...  87.4    2e-21   
ref|XP_010727568.1|  PREDICTED: V-type proton ATPase subunit H is...  89.7    2e-21   
ref|XP_008921674.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  87.4    2e-21   
gb|ETN60671.1|  ATPase SFD subunit                                    82.0    2e-21   
ref|XP_010152360.1|  PREDICTED: V-type proton ATPase subunit H        87.4    2e-21   
gb|KII88913.1|  hypothetical protein PLICRDRAFT_40550                 82.0    2e-21   
ref|XP_005476564.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
gb|ENN77808.1|  hypothetical protein YQE_05692                        81.3    2e-21   
ref|XP_010727569.1|  PREDICTED: V-type proton ATPase subunit H is...  89.7    2e-21   
ref|XP_004542995.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
ref|XP_005742565.1|  PREDICTED: V-type proton ATPase subunit H-li...  89.7    2e-21   
ref|XP_011329949.1|  PREDICTED: V-type proton ATPase subunit H is...  76.3    2e-21   
ref|XP_011329950.1|  PREDICTED: V-type proton ATPase subunit H is...  76.3    2e-21   
gb|ACI34030.1|  Vacuolar proton pump subunit H                        89.4    2e-21   
ref|XP_010864266.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    2e-21   
gb|KFB39891.1|  vacuolar ATP synthase subunit h                       82.0    2e-21   
gb|EFZ22256.1|  hypothetical protein SINV_08430                       76.6    2e-21   
gb|ERL95136.1|  hypothetical protein D910_12406                       81.3    2e-21   
gb|AEE62279.1|  unknown                                               80.9    2e-21   
gb|KIO04112.1|  hypothetical protein M404DRAFT_144318                 79.3    3e-21   
ref|XP_007548603.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    3e-21   
ref|XP_007487188.1|  PREDICTED: V-type proton ATPase subunit H is...  86.7    3e-21   
ref|XP_010864268.1|  PREDICTED: V-type proton ATPase subunit H is...  89.4    3e-21   
ref|XP_004333409.1|  vacuolar atp synthase subunit h, putative        78.6    3e-21   
ref|XP_007487189.1|  PREDICTED: V-type proton ATPase subunit H is...  86.7    3e-21   
gb|EFX87781.1|  hypothetical protein DAPPUDRAFT_306505                81.6    3e-21   
ref|XP_007548605.1|  PREDICTED: V-type proton ATPase subunit H is...  88.6    3e-21   
ref|XP_003291419.1|  hypothetical protein DICPUDRAFT_156018           82.8    3e-21   
gb|ERL95137.1|  hypothetical protein D910_12406                       81.3    3e-21   
ref|XP_310211.4|  AGAP009486-PA                                       81.6    3e-21   
gb|EPY36528.1|  V-type H+-transporting ATPase 54 kD subunit           81.6    4e-21   
ref|XP_003394807.1|  PREDICTED: v-type proton ATPase subunit H-li...  75.5    4e-21   
ref|XP_005845340.1|  hypothetical protein CHLNCDRAFT_32265            75.9    4e-21   
ref|XP_003394806.1|  PREDICTED: v-type proton ATPase subunit H-li...  75.5    4e-21   
emb|CCW70353.1|  unnamed protein product                              87.0    4e-21   
ref|NP_001280516.1|  V-type proton ATPase subunit H                   80.9    4e-21   
ref|XP_006624435.1|  PREDICTED: V-type proton ATPase subunit H-li...  75.5    4e-21   
ref|XP_003251675.1|  PREDICTED: V-type proton ATPase subunit H is...  75.5    4e-21   
ref|XP_007513975.1|  V-type proton ATPase subunit H                   75.5    4e-21   
ref|XP_003251676.1|  PREDICTED: V-type proton ATPase subunit H is...  75.5    4e-21   
ref|XP_003692426.1|  PREDICTED: V-type proton ATPase subunit H-like   75.5    5e-21   
ref|XP_006624436.1|  PREDICTED: V-type proton ATPase subunit H-li...  75.5    5e-21   
ref|NP_001278637.1|  V-type proton ATPase subunit H isoform 1         87.0    5e-21   
ref|XP_966693.3|  PREDICTED: V-type proton ATPase subunit H isofo...  80.9    5e-21   
ref|XP_006624437.1|  PREDICTED: V-type proton ATPase subunit H-li...  75.5    5e-21   
gb|AAM34678.1|AF506234_1  vacuolar ATP synthase subunit H             87.0    5e-21   
ref|XP_006570954.1|  PREDICTED: V-type proton ATPase subunit H is...  75.5    5e-21   
ref|XP_001652018.1|  AAEL006516-PA                                    82.8    5e-21   
emb|CCC51018.1|  putative ATP synthase                                82.4    5e-21   
ref|XP_005815100.1|  PREDICTED: V-type proton ATPase subunit H-like   87.8    5e-21   
ref|NP_775377.2|  V-type proton ATPase subunit H isoform 2            86.7    5e-21   
ref|XP_008332709.1|  PREDICTED: V-type proton ATPase subunit H is...  88.2    6e-21   
ref|XP_001564860.1|  putative ATP synthase                            72.8    6e-21   
ref|XP_007260238.1|  PREDICTED: V-type proton ATPase subunit H is...  87.0    6e-21   
ref|XP_003701719.1|  PREDICTED: V-type proton ATPase subunit H-li...  75.5    6e-21   
ref|XP_008332710.1|  PREDICTED: V-type proton ATPase subunit H is...  88.2    6e-21   
ref|XP_007260236.1|  PREDICTED: V-type proton ATPase subunit H is...  87.0    6e-21   
ref|XP_008432798.1|  PREDICTED: V-type proton ATPase subunit H        87.4    6e-21   
ref|XP_003701718.1|  PREDICTED: V-type proton ATPase subunit H-li...  75.5    7e-21   
gb|KIJ99584.1|  hypothetical protein K443DRAFT_679845                 81.3    7e-21   
ref|XP_001844037.1|  vacuolar ATP synthase subunit H                  80.5    8e-21   
gb|AAL75942.1|AF125105_1  vacuolar proton pump subunit SFD alpha ...  90.1    9e-21   
ref|XP_007364518.1|  ATPase V1 complex subunit H                      75.1    1e-20   
ref|XP_002590036.1|  hypothetical protein BRAFLDRAFT_281437           90.9    1e-20   
emb|CCM03836.1|  predicted protein                                    74.7    1e-20   
gb|KIK81118.1|  hypothetical protein PAXRUDRAFT_833089                74.3    1e-20   
ref|XP_001878316.1|  predicted protein                                80.5    1e-20   
emb|CCW62946.1|  unnamed protein product                              82.0    1e-20   
ref|XP_010698941.1|  ATP synthase, putative                           72.8    1e-20   
ref|XP_007260240.1|  PREDICTED: V-type proton ATPase subunit H is...  87.0    1e-20   
ref|XP_007260239.1|  PREDICTED: V-type proton ATPase subunit H is...  87.0    1e-20   
ref|XP_002114416.1|  hypothetical protein TRIADDRAFT_36227            83.2    2e-20   
gb|KHJ43624.1|  v-ATPase subunit H                                    79.0    2e-20   
ref|XP_011266060.1|  PREDICTED: V-type proton ATPase subunit H is...  73.2    2e-20   
gb|KJA27303.1|  hypothetical protein HYPSUDRAFT_1097962               83.6    2e-20   
ref|XP_011266061.1|  PREDICTED: V-type proton ATPase subunit H is...  73.2    2e-20   
ref|XP_003387765.1|  PREDICTED: V-type proton ATPase subunit H-like   77.4    2e-20   
ref|XP_002090530.1|  GE13171                                          83.6    2e-20   
gb|EPY39230.1|  V-type H+-transporting ATPase 54 kD subunit           75.9    2e-20   
ref|XP_011213953.1|  PREDICTED: V-type proton ATPase subunit H is...  77.0    2e-20   
gb|KIJ60597.1|  hypothetical protein HYDPIDRAFT_116892                73.6    2e-20   
ref|XP_001976245.1|  GG20115                                          83.6    2e-20   
ref|XP_004536256.1|  PREDICTED: V-type proton ATPase subunit H-li...  76.6    3e-20   
gb|EPY38074.1|  V-type H+-transporting ATPase 54 kD subunit           75.1    3e-20   
ref|XP_011189551.1|  PREDICTED: V-type proton ATPase subunit H is...  76.6    3e-20   
ref|XP_011213954.1|  PREDICTED: V-type proton ATPase subunit H is...  76.6    3e-20   



>ref|XP_009608692.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
 ref|XP_009608693.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
Length=454

 Score =   203 bits (517),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG+F  L+VDLGVL IVQ+LKAQAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  285  KGSFSILMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDTSSDPRTLAV
Sbjct  345  GHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDTSSDPRTLAV  392


 Score =   121 bits (303),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFL  452

Query  257  QV  252
            QV
Sbjct  453  QV  454



>ref|XP_009792608.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana sylvestris]
Length=454

 Score =   203 bits (516),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG+F  L+VDLGVL IVQ+LKAQAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  285  KGSFSILMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDTSSDPRTLAV
Sbjct  345  GHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDTSSDPRTLAV  392


 Score =   121 bits (303),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFL  452

Query  257  QV  252
            QV
Sbjct  453  QV  454



>ref|XP_011084696.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   203 bits (517),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +VDLG+  +VQNLKAQAWSDEDLLE+LNQLEEGLK NIKKLSSF+KYKQEVL
Sbjct  283  HKGTFGAQMVDLGLPQLVQNLKAQAWSDEDLLESLNQLEEGLKVNIKKLSSFEKYKQEVL  342

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            LGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDT+SDPRTLAV
Sbjct  343  LGHLDWSPMHKDPVFWRENITNFEEHDFQILRVLITILDTASDPRTLAV  391


 Score =   119 bits (299),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+D+SQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  392  ACYDISQFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  451

Query  257  Q  255
            Q
Sbjct  452  Q  452



>ref|XP_006343605.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343606.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006343608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Solanum 
tuberosum]
Length=454

 Score =   200 bits (509),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTF A +VDLGVL IVQ+LKAQAWSDEDLL+ALNQLE+GLK+NIKKLSSFDKYKQEVLL
Sbjct  285  KGTFSAHMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEQGLKENIKKLSSFDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTSSD RTLAV
Sbjct  345  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSSDARTLAV  392


 Score =   119 bits (297),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV DLKAKER M+LLNHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHSAGRIIVNDLKAKERVMRLLNHENAEVTKNALLCIQRLFLGAKYASFL  452

Query  257  Q  255
            Q
Sbjct  453  Q  453



>ref|XP_004307846.1| PREDICTED: V-type proton ATPase subunit H [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   201 bits (512),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  282  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  341

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDTSSDPR LAV
Sbjct  342  GHLDWSPMHKDAIFWRENITNFEENDFQILRVLITILDTSSDPRALAV  389


 Score =   117 bits (293),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  390  ACFDISQFVQHHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  449

Query  257  Q  255
            Q
Sbjct  450  Q  450



>ref|XP_011077102.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   207 bits (527),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKG+FGA +VDLG+L IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL
Sbjct  283  HKGSFGAQMVDLGLLLIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  342

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            LGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDTS+D RTLAV
Sbjct  343  LGHLDWSPMHKDPTFWRENITNFEEHDFQILRVLITILDTSTDARTLAV  391


 Score =   112 bits (279),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGR+IV DLKAK+R MKL++HEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  392  ACYDLSQFIQYHSAGRIIVNDLKAKDRVMKLMDHENAEVTKNALLCIQRLFLGAKYASFL  451

Query  257  Q  255
            Q
Sbjct  452  Q  452



>ref|XP_010251374.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
 ref|XP_010251375.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
Length=452

 Score =   201 bits (512),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +GTFGA +VDLG+  IVQNLKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  RGTFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNHLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTS+DPR LAV
Sbjct  343  GHLDWSPMHKDPWFWRENMTNFEENDFQILRVLITILDTSNDPRALAV  390


 Score =   117 bits (292),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQYHSAGRIIVTDLKAKERVMKLMNHENSEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_004242619.1| PREDICTED: V-type proton ATPase subunit H [Solanum lycopersicum]
Length=454

 Score =   200 bits (509),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTF A +VDLGVL IVQ+LKAQAWSDEDLL+ALNQLE+GLK+NIKKLSSFDKYKQEVLL
Sbjct  285  KGTFSAHMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEQGLKENIKKLSSFDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTSSD RTLAV
Sbjct  345  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSSDARTLAV  392


 Score =   117 bits (294),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV DLKAKER M+LLNH+N EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHSAGRIIVNDLKAKERVMRLLNHDNAEVTKNALLCIQRLFLGAKYASFL  452

Query  257  Q  255
            Q
Sbjct  453  Q  453



>ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
 gb|ESW28003.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
Length=491

 Score =   195 bits (495),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFD YKQEVLL
Sbjct  322  KGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDMYKQEVLL  381

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQI RVLITILDTSSDPRTLAV
Sbjct  382  GHLDWSPMHKDPIFWRENITNFEENDFQIPRVLITILDTSSDPRTLAV  429


 Score =   120 bits (302),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+D+SQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  430  ACYDISQFIQHHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  489

Query  257  QV  252
            QV
Sbjct  490  QV  491



>ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine 
max]
Length=452

 Score =   194 bits (492),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD YKQEVLL
Sbjct  283  KGTLGAQMVDLQLAQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPRTLAV
Sbjct  343  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRTLAV  390


 Score =   120 bits (302),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>gb|KHN44512.1| V-type proton ATPase subunit H [Glycine soja]
Length=428

 Score =   194 bits (492),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD YKQEVLL
Sbjct  259  KGTLGAQMVDLQLAQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMYKQEVLL  318

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPRTLAV
Sbjct  319  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRTLAV  366


 Score =   120 bits (302),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  367  ACYDLSQFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  426

Query  257  QV  252
            QV
Sbjct  427  QV  428



>ref|XP_006858816.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
 gb|ERN20283.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
Length=475

 Score =   197 bits (500),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ LKAQAWSDEDLL+ALNQLEEGLKDNIKK+SSFDKYKQEVLL
Sbjct  306  KGTFGAQMVDLGLPQIVQILKAQAWSDEDLLDALNQLEEGLKDNIKKMSSFDKYKQEVLL  365

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMH+DP FWR+NI NFEENDFQI+RVL+TILDTS+DPR LAV
Sbjct  366  GHLDWSPMHRDPVFWRENIKNFEENDFQIVRVLLTILDTSTDPRALAV  413


 Score =   117 bits (293),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR I++DLKAK+R MKL+NHENPEVTKNALLCIQRLFLGAKYASFL
Sbjct  414  ACYDLSQFIQYHPAGRGILSDLKAKDRVMKLMNHENPEVTKNALLCIQRLFLGAKYASFL  473

Query  257  Q  255
            Q
Sbjct  474  Q  474



>ref|XP_008800912.1| PREDICTED: probable V-type proton ATPase subunit H [Phoenix dactylifera]
Length=452

 Score =   196 bits (499),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+ HIVQ+LKAQAWSDEDLL ALNQLE+GLKDNIK+LSSFDKYKQEVLL
Sbjct  283  KGAFGAQMIDLGLPHIVQSLKAQAWSDEDLLAALNQLEDGLKDNIKRLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILD S+DP  LAV
Sbjct  343  GHLDWSPMHKDPNFWRDNITNFEENDFQILRVLVTILDMSNDPTALAV  390


 Score =   117 bits (293),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++V+DLKAKERAMKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQYHPGGRIVVSDLKAKERAMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>gb|KHN00570.1| Protein DA1-related 1 [Glycine soja]
Length=1212

 Score =   196 bits (498),  Expect(2) = 3e-75, Method: Composition-based stats.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762   KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
             KGT GA +VDL +  +V +LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD YKQEVLL
Sbjct  1043  KGTLGAQMVDLQLAQVVLSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMYKQEVLL  1102

Query  582   GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
             GHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDTSSDPRTLAV
Sbjct  1103  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDTSSDPRTLAV  1150


 Score =   113 bits (283),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  446   LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
             L  AC+DLSQFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYA
Sbjct  1148  LAVACYDLSQFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLFLGAKYA  1207

Query  266   SFLQV  252
             SFLQV
Sbjct  1208  SFLQV  1212



>emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanthemum crystallinum]
Length=470

 Score =   197 bits (500),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLH-IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            +GTFGA +VDLG+L  +VQNLKA AW DEDL+EALNQLEEG+K+NIKKLSSFDKYKQEVL
Sbjct  298  RGTFGAQMVDLGMLPLVVQNLKAHAWGDEDLVEALNQLEEGMKENIKKLSSFDKYKQEVL  357

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            LGHLDWSP+HKD  FWRDNITNFEENDFQILRVLITILDTSSDPR+LAVC
Sbjct  358  LGHLDWSPVHKDTFFWRDNITNFEENDFQILRVLITILDTSSDPRSLAVC  407


 Score =   112 bits (281),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  431  FDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            FDLSQFIQ HPAGR+IV DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  411  FDLSQFIQNHPAGRMIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  469



>gb|AFK35511.1| unknown [Lotus japonicus]
Length=429

 Score =   192 bits (487),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +V+L +  +VQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSS+DKYKQ VLL
Sbjct  260  KGTFGAQMVELQLPQVVQSLKAQAWSDEDLLEALNYLEDGLKDNIKKLSSYDKYKQGVLL  319

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDTSSDPRTLAV
Sbjct  320  GHLDWSPMHKDSIFWRENITNFEENDFQILRVLITILDTSSDPRTLAV  367


 Score =   117 bits (293),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQF+Q HPAGR IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLG+KYASFL
Sbjct  368  ACFDLSQFVQHHPAGRFIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGSKYASFL  427

Query  257  Q  255
            Q
Sbjct  428  Q  428



>emb|CDX69032.1| BnaC01g04210D [Brassica napus]
Length=452

 Score =   194 bits (493),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   115 bits (287),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010912757.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Elaeis guineensis]
Length=452

 Score =   194 bits (493),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQEVLL
Sbjct  283  KGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAV
Sbjct  343  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAV  390


 Score =   114 bits (286),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_009115735.1| PREDICTED: V-type proton ATPase subunit H-like [Brassica rapa]
 gb|AID60130.1| AT3g42050-like protein [Brassica napus]
 emb|CDX75407.1| BnaA01g02950D [Brassica napus]
Length=452

 Score =   194 bits (492),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   115 bits (287),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010912758.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Elaeis guineensis]
Length=431

 Score =   194 bits (493),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQEVLL
Sbjct  262  KGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQEVLL  321

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAV
Sbjct  322  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAV  369


 Score =   114 bits (286),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  370  ACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  429

Query  257  Q  255
            Q
Sbjct  430  Q  430



>ref|XP_010912760.1| PREDICTED: probable V-type proton ATPase subunit H isoform X3 
[Elaeis guineensis]
Length=391

 Score =   194 bits (492),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQEVLL
Sbjct  222  KGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQEVLL  281

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAV
Sbjct  282  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAV  329


 Score =   114 bits (285),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  330  ACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  389

Query  257  Q  255
            Q
Sbjct  390  Q  390



>gb|KCW59595.1| hypothetical protein EUGRSUZ_H02340 [Eucalyptus grandis]
Length=438

 Score =   193 bits (491),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGAL+VDLG+  IVQ+LK+QAWSDEDLLEALN+LE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  269  KGTFGALMVDLGLPQIVQSLKSQAWSDEDLLEALNELEQGLKDNIKKLSSFDKYKQEVLL  328

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDTSSD R LAV
Sbjct  329  GQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDTSSDARALAV  376


 Score =   114 bits (285),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLFLGAKYASFL
Sbjct  377  ACYDLSQFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLFLGAKYASFL  436

Query  257  QV  252
            QV
Sbjct  437  QV  438



>ref|XP_010023341.1| PREDICTED: V-type proton ATPase subunit H [Eucalyptus grandis]
Length=443

 Score =   193 bits (490),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGAL+VDLG+  IVQ+LK+QAWSDEDLLEALN+LE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  274  KGTFGALMVDLGLPQIVQSLKSQAWSDEDLLEALNELEQGLKDNIKKLSSFDKYKQEVLL  333

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDTSSD R LAV
Sbjct  334  GQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDTSSDARALAV  381


 Score =   114 bits (285),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLFLGAKYASFL
Sbjct  382  ACYDLSQFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLFLGAKYASFL  441

Query  257  QV  252
            QV
Sbjct  442  QV  443



>ref|XP_006574707.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max]
Length=452

 Score =   191 bits (485),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +V +LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD YKQEVLL
Sbjct  283  KGTLGAQMVDLQLAQVVLSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDTSSDPRTLAV
Sbjct  343  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDTSSDPRTLAV  390


 Score =   116 bits (290),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_008791823.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
 ref|XP_008791824.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
Length=452

 Score =   191 bits (486),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE GLKDN+K+LSSFDKYKQEVLL
Sbjct  283  KGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEAGLKDNMKRLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DP  LAV
Sbjct  343  GHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDTSNDPTALAV  390


 Score =   115 bits (287),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_008791825.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   191 bits (486),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE GLKDN+K+LSSFDKYKQEVLL
Sbjct  262  KGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEAGLKDNMKRLSSFDKYKQEVLL  321

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DP  LAV
Sbjct  322  GHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDTSNDPTALAV  369


 Score =   114 bits (286),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  370  ACYDLSQFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  429

Query  257  Q  255
            Q
Sbjct  430  Q  430



>gb|KFK33830.1| hypothetical protein AALP_AA5G065600, partial [Arabis alpina]
Length=182

 Score =   190 bits (482),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  13   KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  72

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV   
Sbjct  73   GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACF  123


 Score =   115 bits (289),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  121  ACFDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  180

Query  257  Q  255
            Q
Sbjct  181  Q  181



>ref|XP_010437658.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Camelina 
sativa]
Length=452

 Score =   191 bits (486),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   113 bits (283),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010432453.1| PREDICTED: V-type proton ATPase subunit H-like [Camelina sativa]
Length=452

 Score =   191 bits (486),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   113 bits (283),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010437659.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Camelina 
sativa]
Length=452

 Score =   191 bits (486),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   113 bits (282),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_002869169.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45428.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=418

 Score =   192 bits (487),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+Q+LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  249  KGTFGAQMVDLGLPHIIQSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  308

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  309  GHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAV  356


 Score =   112 bits (281),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  357  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENTEVTKNALLCIQRLLLGAKYASFL  416

Query  257  Q  255
            Q
Sbjct  417  Q  417



>ref|XP_006283723.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
 gb|EOA16621.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
Length=452

 Score =   191 bits (485),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   113 bits (282),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010447124.1| PREDICTED: V-type proton ATPase subunit H [Camelina sativa]
Length=437

 Score =   191 bits (484),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  268  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  327

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  328  GHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  375


 Score =   113 bits (282),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  376  ACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  435

Query  257  Q  255
            Q
Sbjct  436  Q  436



>ref|XP_010930282.1| PREDICTED: probable V-type proton ATPase subunit H [Elaeis guineensis]
Length=452

 Score =   186 bits (471),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FG  +VDLG+  IVQNLKA+A SDEDLL+ALNQLE+GLKDNIK+LSSFDKYKQEVLL
Sbjct  283  KGAFGVQMVDLGLPQIVQNLKARALSDEDLLDALNQLEDGLKDNIKRLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWS MHKDP FWR+NITNFEENDFQILRVL+TILDTS+DP  LAV
Sbjct  343  GHLDWSLMHKDPNFWRENITNFEENDFQILRVLVTILDTSNDPTALAV  390


 Score =   116 bits (291),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HP GR++V+DLKAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQYHPGGRIVVSDLKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_009416984.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   186 bits (471),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            K   GA ++DLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLK++IK LSSFDKYKQEVLL
Sbjct  283  KAACGAQMIDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKEHIKTLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDTS DP  LAV
Sbjct  343  GHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDTSGDPTALAV  390


 Score =   116 bits (290),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR+IV+DLKAK+R MKL+NHEN +VTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACYDLSQFIQYHPAGRIIVSDLKAKDRVMKLMNHENADVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|NP_189791.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
 sp|Q9LX65.1|VATH_ARATH RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar H(+)-ATPase subunit H; AltName: 
Full=Vacuolar proton pump subunit H [Arabidopsis thaliana]
 emb|CAB91576.1| vacuolar H(+)-ATPase subunit-like protein [Arabidopsis thaliana]
 gb|AAM10284.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
 gb|AEE77718.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
Length=441

 Score =   190 bits (482),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  272  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  331

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  332  GHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAV  379


 Score =   111 bits (278),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFL
Sbjct  380  ACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFL  439

Query  257  Q  255
            Q
Sbjct  440  Q  440



>dbj|BAH20255.1| AT3G42050 [Arabidopsis thaliana]
Length=436

 Score =   189 bits (481),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  267  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  326

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  327  GHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAV  374


 Score =   111 bits (278),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFL
Sbjct  375  ACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFL  434

Query  257  Q  255
            Q
Sbjct  435  Q  435



>gb|AAK59761.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
Length=441

 Score =   189 bits (481),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  272  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  331

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  332  GHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAV  379


 Score =   111 bits (278),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFL
Sbjct  380  ACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFL  439

Query  257  Q  255
            Q
Sbjct  440  Q  440



>ref|XP_006412262.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412263.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412264.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53715.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53716.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53717.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
Length=452

 Score =   184 bits (468),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +V+LG+ HI+ +LK QAWSDEDLL+ALN+LEEGLKD I+KLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVELGLPHIIHSLKTQAWSDEDLLDALNKLEEGLKDKIRKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G LDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  343  GQLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAV  390


 Score =   114 bits (284),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACFDLSQFIQYHAAGRVIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_006657814.1| PREDICTED: probable V-type proton ATPase subunit H-like [Oryza 
brachyantha]
Length=452

 Score =   187 bits (475),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   110 bits (275),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENGEVRKNALLCVQRLFLGAKYASFL  450

Query  257  QV  252
            Q 
Sbjct  451  QT  452



>ref|XP_004957961.1| PREDICTED: probable V-type proton ATPase subunit H-like [Setaria 
italica]
Length=452

 Score =   186 bits (473),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  IVQNLKAQAWSDEDLL+ALNQLE GLKDN+KKLSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPQIVQNLKAQAWSDEDLLDALNQLEVGLKDNLKKLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPGFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   111 bits (277),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLCIQRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>gb|EMS54494.1| putative V-type proton ATPase subunit H [Triticum urartu]
Length=450

 Score =   188 bits (477),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKYKQ+VLL
Sbjct  281  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKYKQQVLL  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAV
Sbjct  341  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAV  388


 Score =   109 bits (272),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFL
Sbjct  389  ACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFL  448

Query  257  QV  252
            QV
Sbjct  449  QV  450



>ref|XP_010237225.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
 ref|XP_010237228.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
Length=452

 Score =   188 bits (478),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NITNFEENDFQILRVL+T++DTS+D   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENITNFEENDFQILRVLMTVIDTSTDTTALAV  390


 Score =   108 bits (270),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>gb|EMT32310.1| Putative V-type proton ATPase subunit H [Aegilops tauschii]
Length=436

 Score =   187 bits (476),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKYKQ+VLL
Sbjct  267  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKYKQQVLL  326

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAV
Sbjct  327  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAV  374


 Score =   109 bits (272),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFL
Sbjct  375  ACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFL  434

Query  257  QV  252
            QV
Sbjct  435  QV  436



>sp|Q84ZC0.1|VATH_ORYSJ RecName: Full=Probable V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit 
H [Oryza sativa Japonica Group]
 dbj|BAC57732.1| putative vacuolar ATP synthase subunit H [Oryza sativa Japonica 
Group]
 dbj|BAG90555.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   186 bits (473),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTS+D   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSADTTALAV  390


 Score =   110 bits (275),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLFLGAKYASFL  450

Query  257  QV  252
            Q 
Sbjct  451  QT  452



>gb|EEC82241.1| hypothetical protein OsI_26411 [Oryza sativa Indica Group]
 gb|EEE67371.1| hypothetical protein OsJ_24664 [Oryza sativa Japonica Group]
Length=495

 Score =   186 bits (473),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KYKQ+VLL
Sbjct  326  KGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKYKQQVLL  385

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTS+D   LAV
Sbjct  386  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSADTTALAV  433


 Score =   110 bits (275),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL
Sbjct  434  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLFLGAKYASFL  493

Query  257  QV  252
            Q 
Sbjct  494  QT  495



>dbj|BAJ84958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   187 bits (474),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAV
Sbjct  343  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAV  390


 Score =   108 bits (271),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_002460834.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
 gb|EER97355.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
Length=452

 Score =   185 bits (469),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   110 bits (275),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>tpg|DAA63056.1| TPA: hypothetical protein ZEAMMB73_267119 [Zea mays]
Length=379

 Score =   184 bits (466),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  210  KGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  269

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  270  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  317


 Score =   109 bits (273),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFL
Sbjct  318  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFL  377

Query  257  Q  255
            Q
Sbjct  378  Q  378



>ref|NP_001288363.1| uncharacterized protein LOC103647744 [Zea mays]
 gb|ACN33576.1| unknown [Zea mays]
 tpg|DAA41089.1| TPA: vacuolar ATPase subunit H protein [Zea mays]
Length=452

 Score =   184 bits (468),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   108 bits (271),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            +
Sbjct  451  R  451



>gb|ACF84665.1| unknown [Zea mays]
 gb|ACL54657.1| unknown [Zea mays]
Length=452

 Score =   184 bits (466),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   109 bits (273),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|NP_001146965.1| vacuolar ATPase subunit H protein [Zea mays]
 gb|ACG24799.1| vacuolar ATPase subunit H protein [Zea mays]
Length=468

 Score =   184 bits (466),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  299  KGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  358

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  359  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  406


 Score =   109 bits (273),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFL
Sbjct  407  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFL  466

Query  257  Q  255
            Q
Sbjct  467  Q  467



>gb|ABG75917.1| vacuolar proton ATPase subunit H [Triticum aestivum]
Length=452

 Score =   187 bits (476),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAV
Sbjct  343  GHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAV  390


 Score =   103 bits (257),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q H +GR++V DLKAK+R MKL++H+N EV KN+LLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHTSGRLVVADLKAKDRVMKLMSHDNAEVRKNSLLCVQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_009415033.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   181 bits (458),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            K   GA ++DLG+  IVQ+LKAQAWSDEDLL ALNQLE+GLK++IK LSSFDKYKQEVL 
Sbjct  283  KAACGAQMIDLGLPQIVQSLKAQAWSDEDLLGALNQLEDGLKEHIKTLSSFDKYKQEVLQ  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDTSSDP  L+V
Sbjct  343  GHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDTSSDPTALSV  390


 Score =   110 bits (274),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR++V DLKAK+R MKL+NHEN EVT++ALLCIQRLFLGAKYAS L
Sbjct  391  ACYDLSQFIQYHPAGRIMVADLKAKDRVMKLMNHENAEVTRHALLCIQRLFLGAKYASLL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>emb|CDX76266.1| BnaA08g11340D [Brassica napus]
Length=468

 Score =   176 bits (447),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTF   +VDL + HI+ +LK QAWSDEDLL+ALNQLEEGLKD I KLSSFDKYKQEVLL
Sbjct  299  KGTFVVQMVDLRLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIWKLSSFDKYKQEVLL  358

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHL+W+PMHK+  FWR+N+++FEENDFQILRVL+TILDTSSDPR+LAV
Sbjct  359  GHLEWNPMHKEANFWRENVSSFEENDFQILRVLLTILDTSSDPRSLAV  406


 Score =   113 bits (283),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGRVIVTDLKAKER M+L+ HEN EVTKNALLCIQRL LGAKYASFL
Sbjct  407  ACYDLSQFIQYHAAGRVIVTDLKAKERVMRLMGHENAEVTKNALLCIQRLLLGAKYASFL  466

Query  257  QV  252
            QV
Sbjct  467  QV  468



>ref|XP_002453051.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
 gb|EES06027.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
Length=452

 Score =   182 bits (463),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  283  KGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI +FEENDFQILRVL+TI+DTSSD   LAV
Sbjct  343  GHLDWSPMHKDPSFWRENINSFEENDFQILRVLMTIIDTSSDTTALAV  390


 Score =   105 bits (263),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK++ MKL+NH N EV KNALLC+QRLFLGAKYASFL
Sbjct  391  ACYDLSQFLQYHPSGRIVVADLKAKDQVMKLMNHGNTEVRKNALLCVQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>emb|CDY57740.1| BnaC03g77060D [Brassica napus]
Length=459

 Score =   174 bits (440),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            K +    +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEE LKD I+KLSSFDKYKQEVLL
Sbjct  290  KSSTKEKMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEDLKDKIRKLSSFDKYKQEVLL  349

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDW+PMHK+  FWR+N+T+FEEND QILRVL+TILDTSSDPR+LAV
Sbjct  350  GHLDWNPMHKEANFWRENVTSFEENDLQILRVLLTILDTSSDPRSLAV  397


 Score =   114 bits (284),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ H AGRVIVTDLKAKER MKL+ HEN EVTKNALLCIQRL LGAKYASFL
Sbjct  398  ACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMAHENAEVTKNALLCIQRLLLGAKYASFL  457

Query  257  QV  252
            QV
Sbjct  458  QV  459



>tpg|DAA41086.1| TPA: hypothetical protein ZEAMMB73_371057, partial [Zea mays]
Length=607

 Score =   185 bits (470),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  437  KGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  496

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV
Sbjct  497  GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAV  544


 Score = 95.1 bits (235),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLG  279
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLG
Sbjct  545  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLFLG  597



>gb|ABR17502.1| unknown [Picea sitchensis]
Length=458

 Score =   181 bits (459),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +GTF + +VDLG+  IVQNLK+QAWSDEDL+EALN LEEGLKD+IK+LSSFDKYKQEVLL
Sbjct  289  RGTFASEMVDLGLPQIVQNLKSQAWSDEDLVEALNSLEEGLKDSIKRLSSFDKYKQEVLL  348

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G+LDWSPMHKDP FWR+NI  FE+NDFQ+LR+LITILDTS + R LAV
Sbjct  349  GNLDWSPMHKDPVFWRENINKFEDNDFQVLRILITILDTSGESRALAV  396


 Score = 98.6 bits (244),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+D+SQFIQ HPAGR IVTDLK KER +KL++HE+ EV KNALLC+Q+L L AKY S+L
Sbjct  397  ACYDISQFIQYHPAGRGIVTDLKVKERVIKLMDHESSEVRKNALLCVQKLLLSAKYVSYL  456

Query  257  Q  255
            Q
Sbjct  457  Q  457



>gb|AEG78652.1| vacuolar H+-ATPase subunit H, partial [Avena sativa]
Length=298

 Score =   174 bits (440),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+ SSFDKYKQ+VLL
Sbjct  129  KGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRXSSFDKYKQQVLL  188

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            GHLDWSPMHKDP FW +NIT FE N+FQI RVL+T++DTS+D   LAV
Sbjct  189  GHLDWSPMHKDPNFWXENITXFEGNEFQIXRVLMTVIDTSTDTHALAV  236


 Score = 91.3 bits (225),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQ +Q HP GR+   DLKA  R M L NH+N EV KN+LLC+QRLFLGAKY SFL
Sbjct  237  ACYDLSQXLQYHPXGRLXXADLKAXXRVMXLXNHDNAEVRKNSLLCVQRLFLGAKYXSFL  296

Query  257  Q  255
            Q
Sbjct  297  Q  297



>ref|XP_011044458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Populus 
euphratica]
Length=452

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTS+DPR LAV C   S  I   
Sbjct  343  GHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSNDPRALAVACFDLSQFIQHH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDLSQFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>emb|CDP04145.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKG FGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL
Sbjct  200  HKGNFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  259

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWSPMHKDP FWR+NIT FEENDFQILRVLITILDT++DPRTLAV C   S  I  
Sbjct  260  LGHLDWSPMHKDPIFWRENITTFEENDFQILRVLITILDTANDPRTLAVACFDLSQFIQH  319

Query  408  MPS  400
             P+
Sbjct  320  HPA  322


 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAK+R MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  309  ACFDLSQFIQHHPAGRVIVTDLKAKDRVMKLMNHENGEVTKNALLCIQRLFLGAKYASFL  368

Query  257  QV  252
            QV
Sbjct  369  QV  370



>ref|XP_011044454.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044455.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
Length=483

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  314  KGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  373

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTS+DPR LAV C   S  I   
Sbjct  374  GHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSNDPRALAVACFDLSQFIQHH  433

Query  405  PS  400
            P+
Sbjct  434  PA  435


 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  422  ACFDLSQFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  481

Query  257  QV  252
            QV
Sbjct  482  QV  483



>gb|KDP39537.1| hypothetical protein JCGZ_02557 [Jatropha curcas]
Length=439

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HIVQ+LKAQAWSDEDLLEALNQLEEGL+DNIKKLSSFDKYKQEVLL
Sbjct  270  KGTFGAQMVDLGLPHIVQSLKAQAWSDEDLLEALNQLEEGLRDNIKKLSSFDKYKQEVLL  329

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPR LAV C   S  I   
Sbjct  330  GHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRALAVGCFDLSQFIQYH  389

Query  405  PS  400
            P+
Sbjct  390  PA  391


 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
             CFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  378  GCFDLSQFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  437

Query  257  Q  255
            Q
Sbjct  438  Q  438



>gb|AIZ49542.1| V-ATPase subunit H1 [Eriobotrya japonica]
Length=452

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_008357071.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008357072.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGRV+VTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFVQQHPAGRVVVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_002980222.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
 gb|EFJ18482.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
Length=451

 Score =   164 bits (414),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTF   +V+LG+  I+QNLK QAWSDEDL EALN +EE LK N+K LSSF+KYKQEVL 
Sbjct  281  KGTFARDMVELGMPKIIQNLKMQAWSDEDLTEALNLMEETLKKNLKLLSSFEKYKQEVLS  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S DPRT AV 
Sbjct  341  GNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNSRDPRTQAVA  389


 Score = 91.7 bits (226),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC D++QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L AKYASF+
Sbjct  389  ACQDIAQFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLLNAKYASFM  448

Query  257  Q  255
            Q
Sbjct  449  Q  449



>ref|XP_009361140.1| PREDICTED: V-type proton ATPase subunit H [Pyrus x bretschneideri]
Length=452

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEG+KDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGMKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_002963102.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
 gb|EFJ36565.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
Length=451

 Score =   163 bits (413),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTF   +V+LG+  I+QNLK QAWSDEDL EALN +EE LK N+K LSSF+KYKQEVL 
Sbjct  281  KGTFARDMVELGMPKIIQNLKMQAWSDEDLTEALNFMEETLKKNLKLLSSFEKYKQEVLS  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S DPRT AV 
Sbjct  341  GNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNSRDPRTQAVA  389


 Score = 91.7 bits (226),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC D++QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L AKYASF+
Sbjct  389  ACQDIAQFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLLNAKYASFM  448

Query  257  Q  255
            Q
Sbjct  449  Q  449



>ref|XP_008234540.1| PREDICTED: V-type proton ATPase subunit H, partial [Prunus mume]
Length=423

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTS+DPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDTSTDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLN  339
            L  ACFD+SQF+Q HPAGR+IVTDLKAKER MKL+N
Sbjct  388  LAVACFDISQFVQQHPAGRIIVTDLKAKERVMKLMN  423



>ref|XP_008343829.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008343831.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+  IVQNLKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+NITNFE+NDFQILRVLITILDTSSDPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENITNFEDNDFQILRVLITILDTSSDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGR IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFVQQHPAGRSIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_007217990.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
 gb|EMJ19189.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
Length=452

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPQMVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTSSDPR LAV C   S  +   
Sbjct  343  GHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDTSSDPRALAVACFDISQFVQQH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQF+Q HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFVQQHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>gb|EYU39750.1| hypothetical protein MIMGU_mgv1a006219mg [Erythranthe guttata]
Length=452

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +VDLG+  +VQNLKAQAWSDEDLLE+LNQLEEG+KDNIKKLSSFDKYKQEVL
Sbjct  282  HKGTFGAQMVDLGLPQVVQNLKAQAWSDEDLLESLNQLEEGMKDNIKKLSSFDKYKQEVL  341

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWSPMHKD  FWR+NIT+FEE+DFQILRVLITILDTSSDPRTLAV C   S  I +
Sbjct  342  LGHLDWSPMHKDLIFWRENITSFEEHDFQILRVLITILDTSSDPRTLAVACYDLSQFIQN  401

Query  408  MPSS  397
             P+ 
Sbjct  402  HPAG  405


 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR+IVTDLKAK+R MKL+NHEN EVTKNALLCIQRLFLGAKYASF+
Sbjct  391  ACYDLSQFIQNHPAGRIIVTDLKAKDRVMKLMNHENAEVTKNALLCIQRLFLGAKYASFV  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_002325805.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
 gb|EEF00187.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
Length=447

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQNLKAQAWSDEDLLEALNQ+EEG+KDNIKKLSSFDKYKQEVLL
Sbjct  278  KGTFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQIEEGVKDNIKKLSSFDKYKQEVLL  337

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHK+PAFW +N TNFEENDFQILRVL+TILDTS+DPR LAV C   S  I   
Sbjct  338  GHLDWSPMHKNPAFWCENFTNFEENDFQILRVLVTILDTSNDPRALAVACFDLSQFIQYH  397

Query  405  PS  400
            P+
Sbjct  398  PA  399


 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  386  ACFDLSQFIQYHPAGRIIVTDLKAKERMMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  445

Query  257  QV  252
            QV
Sbjct  446  QV  447



>gb|EYU39492.1| hypothetical protein MIMGU_mgv1a006273mg [Erythranthe guttata]
Length=450

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +VDLG+  +VQ+LKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF+KYKQE L
Sbjct  280  HKGTFGAQMVDLGLPQLVQSLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFEKYKQEAL  339

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWSPMHKDP FWRDNIT+FEE+DFQILRVLITILDTSSD RTLAV C   S  I  
Sbjct  340  LGHLDWSPMHKDPIFWRDNITHFEEHDFQILRVLITILDTSSDSRTLAVACYDLSQFIQY  399

Query  408  MPS  400
             P+
Sbjct  400  HPA  402


 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR+IV DLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFL
Sbjct  389  ACYDLSQFIQYHPAGRIIVNDLKAKERVMKLMNHENAEVTKSALLCIQRLFLGAKYASFL  448

Query  257  QV  252
            Q 
Sbjct  449  QT  450



>ref|XP_010662098.1| PREDICTED: V-type proton ATPase subunit H [Vitis vinifera]
Length=452

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+L IVQ+LKAQAWSDEDL+EALNQL+EGLK NIKKLSSFDKYKQEVLL
Sbjct  283  KGAFGAQMVDLGLLQIVQSLKAQAWSDEDLMEALNQLDEGLKANIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDTSSDPR LAV C   S  I   
Sbjct  343  GHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDTSSDPRALAVACFDLSQFIQYH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLFLGAKYASFL
Sbjct  391  ACFDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_010087456.1| V-type proton ATPase subunit H [Morus notabilis]
 gb|EXB29137.1| V-type proton ATPase subunit H [Morus notabilis]
Length=453

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKL SFDKYKQEVLL
Sbjct  284  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLRSFDKYKQEVLL  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
             HLDWSPMHKDPAFWR+N TNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   
Sbjct  344  AHLDWSPMHKDPAFWRENATNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQHH  403

Query  405  PS  400
            P+
Sbjct  404  PA  405


 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  392  ACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  451

Query  257  Q  255
            Q
Sbjct  452  Q  452



>ref|XP_001756205.1| predicted protein [Physcomitrella patens]
 gb|EDQ79071.1| predicted protein [Physcomitrella patens]
Length=448

 Score =   159 bits (401),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A +VDLG+  +VQ+LK QAW+DEDLL+AL+ ++  LKD I+KLSSFD+YK EV  
Sbjct  280  KGNFAAEMVDLGMSKVVQSLKLQAWNDEDLLQALDVVDAALKDIIRKLSSFDRYKGEVFS  339

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            G+LDWSPMHKDP FWR+NI+ FEE+DFQ+LR+LIT+LD S DP+TLAV 
Sbjct  340  GNLDWSPMHKDPVFWRENISKFEESDFQVLRILITLLDNSRDPKTLAVA  388


 Score = 91.3 bits (225),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC D++QFIQ HPAGR I+ DLKAKER MK ++H NPEV   ALLC+Q++ L AKYAS++
Sbjct  388  ACHDIAQFIQNHPAGRGIILDLKAKERVMKHMSHPNPEVATQALLCVQKVLLSAKYASYM  447

Query  257  Q  255
            Q
Sbjct  448  Q  448



>emb|CBI26482.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+L IVQ+LKAQAWSDEDL+EALNQL+EGLK NIKKLSSFDKYKQEVLL
Sbjct  314  KGAFGAQMVDLGLLQIVQSLKAQAWSDEDLMEALNQLDEGLKANIKKLSSFDKYKQEVLL  373

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDTSSDPR LAV C   S  I   
Sbjct  374  GHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDTSSDPRALAVACFDLSQFIQYH  433

Query  405  PS  400
            P+
Sbjct  434  PA  435


 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLFLGAKYASFL
Sbjct  422  ACFDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLFLGAKYASFL  481

Query  257  Q  255
            Q
Sbjct  482  Q  482



>ref|XP_006437440.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 ref|XP_006437441.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50680.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50681.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
Length=447

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIK+LSSFDKYKQEVLL
Sbjct  278  KGNFAAQMIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKRLSSFDKYKQEVLL  337

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   
Sbjct  338  GHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYH  397

Query  405  PS  400
            P+
Sbjct  398  PA  399


 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFL
Sbjct  386  ACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFL  445

Query  257  Q  255
            Q
Sbjct  446  Q  446



>gb|KJB26714.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=351

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  182  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKYKQEVLL  241

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++TSSDPR LAV C   S  I   
Sbjct  242  GHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMETSSDPRALAVACFDLSQFIQHH  301

Query  405  PS  400
            P+
Sbjct  302  PA  303


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFL
Sbjct  290  ACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFL  349

Query  257  Q  255
            Q
Sbjct  350  Q  350



>ref|XP_007029672.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
 gb|EOY10174.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
Length=453

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  284  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKYKQEVLL  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+D R LAV C   S  I   
Sbjct  344  GHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDSRALAVACFDLSQFIQHH  403

Query  405  PS  400
            P+
Sbjct  404  PA  405


 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  392  ACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  451

Query  257  QV  252
            QV
Sbjct  452  QV  453



>ref|XP_007029671.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10173.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
Length=459

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  290  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKYKQEVLL  349

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+D R LAV C   S  I   
Sbjct  350  GHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDSRALAVACFDLSQFIQHH  409

Query  405  PS  400
            P+
Sbjct  410  PA  411


 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  398  ACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  457

Query  257  QV  252
            QV
Sbjct  458  QV  459



>gb|EPS61013.1| hypothetical protein M569_13786, partial [Genlisea aurea]
Length=442

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +VD+G+  +VQNLKAQAW DEDLLE LNQLEEGLKDNIK+LSSFD YKQEVL
Sbjct  271  HKGTFGAQMVDIGLPQLVQNLKAQAWRDEDLLETLNQLEEGLKDNIKRLSSFDNYKQEVL  330

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWS MHKDPAFWR+N  NFEENDFQILRVL+TILDTS+DPRTLAV C   S  I  
Sbjct  331  LGHLDWSIMHKDPAFWRENSANFEENDFQILRVLVTILDTSTDPRTLAVACYDLSQFIQH  390

Query  408  MPS  400
             P+
Sbjct  391  HPA  393


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR++VTDLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  380  ACYDLSQFIQHHPAGRIVVTDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFL  439



>ref|XP_006484607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Citrus 
sinensis]
Length=452

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIK+LSSFDKYKQEVLL
Sbjct  283  KGNFAAQMIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKRLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TIL TSSDPR LAV C   S  I   
Sbjct  343  GHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILHTSSDPRALAVACFDLSQFIQYH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFL
Sbjct  391  ACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>gb|KHG22602.1| V-type proton ATPase subunit H -like protein [Gossypium arboreum]
Length=494

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  325  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKYKQEVLL  384

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDN++ FEENDFQ+LRVLITI++TSSDPR LAV C   S  I   
Sbjct  385  GHLDWSPMHKDPLFWRDNVSCFEENDFQVLRVLITIMETSSDPRALAVACFDLSQFIQHH  444

Query  405  PS  400
            P+
Sbjct  445  PA  446


 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFL
Sbjct  433  ACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFL  492

Query  257  Q  255
            Q
Sbjct  493  Q  493



>gb|KJB18498.1| hypothetical protein B456_003G056300 [Gossypium raimondii]
Length=463

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDLG+  I+Q+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  294  KGTCGAQMVDLGLPQIIQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKYKQEVLL  353

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+DPR LAV C   S  I   
Sbjct  354  GHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDPRPLAVACFDISQFIQHH  413

Query  405  PS  400
            P+
Sbjct  414  PA  415


 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGRVIV DLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  402  ACFDISQFIQHHPAGRVIVNDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  461

Query  257  QV  252
            QV
Sbjct  462  QV  463



>gb|KJB26715.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=481

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  312  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKYKQEVLL  371

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++TSSDPR LAV C   S  I   
Sbjct  372  GHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMETSSDPRALAVACFDLSQFIQHH  431

Query  405  PS  400
            P+
Sbjct  432  PA  433


 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFL
Sbjct  420  ACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFL  479

Query  257  Q  255
            Q
Sbjct  480  Q  480



>ref|XP_010526971.1| PREDICTED: V-type proton ATPase subunit H-like [Tarenaya hassleriana]
Length=452

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            K TFGA +VDLG+ HIV +L+ QAWSDEDLLEALNQLEEGLKDNI+K SSFDKYKQEVLL
Sbjct  283  KVTFGAQMVDLGLPHIVASLRTQAWSDEDLLEALNQLEEGLKDNIRKSSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
            GHLDW+PMHKDPAFWR+NI NFE NDFQILRVLITIL+TSSDPRTLAV   
Sbjct  343  GHLDWTPMHKDPAFWRENIVNFEGNDFQILRVLITILETSSDPRTLAVACF  393


 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = -1

Query  551  ILHSGGTTLQILKRMISRS*GSLLQFWTHPVIQEHLLSACFDLSQFIQCHPAGRVIVTDL  372
            I++  G   QIL+ +I+     +L+  + P     L  ACFD+SQFIQ HPAGRVIV DL
Sbjct  361  IVNFEGNDFQILRVLIT-----ILETSSDP---RTLAVACFDISQFIQFHPAGRVIVNDL  412

Query  371  KAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            KAKER MKL++HEN EVTKNALL IQRL LGAKYASFLQV
Sbjct  413  KAKERVMKLMSHENVEVTKNALLSIQRLLLGAKYASFLQV  452



>ref|XP_003629515.1| V-type proton ATPase subunit H [Medicago truncatula]
Length=448

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  279  KGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKYKQEVLL  338

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAV C   S  I S 
Sbjct  339  GNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDISQFIQSH  398

Query  405  PS  400
            P+
Sbjct  399  PA  400


 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  387  ACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  446

Query  257  QV  252
            QV
Sbjct  447  QV  448



>ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Cicer 
arietinum]
 ref|XP_004509231.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Cicer 
arietinum]
Length=452

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILDTS+DPRTLAV C   S  I   
Sbjct  343  GNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDTSNDPRTLAVACFDISQFIQCH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQCHPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFIQCHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_010547995.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
 ref|XP_010547996.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
Length=452

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HIV +LK QAWSDEDLLEALNQLEEGLKD I+KLSSFDKYKQEVLL
Sbjct  283  KGTFGAQMVDLGLPHIVASLKTQAWSDEDLLEALNQLEEGLKDKIRKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+PMHKD AFWR+NI  FEENDFQILRVLITILD+SSDPR+LAV C   S  I   
Sbjct  343  GHLDWTPMHKDLAFWRENIMGFEENDFQILRVLITILDSSSDPRSLAVACYDLSQFIQYH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  391  ACYDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENSEVTKNALLCIQRLLLGAKYASFL  450

Query  257  Q  255
            Q
Sbjct  451  Q  451



>ref|XP_002520072.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
 gb|EEF42396.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
Length=446

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +GTFGA +VDLG+  +VQ+LK +AWSDEDLLEALNQLEEGL+DNIKKLSSFDKYKQEVLL
Sbjct  277  RGTFGAQMVDLGLPQVVQSLKTRAWSDEDLLEALNQLEEGLRDNIKKLSSFDKYKQEVLL  336

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+PMHKDP FWR+N+ NFEENDFQILRVLITILDTS+D R LAV C   S  I + 
Sbjct  337  GHLDWTPMHKDPIFWRENLNNFEENDFQILRVLITILDTSNDSRALAVACFDLSQFIQNH  396

Query  405  PS  400
            P+
Sbjct  397  PA  398


 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  385  ACFDLSQFIQNHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  444

Query  257  Q  255
            Q
Sbjct  445  Q  445



>gb|AET03991.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula]
Length=486

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  317  KGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKYKQEVLL  376

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAV C   S  I S 
Sbjct  377  GNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDISQFIQSH  436

Query  405  PS  400
            P+
Sbjct  437  PA  438


 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  425  ACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  484

Query  257  QV  252
            QV
Sbjct  485  QV  486



>ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 ref|XP_004162622.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 gb|KGN59423.1| hypothetical protein Csa_3G819800 [Cucumis sativus]
Length=454

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +V LG+  +VQ+LK+QAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL
Sbjct  284  HKGTFGAQMVGLGLPQVVQSLKSQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  343

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWSPMHKD  FWR+NIT+FEEND +ILRVLITILD+S+DPR LAV C   S  I  
Sbjct  344  LGHLDWSPMHKDVNFWRENITSFEENDLKILRVLITILDSSTDPRALAVACFDLSQFIQH  403

Query  408  MPS  400
             P+
Sbjct  404  HPA  406


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLFLGAKYASFL
Sbjct  393  ACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLFLGAKYASFL  452

Query  257  Q  255
            Q
Sbjct  453  Q  453



>ref|XP_006437446.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
 gb|ESR50686.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
Length=163

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDN K+LSS DKY QEVLLGHLDWSP
Sbjct  1    MIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNTKRLSSLDKYMQEVLLGHLDWSP  60

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSMPS  400
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   P+
Sbjct  61   MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPA  115


 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFL
Sbjct  102  ACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFL  161

Query  257  Q  255
            Q
Sbjct  162  Q  162



>gb|ACJ85007.1| unknown [Medicago truncatula]
 gb|AFK33862.1| unknown [Medicago truncatula]
Length=452

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT GA +VDL +  + Q+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  283  KGTLGAQMVDLQLPQVAQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKYKQEVLL  342

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAV C   S  I S 
Sbjct  343  GNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDISQFIQSH  402

Query  405  PS  400
            P+
Sbjct  403  PA  404


 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFL
Sbjct  391  ACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFL  450

Query  257  QV  252
            QV
Sbjct  451  QV  452



>ref|XP_008443235.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
 ref|XP_008443236.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
Length=454

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = -3

Query  765  HKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  586
            HKGTFGA +V LG+  IVQ+LK+QAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL
Sbjct  284  HKGTFGAQMVGLGLPQIVQSLKSQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVL  343

Query  585  LGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHS  409
            LGHLDWSPMHKD  FWR+NI +FEEND +ILRVLITILD+SSDPR LAV C   S  I  
Sbjct  344  LGHLDWSPMHKDVNFWRENIMSFEENDLKILRVLITILDSSSDPRALAVACFDLSQFIQH  403

Query  408  MPS  400
             P+
Sbjct  404  HPA  406


 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLFLGAKYASFL
Sbjct  393  ACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLFLGAKYASFL  452

Query  257  Q  255
            Q
Sbjct  453  Q  453



>ref|XP_009615905.1| PREDICTED: V-type proton ATPase subunit H-like [Nicotiana tomentosiformis]
Length=297

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGT+GA +VD+GVL IVQNLK QAWSDEDLL+ALNQLEEGLKDNIK LSS+DKYKQEVLL
Sbjct  128  KGTYGAQMVDVGVLQIVQNLKGQAWSDEDLLDALNQLEEGLKDNIKILSSYDKYKQEVLL  187

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G+LDWSPMHKD  FW++NI NFEEN FQILRVL+TILDTSSD RTLAV C   S  I   
Sbjct  188  GNLDWSPMHKDLLFWKENINNFEENGFQILRVLMTILDTSSDARTLAVACYDLSQFIQCH  247

Query  405  PS  400
            P+
Sbjct  248  PA  249


 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCHPAGR+IV DLKAKER MKLLNHE  EVTKNALLCIQRLFLGAKYASFL
Sbjct  236  ACYDLSQFIQCHPAGRIIVADLKAKERVMKLLNHETAEVTKNALLCIQRLFLGAKYASFL  295

Query  257  Q  255
            Q
Sbjct  296  Q  296



>ref|XP_001761877.1| predicted protein [Physcomitrella patens]
 gb|EDQ73318.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   147 bits (372),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG   + +VDLG+  IVQ+L+  AWSDEDLL+AL  L+  LKD+I+KLSSFDK+K +V  
Sbjct  282  KGNSASEMVDLGLPKIVQSLQLYAWSDEDLLQALEVLDAALKDSIRKLSSFDKFKGQVFS  341

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            G+LDW+ MHKDP FWR+NIT FEENDFQ+LR+LIT+LD S D +TLAV 
Sbjct  342  GNLDWTSMHKDPVFWRENITKFEENDFQVLRILITLLDISRDSKTLAVA  390


 Score = 91.3 bits (225),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC D+SQFIQ HPAGR IV DLKAKER MK ++H +PE+ K ALLC+Q++ L AKY S++
Sbjct  390  ACHDISQFIQFHPAGRGIVVDLKAKERVMKHMSHPDPELAKQALLCVQKILLSAKYVSYM  449

Query  257  Q  255
            Q
Sbjct  450  Q  450



>gb|ACN34691.1| unknown [Zea mays]
Length=199

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ+VLL
Sbjct  30   KGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQQVLL  89

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAV C   S  +   
Sbjct  90   GHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLSQFLQYH  149

Query  405  PS  400
            PS
Sbjct  150  PS  151


 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFL
Sbjct  138  ACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFL  197

Query  257  Q  255
            Q
Sbjct  198  Q  198



>emb|CDX72455.1| BnaC07g44770D [Brassica napus]
Length=450

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  281  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAV C   S  I   
Sbjct  341  GHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDISQFIQYH  400

Query  405  PS  400
            P+
Sbjct  401  PA  402


 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  389  ACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  448

Query  257  Q  255
            Q
Sbjct  449  Q  449



>emb|CDY49280.1| BnaA03g50930D [Brassica napus]
Length=450

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  281  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAV C   S  I   
Sbjct  341  GHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDISQFIQYH  400

Query  405  PS  400
            P+
Sbjct  401  PA  402


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  389  ACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  448

Query  257  Q  255
            Q
Sbjct  449  Q  449



>ref|XP_009138267.1| PREDICTED: V-type proton ATPase subunit H [Brassica rapa]
Length=451

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKYKQEVLL
Sbjct  282  KGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKYKQEVLL  341

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAV C   S  I   
Sbjct  342  GHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDISQFIQYH  401

Query  405  PS  400
            P+
Sbjct  402  PA  403


 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFL
Sbjct  390  ACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFL  449

Query  257  Q  255
            Q
Sbjct  450  Q  450



>ref|XP_010673864.1| PREDICTED: V-type proton ATPase subunit H [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQNLKAQAW DEDL+EAL+QL+EGLKDN+KK+SSFDKYKQEVLL
Sbjct  296  KGTFGAQMVDLGMPQIVQNLKAQAWGDEDLVEALSQLDEGLKDNVKKMSSFDKYKQEVLL  355

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSP+HKD  FWR+NI+NFEE DF+ILRVL+TILDTS+DPR+L+V C   S  I   
Sbjct  356  GHLDWSPVHKDTFFWRENISNFEEKDFEILRVLLTILDTSNDPRSLSVACFDLSQFIQHH  415

Query  405  PS  400
            PS
Sbjct  416  PS  417


 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HP+GR+IV DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  404  ACFDLSQFIQHHPSGRIIVKDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  463

Query  257  Q  255
            Q
Sbjct  464  Q  464



>gb|AAO65974.1| putative vacuolar ATPase subunit H protein [Suaeda salsa]
 gb|AEP40377.1| vacuolar proton pump ATPase subunit H [Suaeda corniculata]
Length=465

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG+FG L+VDLG+  IVQNLKA AW DEDL+EALNQL+EGLK N+K+LSSF+KYKQEVLL
Sbjct  296  KGSFGPLMVDLGMPQIVQNLKANAWGDEDLVEALNQLDEGLKYNVKQLSSFEKYKQEVLL  355

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            GHLDWSP+HKD  FWR+NI NFEENDFQILRVLITILDTS+DPR+LAV C   S  +   
Sbjct  356  GHLDWSPVHKDAFFWRENIKNFEENDFQILRVLITILDTSNDPRSLAVACFDLSQFVQQH  415

Query  405  PS  400
            PS
Sbjct  416  PS  417


 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQF+Q HP+GR+IV DL+AKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  404  ACFDLSQFVQQHPSGRIIVNDLQAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFL  463

Query  257  Q  255
            Q
Sbjct  464  Q  464



>ref|XP_004251740.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum lycopersicum]
Length=454

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +G+FG+ +VDL VL IVQ+LKAQAWSDEDLL+ALNQLE GLK NIKK+SS+DKYKQEVLL
Sbjct  285  RGSFGSQMVDLDVLQIVQSLKAQAWSDEDLLDALNQLEGGLKANIKKMSSYDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G LDWSPMHKDP FW++NIT FEEN FQILRVL+TILDTS+D RTLAV C   S  I   
Sbjct  345  GSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDTSNDSRTLAVACYDLSQFIQCH  404

Query  405  PS  400
            P+
Sbjct  405  PA  406


 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLFLGAKYASFL  452



>ref|XP_006350112.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum tuberosum]
Length=454

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +G+FGA +VDL VL IVQ+LKAQAWSDEDLL+ALNQLE GLK NIKKLSS+DKYKQEVLL
Sbjct  285  RGSFGAQMVDLDVLQIVQSLKAQAWSDEDLLDALNQLEGGLKANIKKLSSYDKYKQEVLL  344

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSM  406
            G LDWSPMHKDP FW++NIT FEEN FQILRVL+TILD+S+D RTL+V C   S  I   
Sbjct  345  GSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDSSNDARTLSVACYDLSQFIQCH  404

Query  405  PS  400
            P+
Sbjct  405  PA  406


 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLFLGAKYASFL
Sbjct  393  ACYDLSQFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLFLGAKYASFL  452

Query  257  Q  255
            Q
Sbjct  453  Q  453



>gb|ABF50108.1| vacuolar ATPase subunit H [Musa acuminata AAA Group]
Length=105

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  720  HIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAF  541
             IVQ+LKAQAWSDEDLLEALNQLE+GLK++IK LSSFDKYKQEVLLGHLDW PMHKDP F
Sbjct  2    QIVQSLKAQAWSDEDLLEALNQLEDGLKEHIKTLSSFDKYKQEVLLGHLDWYPMHKDPGF  61

Query  540  WRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
            WR+NITNFEENDFQILRVLITILDTS DP  LAV  
Sbjct  62   WRENITNFEENDFQILRVLITILDTSGDPTALAVAC  97



>ref|XP_002319248.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
 gb|EEE95171.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
Length=397

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL
Sbjct  300  KGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  359

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILD  469
            GHLDWSPMHKDPAFWR+NITNFEENDFQ+L  + + L+
Sbjct  360  GHLDWSPMHKDPAFWRENITNFEENDFQVLVFIFSYLN  397



>ref|XP_009778019.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Nicotiana 
sylvestris]
Length=370

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VD+GVL IVQNLKAQAWSDEDLL+ALNQLEEGLKDNIKKLSS+DKYKQEVLL
Sbjct  273  KGTFGAQMVDVGVLQIVQNLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSYDKYKQEVLL  332

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITIL  472
            G+LDWSPMHKDP FW++NI NFEEN FQ++ V+  IL
Sbjct  333  GNLDWSPMHKDPLFWKENINNFEENGFQVMPVVFNIL  369



>ref|XP_006855968.1| hypothetical protein AMTR_s00037p00233030 [Amborella trichopoda]
 gb|ERN17435.1| hypothetical protein AMTR_s00037p00233030 [Amborella trichopoda]
Length=157

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  678  DLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQ  499
            DLL+ALNQLEEGLKDNIKKL SFDKY+QEVLLGHLDWSPMH+DP FWR+NITNFEENDFQ
Sbjct  16   DLLDALNQLEEGLKDNIKKLCSFDKYEQEVLLGHLDWSPMHRDPVFWRENITNFEENDFQ  75

Query  498  ILRVLITILDTSSDPRTLAV-CLLRSVTIHSMPSS  397
            I+RVL+TILDTS+DPR LAV C   S  I   P+ 
Sbjct  76   IVRVLLTILDTSTDPRALAVACYDLSQFIQYHPAG  110


 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            AC+DLSQFIQ HPAGR I++DLKAK+  MKL+NHENPEV KNALL IQRLFLGAKYASFL
Sbjct  96   ACYDLSQFIQYHPAGRGILSDLKAKDWVMKLMNHENPEVIKNALLGIQRLFLGAKYASFL  155

Query  257  Q  255
            Q
Sbjct  156  Q  156



>ref|XP_002955475.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
 gb|EFJ43546.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
Length=477

 Score =   109 bits (273),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V+ G+  +V   + Q+W D+D++E L  +EE LK  I  LS+F+KYK+EV+ G LDWSP
Sbjct  315  MVEAGLNKVVIVRQLQSWGDDDVVEMLGFVEEKLKQGIIILSNFEKYKKEVMSGQLDWSP  374

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            MH    FWR+N+  FEE DFQ+LRVL+ I++T+ D +TLAV
Sbjct  375  MHSSDLFWRENVEKFEERDFQVLRVLLKIIETNRDVKTLAV  415


 Score = 69.7 bits (169),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
             C DL QFI  HP GR IV DL+ KE  M+LL+H + EV K ALLC+Q+L L      FL
Sbjct  416  GCHDLGQFIVNHPQGRYIVNDLRGKELVMRLLSHSDAEVQKQALLCVQKLMLSKDKLDFL  475

Query  257  Q  255
            +
Sbjct  476  K  476



>ref|XP_001689562.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
 gb|EDP09300.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
Length=463

 Score =   109 bits (272),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V+ G+  +V   + Q+W DED++E L  ++E LK+ I  LS+FDKYK+EVL   LDWSP
Sbjct  301  MVEAGLNKVVVTRQMQSWGDEDVVEMLTYVDEKLKEGIVFLSNFDKYKKEVLSNTLDWSP  360

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            MH    FWR N   FEE DFQ+LRVL+ I++T+ D +TLAV
Sbjct  361  MHTSDLFWRQNAEKFEERDFQVLRVLLKIIETNRDVKTLAV  401


 Score = 68.6 bits (166),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
             C DL QFI  HP GR IV DL+ KE  M+LL H + EV K ALLC+Q+L L      F+
Sbjct  402  GCHDLGQFIVYHPQGRYIVNDLRGKELVMRLLGHSDVEVQKQALLCVQKLMLSKDKLDFI  461

Query  257  Q  255
            +
Sbjct  462  K  462



>ref|XP_005646211.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
 gb|EIE21667.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
Length=465

 Score =   108 bits (271),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V+  +  +VQ    Q W DED+  AL  L+E L  NIK LSS+DKYK+EVL G LDWSP
Sbjct  303  MVEAALPKVVQQRLLQNWEDEDVTAALEALKEALAANIKLLSSWDKYKKEVLSGSLDWSP  362

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            MH    FW +N   FEE DFQ+LRVL+ +L+ S + RTLAV 
Sbjct  363  MHTSDLFWLENAPKFEERDFQVLRVLLKLLEQSRENRTLAVA  404


 Score = 63.5 bits (153),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            A  DL  FI  HP GR IVTDL+ KE AM+L+ H + EV K ALL +Q++ L     ++L
Sbjct  404  AASDLGHFISAHPHGRNIVTDLRGKELAMRLMMHPDAEVQKQALLAVQKILLAKDKVAYL  463



>ref|XP_006437443.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
 gb|ESR50683.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
Length=114

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 77/119 (65%), Gaps = 9/119 (8%)
 Frame = -1

Query  611  LISTSRRSFSAILIGPLCIKILHSGGTTLQILKRMISRS*GSLLQFWTHPVIQEHLLSAC  432
            LIS S RS S       CI         +  L   I R   ++L   + P     L  AC
Sbjct  4    LISVSSRSAS------FCINTYKVSVILMDNLLSQILRVLLTILDTSSDP---RALAVAC  54

Query  431  FDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            FDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  55   FDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  113



>gb|KDO49208.1| hypothetical protein CISIN_1g0474481mg, partial [Citrus sinensis]
Length=65

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            L  ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYA
Sbjct  1    LAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYA  60

Query  266  SFLQ  255
            SFLQ
Sbjct  61   SFLQ  64



>gb|KDO40338.1| hypothetical protein CISIN_1g034103mg [Citrus sinensis]
Length=103

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            L  ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYA
Sbjct  39   LAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYA  98

Query  266  SFLQ  255
            SFLQ
Sbjct  99   SFLQ  102


 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSMPS  400
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   P+
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPA  55



>gb|KDO40336.1| hypothetical protein CISIN_1g034106mg [Citrus sinensis]
Length=103

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFL
Sbjct  42   ACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFL  101

Query  257  Q  255
            Q
Sbjct  102  Q  102


 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSMPS  400
            MHKDP FW DNITNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   P+
Sbjct  1    MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPA  55



>gb|KDO40334.1| hypothetical protein CISIN_1g034108mg [Citrus sinensis]
Length=103

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            ACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKY SFL
Sbjct  42   ACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYTSFL  101

Query  257  Q  255
            Q
Sbjct  102  Q  102


 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -3

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRSVTIHSMPS  400
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAV C   S  I   P+
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPA  55



>emb|CAG27620.1| putative vacuolar ATPase subunit H [Populus deltoides x Populus 
maximowiczii]
Length=105

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = -3

Query  600  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV-CLLRS  424
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTSSDPR LAV C   S
Sbjct  1    KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDLS  60

Query  423  VTIHSMPS  400
              I   P+
Sbjct  61   QFIQHHPA  68


 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  285
            L  ACFDLSQFIQ HPAGRVIVTDLK KER MKL+NHEN EVTKNALLCIQ  F
Sbjct  52   LAVACFDLSQFIQHHPAGRVIVTDLKTKERVMKLMNHENAEVTKNALLCIQGSF  105



>ref|XP_007029673.1| Vacuolar ATP synthase subunit H family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY10175.1| Vacuolar ATP synthase subunit H family protein isoform 3, partial 
[Theobroma cacao]
Length=325

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKYKQEVLL
Sbjct  262  KGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKYKQEVLL  321

Query  582  GHLD  571
            GHLD
Sbjct  322  GHLD  325



>ref|XP_002500993.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO62251.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=504

 Score = 87.0 bits (214),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -3

Query  717  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFW  538
            +VQNL+ + + DE+LL AL  LE+G+    K+ SS+D+Y+ EV  G LDW+  H D  FW
Sbjct  346  LVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAHIDEGFW  405

Query  537  RDNITNFEENDFQILRVLITIL-DTSSDPRTLAV  439
            R+N +   +N+ Q+LR+L+    D  ++PRTLAV
Sbjct  406  RENASKLTDNNCQLLRMLVAAASDPGAEPRTLAV  439


 Score = 60.5 bits (145),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = -1

Query  434  CFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL------FLGAK  273
            C DL +F   +PAGR +V DLK K+ AM+LL H + EV K ALLC Q+L      FLG +
Sbjct  441  CHDLGEFATHYPAGRFLVQDLKGKDCAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGE  500

Query  272  YAS  264
             +S
Sbjct  501  VSS  503



>ref|XP_002680972.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
 gb|EFC48228.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
Length=478

 Score = 94.0 bits (232),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            F   +V++ V   + NL+ +++ D+D+ E L  L E L  +I ++SSFD Y+QEVL GHL
Sbjct  315  FVTAMVNVSVPKTLLNLQKRSFEDKDITEELKSLSENLDAHIDEISSFDDYRQEVLSGHL  374

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +W+P+H    FW++N+   E+N+F ILR LI +LD  S+   LA+
Sbjct  375  EWTPVHSSEKFWKENMDKMEQNNFYILRELIKLLDDESNTDNLAI  419


 Score = 52.4 bits (124),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  452  EHLLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            ++L   C D+ +F++ H  G+ +VTDL AK R ++L+ H N EV K AL C Q++ +
Sbjct  415  DNLAIGCHDIGEFVRYHNRGKRVVTDLGAKARILQLMEHPNDEVKKYALECCQKIMI  471



>emb|CDO69013.1| hypothetical protein BN946_scf184834.g20 [Trametes cinnabarina]
Length=398

 Score = 91.3 bits (225),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +    A+LV   +L   +NL  + W+DED++E +  L + L    + L+++D+Y+ E+L 
Sbjct  217  QANLPAMLVA-QLLPFAKNLSGRKWTDEDIVEDIQFLRDELSARFESLTTYDEYRSELLS  275

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            GHL W+P+H+   FW++N T   +ND+++L++LI +L+ S+DP  LAV 
Sbjct  276  GHLSWTPVHESDLFWKENATRLNDNDYELLKILIRLLNESNDPTVLAVA  324


 Score = 52.0 bits (123),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ Q+++ +  G+ I+TDL  K R M+L++H NP+V   AL+ +QRL
Sbjct  324  ASHDIGQYVKHYERGKKILTDLGGKTRVMELMSHPNPDVRYQALISVQRL  373



>ref|XP_008869403.1| hypothetical protein H310_06210 [Aphanomyces invadans]
 gb|ETW01555.1| hypothetical protein H310_06210 [Aphanomyces invadans]
Length=461

 Score = 87.0 bits (214),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
            G +   ++D G+L  + NL+ + W+DED+ +++  + + L    K+L++ ++Y++EV  G
Sbjct  298  GAYNERMIDGGLLKTLTNLRDRKWTDEDIAKSITAIRDVLIREFKELNTMERYEKEVRTG  357

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
             L W  +H +  FWR+N+ +FE N+F+++R+LI +L+ S DP+T++V L
Sbjct  358  SLAWGLLHTEK-FWRENVMSFEANEFELIRLLIDLLE-SDDPKTVSVAL  404


 Score = 54.7 bits (130),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A +DL  F++ +P G+ I   L AK+ AMKL+ HEN EV K+AL CI ++ +
Sbjct  403  ALYDLGDFVRFYPNGKHIAKRLGAKKVAMKLMTHENAEVQKHALTCISKMMV  454



>ref|XP_011500008.1| PREDICTED: V-type proton ATPase subunit H [Ceratosolen solmsi 
marchali]
Length=484

 Score = 84.3 bits (207),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DEDL + +  L + L+ +++ LSSFD+Y  EV  G L+WSP
Sbjct  299  MVQCKVLKQLSILSQRKFDDEDLTDDIEFLNDKLQASVQDLSSFDEYATEVKSGRLEWSP  358

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+V   
Sbjct  359  VHKSGKFWRENSSRLNEKNYELLRILVHLLETSKDPLVLSVACF  402


 Score = 57.0 bits (136),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            ACFD+ ++++ +P G+ I+  L  K+R M+LL+HE+P V   ALL +Q+L +
Sbjct  400  ACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHEDPNVRYEALLAVQKLMV  451



>ref|XP_008901144.1| hypothetical protein PPTG_07998 [Phytophthora parasitica INRA-310]
 gb|ETI53062.1| hypothetical protein F443_03935 [Phytophthora parasitica P1569]
 gb|ETI53076.1| hypothetical protein F443_03932 [Phytophthora parasitica P1569]
 gb|ETK92905.1| hypothetical protein L915_03827 [Phytophthora parasitica]
 gb|ETL46332.1| hypothetical protein L916_03768 [Phytophthora parasitica]
 gb|ETL99471.1| hypothetical protein L917_03682 [Phytophthora parasitica]
 gb|ETM52630.1| hypothetical protein L914_03787 [Phytophthora parasitica]
 gb|ETN13060.1| hypothetical protein PPTG_07998 [Phytophthora parasitica INRA-310]
 gb|ETO81753.1| hypothetical protein F444_03993 [Phytophthora parasitica P1976]
 gb|ETP22880.1| hypothetical protein F441_03916 [Phytophthora parasitica CJ01A1]
 gb|ETP50858.1| hypothetical protein F442_03923 [Phytophthora parasitica P10297]
Length=463

 Score = 86.3 bits (212),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
            G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ ++Y++E+  G
Sbjct  300  GFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAIRDVLIREYKELNTMERYEKELRTG  359

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
             L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S DP+T+AV L 
Sbjct  360  TLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDDPKTVAVALF  407


 Score = 54.3 bits (129),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FDL +F++ +P G+ I   L AK+  MKL+ HEN EV K AL CI ++ +
Sbjct  405  ALFDLGEFVRFYPNGKHIAKRLGAKKMTMKLMTHENAEVQKQALQCISKMMV  456



>gb|EFN88781.1| Vacuolar proton pump subunit H [Harpegnathos saltator]
Length=529

 Score = 85.9 bits (211),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+   +  L + L+ +++ LSSFD+Y  EV  G L+WSP
Sbjct  344  MVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQDLSSFDEYSTEVKSGRLEWSP  403

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+LI +LDTS DP  L+V 
Sbjct  404  VHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLSVA  445


 Score = 53.9 bits (128),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  445  ASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  496



>ref|XP_011150661.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Harpegnathos 
saltator]
Length=519

 Score = 85.9 bits (211),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+   +  L + L+ +++ LSSFD+Y  EV  G L+WSP
Sbjct  334  MVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQDLSSFDEYSTEVKSGRLEWSP  393

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+LI +LDTS DP  L+V 
Sbjct  394  VHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLSVA  435


 Score = 53.9 bits (128),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  435  ASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  486



>dbj|GAM29018.1| hypothetical protein SAMD00019534_121940 [Acytostelium subglobosum 
LB1]
Length=450

 Score = 87.0 bits (214),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +++ G + ++  L  + W D+D+++ ++ L E L  +I ++SSFDKY+ EVL   L+WSP
Sbjct  289  MIECGFVRMLNFLSNKKWGDQDIVDDISTLSETLSQDIARMSSFDKYRAEVLSKELEWSP  348

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
            +HK   FW++N   FEEN   +L+ L  IL  S +P  +++  
Sbjct  349  VHKSEKFWKENAVRFEENSHNVLKFLHLILQKSDNPLHISIAC  391


 Score = 52.4 bits (124),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  449  HLLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLG  279
            H+  AC DL +F++ HP G++I+  L  K   MKL+ + N EV K AL  +Q++ + 
Sbjct  386  HISIACHDLGEFVRFHPRGKIIIETLGIKTDIMKLMTNPNEEVKKQALFALQKMMIN  442



>ref|XP_011150670.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Harpegnathos 
saltator]
Length=484

 Score = 85.5 bits (210),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+   +  L + L+ +++ LSSFD+Y  EV  G L+WSP
Sbjct  299  MVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQDLSSFDEYSTEVKSGRLEWSP  358

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+LI +LDTS DP  L+V 
Sbjct  359  VHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLSVA  400


 Score = 53.9 bits (128),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  400  ASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_011302355.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Fopius 
arisanus]
Length=483

 Score = 86.7 bits (213),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+ E +  L E L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  299  MVQCKVLKQLSILSQRKFDDEDITEDIEFLNEKLQASVQDLSSFDEYSTQVKSGRLEWSP  358

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+V 
Sbjct  359  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVA  400


 Score = 52.8 bits (125),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  400  ASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  451



>ref|XP_011302354.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Fopius 
arisanus]
Length=518

 Score = 86.7 bits (213),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+ E +  L E L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  334  MVQCKVLKQLSILSQRKFDDEDITEDIEFLNEKLQASVQDLSSFDEYSTQVKSGRLEWSP  393

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+V 
Sbjct  394  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVA  435


 Score = 52.8 bits (125),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  435  ASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  486



>ref|XP_002909335.1| V-type proton ATPase subunit H, putative [Phytophthora infestans 
T30-4]
 gb|EEY58149.1| V-type proton ATPase subunit H, putative [Phytophthora infestans 
T30-4]
Length=463

 Score = 84.7 bits (208),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
            G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ ++Y++E+  G
Sbjct  300  GFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAIRDVLIREYKELNTMERYEKELRTG  359

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
             L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S +P+T+AV L 
Sbjct  360  TLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDEPKTVAVALF  407


 Score = 54.3 bits (129),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FDL +F++ +P G+ I   L AK+  MKL+ HEN EV K AL CI ++ +
Sbjct  405  ALFDLGEFVRFYPNGKHIAKRLGAKKMTMKLMTHENAEVQKQALQCISKMMV  456



>ref|XP_007863478.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58239.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
Length=437

 Score = 84.0 bits (206),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -3

Query  726  VLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP  547
            +L  ++NL  + WSDED+LE +  L + LK     L+++D+Y  E+  GHL W+P+H+  
Sbjct  284  LLPFMKNLSTRKWSDEDILEDVQFLRDELKSRFDSLTNYDEYTSELASGHLSWTPVHESE  343

Query  546  AFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
             FW++N T   E D++ L+ L+ +L  SSD   LAV 
Sbjct  344  VFWKENATKLNEKDYEQLKTLVRLLKESSDALVLAVA  380


 Score = 54.7 bits (130),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  DL Q+++ +  G+ +VTDL AK R M+L+ H NP+V   AL+ +QRL
Sbjct  380  AAHDLGQYVKHYERGKKVVTDLGAKTRVMELMTHPNPDVRYQALISVQRL  429



>ref|XP_009529196.1| hypothetical protein PHYSODRAFT_505321 [Phytophthora sojae]
 gb|EGZ15447.1| hypothetical protein PHYSODRAFT_505321 [Phytophthora sojae]
Length=463

 Score = 82.8 bits (203),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
            G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ ++Y++E+  G
Sbjct  300  GFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAVRDVLIREYKELNTMERYEKELRTG  359

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCLL  430
             L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S D +T+AV L 
Sbjct  360  TLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDDSKTVAVALF  407


 Score = 55.8 bits (133),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FDL +F++ +P G+ I   L AK+ AMKL+ HEN EV K AL CI ++ +
Sbjct  405  ALFDLGEFVRFYPNGKHIAKTLGAKKVAMKLMTHENAEVQKQALQCISKMMV  456



>gb|KFO20474.1| V-type proton ATPase subunit H [Fukomys damarensis]
Length=944

 Score = 93.2 bits (230),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  761  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  820

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  821  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  865


 Score = 45.4 bits (106),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +   YA
Sbjct  863  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWYA  922

Query  266  SFLQV*PS  243
                + P+
Sbjct  923  QLFTLTPT  930



>ref|XP_008547204.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Microplitis 
demolitor]
Length=518

 Score = 84.3 bits (207),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+ E +  L + L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  333  MVQCKVLKQLSILCQRKFDDEDITEDIEFLNDKLQASVQDLSSFDEYSTQVKSGRLEWSP  392

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+V 
Sbjct  393  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVA  434


 Score = 52.8 bits (125),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  434  ASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  485



>gb|KIP10325.1| hypothetical protein PHLGIDRAFT_125667 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=437

 Score = 87.4 bits (215),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
                A+LV   VL  V+NL  + W+DED+LE +  L E L      L+++D+Y  E+L G
Sbjct  274  ANLPAMLV-AQVLPFVKNLSTRKWTDEDILEDIQYLREELTARFDSLTTYDEYSSELLSG  332

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            HL W+P+H+   FW++N+T   + D+  L++L+ +L  SSD   LAV 
Sbjct  333  HLSWTPVHESELFWKENVTKLNDKDYAQLKLLVNLLKESSDAIVLAVA  380


 Score = 49.7 bits (117),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ Q+++ +  G+ ++TDL AK R M+L+ H++P V   AL+ +QRL
Sbjct  380  AAHDVGQYVKHYERGKKVLTDLGAKTRVMELMTHKDPNVRYQALVSVQRL  429



>ref|XP_008547205.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Microplitis 
demolitor]
Length=484

 Score = 84.3 bits (207),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L  + + DED+ E +  L + L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  299  MVQCKVLKQLSILCQRKFDDEDITEDIEFLNDKLQASVQDLSSFDEYSTQVKSGRLEWSP  358

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+V 
Sbjct  359  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVA  400


 Score = 52.8 bits (125),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  400  ASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  451



>ref|XP_009308551.1| ATP synthase [Trypanosoma grayi]
 gb|KEG13226.1| ATP synthase [Trypanosoma grayi]
Length=472

 Score = 83.2 bits (204),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = -3

Query  756  TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGH  577
             F A +V +G+L  +  L  + + DED+   ++ L+  L+ +++KL+SF +Y+ EVL G 
Sbjct  302  AFIAEMVGIGMLKTLAQLSRRKFGDEDISTLIHDLQNVLEQSMEKLTSFSEYRGEVLSGA  361

Query  576  LDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            L+W+P+H    FW++N+  FE N++++L  L  I+ T+    TLAV
Sbjct  362  LEWTPVHTSAKFWKENVMQFESNNYEVLAALGNIIMTTRQDLTLAV  407


 Score = 53.5 bits (127),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGR--VIVTDLKA-KERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  AC+DL + ++ HP GR  +++  L+  K R M L++H NPEV KNALL +Q++ +
Sbjct  405  LAVACYDLGEVVRHHPTGRALLLLPQLEGVKTRVMALMSHANPEVAKNALLAVQKIMV  462



>ref|XP_007321482.1| hypothetical protein SERLADRAFT_474431 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN96156.1| hypothetical protein SERLA73DRAFT_185746 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21696.1| hypothetical protein SERLADRAFT_474431 [Serpula lacrymans var. 
lacrymans S7.9]
Length=436

 Score = 89.7 bits (221),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
                A+LV   +L  ++NL  + WSDED+LE +  +++ L+ N + L+++D+Y  E+  G
Sbjct  273  ANLPAMLV-AQLLPFIKNLSGRKWSDEDILEDVQFVKDELETNFQTLTTYDEYTSELASG  331

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
            HL W+P+H+   FW++N     + D++ LR+LI +LD S+DP  LAV +
Sbjct  332  HLSWTPVHESEDFWKENAAKLNDKDYEQLRILIRLLDDSNDPLVLAVAV  380


 Score = 46.2 bits (108),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ ++++ +  G+ +VTDL AK RAM L+ H + +V  +ALL +Q L
Sbjct  379  AVHDIGRYVKHYDRGKKVVTDLGAKTRAMDLMRHSDSDVRYHALLSVQLL  428



>gb|EKF99745.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score = 84.7 bits (208),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +W+P+H    FWR+N+  FE ND+++L  L   + T+    TLAV
Sbjct  364  EWTPVHTSNKFWRENVMQFENNDYEVLVALGNTIMTTHQDLTLAV  408


 Score = 51.2 bits (121),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            AC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  409  ACYDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQKIMV  463



>ref|XP_007338813.1| ATPase, V1 complex, subunit H [Auricularia delicata TFB-10046 
SS5]
 gb|EJD53236.1| ATPase, V1 complex, subunit H [Auricularia delicata TFB-10046 
SS5]
Length=438

 Score = 86.7 bits (213),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -3

Query  726  VLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP  547
            +L  V+NL  + WSDED++E +  L   L  N + L+++D+Y  E+  GHL W+P+H   
Sbjct  286  LLPFVKNLAGRKWSDEDIIEDITFLRTELAANFESLTTYDEYTSELQSGHLSWTPVHDSQ  345

Query  546  AFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
             FW++N+T   +++++ L++L+ +L TS DP  LAV 
Sbjct  346  TFWKENVTKLNDDNYKQLKLLVGLLKTSDDPLVLAVA  382


 Score = 48.9 bits (115),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ Q+++ +  G+  VTDL AK R M+L+ H N +V   AL+ +QRL
Sbjct  382  AAHDIGQYVKFYDRGKKAVTDLGAKTRVMELMTHTNADVRYQALISVQRL  431



>gb|KIM53725.1| hypothetical protein SCLCIDRAFT_1222591 [Scleroderma citrinum 
Foug A]
Length=437

 Score = 84.3 bits (207),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 65/109 (60%), Gaps = 1/109 (1%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
                A+LV   +L  ++NL A  WSDED+LE +  + + L+ N   L+++D+Y  E+  G
Sbjct  274  ANLPAMLVA-QLLPFIKNLAAGKWSDEDILEDIQFVRDELETNFASLTTYDEYTSELASG  332

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
            HL W+P+H+   FWR+N T   E D+  L+ L+ +L+   D  TLAV +
Sbjct  333  HLSWTPVHESEEFWRENATRLNERDYAQLKSLLRLLNMDDDSVTLAVAV  381


 Score = 51.2 bits (121),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ Q+++ +  G+ I+TD  AK RAM+L+ H +P+V   ALL +Q+L
Sbjct  380  AVHDIGQYVKHYERGKKIITDFGAKGRAMELMTHSDPDVRYRALLAVQQL  429



>gb|KFM65821.1| V-type proton ATPase subunit H, partial [Stegodyphus mimosarum]
Length=475

 Score = 85.1 bits (209),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = -3

Query  750  GALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLD  571
              ++V   VL  +  L+++ + D D++E L  L E L+ +I+ LSSFD+Y  E+  G L+
Sbjct  298  AIVMVQCKVLKQLDILQSRRFDDPDIVEDLEFLNEKLQTSIQDLSSFDEYSTEIKSGRLE  357

Query  570  WSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            WSP+H    FWR+N     E ++++L++LI IL TS DP  L+V
Sbjct  358  WSPVHNSEKFWRENTHRLNEKNYELLKILIYILQTSKDPLALSV  401


 Score = 50.4 bits (119),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K++ M LL+HE+P V   ALLC+Q+L +
Sbjct  402  AAHDIGEYVRHYPRGKHVIEGLGGKQQVMHLLSHEDPNVRYQALLCVQKLMV  453



>ref|NP_001016182.1| V-type proton ATPase subunit H [Xenopus (Silurana) tropicalis]
 gb|AAI70670.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
 gb|AAI70668.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
Length=479

 Score = 91.7 bits (226),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED++E +  L E L ++++ LSSFD+Y  E+  
Sbjct  298  RQEYALAMIQCKVLKQLENLEQQKYDDEDIVEDIKFLLEKLGESVQDLSSFDEYSSELKS  357

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  358  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  405


 Score = 43.5 bits (101),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  403  LAVAAHDIGEYVRHYPRGKRVIEQLDGKQLVMNHMHHEDQQVRYNALLAVQKLMV  457



>gb|ERE85970.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=476

 Score = 90.1 bits (222),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 44.7 bits (104),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +   YA
Sbjct  410  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWYA  466



>gb|EGW09777.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=473

 Score = 89.7 bits (221),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  299  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVEDLSSFDEYSSELKS  358

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  359  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  406


 Score = 44.7 bits (104),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +   YA
Sbjct  407  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWYA  463



>gb|AFN11665.1| vacuolar ATPase subunit H [Locusta migratoria manilensis]
Length=515

 Score = 84.7 bits (208),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            +V   VL  +  L+ +   DED++  +  L E L+ +++ LSSFD+Y  E+  G L+WSP
Sbjct  332  MVQCKVLKQLSILEQRKLDDEDIVADIEFLNEKLQASVQDLSSFDEYATEIKSGRLEWSP  391

Query  561  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            +HK   FWR+N     E ++++LR+LI +L+TS DP  L+V 
Sbjct  392  VHKSAKFWRENAGRLNEKNYELLRILIHLLETSKDPLVLSVA  433


 Score = 50.1 bits (118),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A FD+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  433  ASFDIGEYVRHYPRGKHVIEQLGGKQLVMQLLGHEDPNVRYEALLAVQKLMV  484



>ref|XP_811617.1| ATP synthase [Trypanosoma cruzi strain CL Brener]
 gb|EAN89766.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score = 83.2 bits (204),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +W+P+H    FW++N+  FE ND+++L  L   + T+    TLAV
Sbjct  364  EWTPVHTSNKFWKENVMQFENNDYEVLVALGNTIMTTHQDLTLAV  408


 Score = 51.2 bits (121),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            AC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  409  ACYDLGEVVRHHPTGKSLLLLPRMEGVKSRVMALMSHPNPEVAKNALLAVQKIMV  463



>gb|EKF31005.1| ATP synthase, putative [Trypanosoma cruzi marinkellei]
Length=474

 Score = 83.2 bits (204),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +W+P+H    FW++N+  FE ND+++L  L   + T+    TLAV
Sbjct  364  EWTPVHTSNKFWKENVMQFENNDYEVLVALGNTIMTTHQDLTLAV  408


 Score = 51.2 bits (121),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            AC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  409  ACYDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQKIMV  463



>ref|XP_004329545.1| PREDICTED: V-type proton ATPase subunit H-like [Tursiops truncatus]
Length=240

 Score = 90.9 bits (224),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 68/109 (62%), Gaps = 0/109 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  59   RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  118

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVC  436
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV 
Sbjct  119  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVA  167


 Score = 43.5 bits (101),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  167  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  218



>gb|KIM87633.1| hypothetical protein PILCRDRAFT_815209 [Piloderma croceum F 1598]
Length=437

 Score = 82.4 bits (202),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = -3

Query  726  VLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP  547
            +L   +NL  + +SDED+LE +  L++ L  N + L+++D+Y  E+  GHL W+P+H+  
Sbjct  284  LLPFAKNLCTRKFSDEDILEDVQFLKDELTINFQSLTTYDEYSSELTSGHLSWTPVHESV  343

Query  546  AFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
             FW++N T   + D++ L+ LI +L+ +SDP  LAV +
Sbjct  344  DFWKENATKLNDKDYEQLKTLIKLLNEASDPLVLAVAV  381


 Score = 52.0 bits (123),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            A  D+ Q+++ +  G+ ++TDL AK RAM+L+ H +P+V   ALL +Q+L
Sbjct  380  AVHDVGQYVKHYERGKKVITDLGAKTRAMELMTHHDPDVRYRALLSVQQL  429



>sp|Q9TVC1.1|VATH_PIG RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=V-ATPase 50/57 kDa subunits; AltName: 
Full=Vacuolar proton pump subunit H; AltName: Full=Vacuolar 
proton pump subunit SFD [Sus scrofa]
 emb|CAB39537.1| 54 kDa vacuolar H(+)-ATPase subunit [Sus scrofa]
Length=483

 Score = 90.9 bits (224),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   L+   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|EPZ30805.1| V-type proton ATPase subunit H-like protein [Rozella allomycis 
CSF55]
Length=440

 Score = 83.2 bits (204),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = -3

Query  741  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  562
            L+    L +++ L  + ++DED+   +  L E L++    LSSFD+Y  E+  G L+WSP
Sbjct  278  LIGAKTLSVIETLAGRKFTDEDITNDIKFLGEELRNVFNTLSSFDEYVSELRSGKLEWSP  337

Query  561  MHKDPAFWRDNITNFEENDFQIL----RVLITILDTSSDPRTLAVCL  433
             H+   FW+ N+  F E DF++L    R+LI IL TS DP  L+V  
Sbjct  338  PHQSELFWKQNVIKFNEKDFEVLNNWSRILIRILATSEDPTVLSVAC  384


 Score = 50.8 bits (120),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            AC D+  + + +P GR  + +L AK++ MKL++HEN EV  +AL+ +Q L
Sbjct  383  ACNDIGNYAKFYPNGRRYLQELGAKQKVMKLMSHENSEVKYHALMSVQNL  432



>ref|NP_999405.1| V-type proton ATPase subunit H [Sus scrofa]
 emb|CAB39533.1| 54 kDa vacuolar H(+)-ATPase subunit [Sus scrofa]
Length=483

 Score = 90.9 bits (224),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   L+   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|KIK18316.1| hypothetical protein PISMIDRAFT_14479 [Pisolithus microcarpus 
441]
Length=436

 Score = 84.7 bits (208),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 2/109 (2%)
 Frame = -3

Query  759  GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLG  580
                A+LV   +L   +NL A  WSDED+LE +  + + L+ N   L+++D Y  E+   
Sbjct  274  ANLPAMLVS-ELLSFTKNLAAAKWSDEDILEDIQFVRDELERNFASLTTYDVYTSELASN  332

Query  579  HLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVCL  433
            HL W+P+H+   FWR+N     E DF  L+ LI +LD S+DP TLAV +
Sbjct  333  HLSWTPVHESEEFWRENAHRLHERDFAQLKALIQLLD-SNDPVTLAVAV  380


 Score = 49.3 bits (116),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            L  A  D+ Q+++    G+ +VTDL AK RAM+L+ H +P+V  +ALL +Q L
Sbjct  376  LAVAVHDVGQYVKHCERGKKVVTDLGAKARAMELMTHSDPDVRYHALLAVQEL  428



>ref|XP_820568.1| ATP synthase [Trypanosoma cruzi strain CL Brener]
 gb|EAN98717.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score = 84.7 bits (208),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +W+P+H    FWR+N+  FE ND+++L  L   + T+    TLAV
Sbjct  364  EWTPVHTSNKFWRENVMQFENNDYEVLVALGNTIMTTHQDLTLAV  408


 Score = 48.9 bits (115),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            AC DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  409  ACHDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQKIMV  463



>ref|XP_006924025.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
alecto]
 ref|XP_011357456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
 ref|XP_011357457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.5 bits (101),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006924026.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
alecto]
 ref|XP_011357458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
 ref|XP_011357459.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
Length=465

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006994248.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Peromyscus 
maniculatus bairdii]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007090621.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Panthera 
tigris altaica]
Length=493

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  315  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  374

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  375  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  419


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  417  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  471



>ref|XP_007090622.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Panthera 
tigris altaica]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006495498.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mus musculus]
Length=453

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  272  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  331

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  332  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  379


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  377  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  431



>ref|XP_003999861.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Felis catus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|AFM90690.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Callorhinchus 
milii]
Length=482

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ + +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  304  YALAMIQCKVLKQLENLEQQKYDDEDIADDIKYLLEKLGESVQDLSSFDEYSSELKSGRL  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N +   E ++++L++L  +L+ S DP+ LAV
Sbjct  364  EWSPVHKSEKFWRENASRLNEKNYELLKILTRLLEVSDDPQVLAV  408


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  460



>ref|XP_004679936.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Condylura 
cristata]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|ELK02307.1| V-type proton ATPase subunit H [Pteropus alecto]
Length=443

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  281  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  341  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  388


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  386  LAVAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  440



>ref|XP_004479904.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Dasypus 
novemcinctus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005613222.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Equus caballus]
 ref|XP_005613223.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Equus caballus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005215461.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Bos taurus]
 ref|XP_005215462.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Bos taurus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006994249.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Peromyscus 
maniculatus bairdii]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006077050.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Bubalus 
bubalis]
 ref|XP_006077051.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Bubalus 
bubalis]
 ref|XP_010837255.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Bison bison 
bison]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_544082.2| PREDICTED: V-type proton ATPase subunit H isoformX1 [Canis lupus 
familiaris]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005892054.1| PREDICTED: V-type proton ATPase subunit H-like [Bos mutus]
Length=443

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  262  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  321

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  322  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  369


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  370  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_006769145.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Myotis 
davidii]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004602396.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Sorex araneus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004011727.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Ovis aries]
 ref|XP_005689030.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Capra hircus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004602395.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Sorex araneus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004011726.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Ovis aries]
 ref|XP_005689031.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Capra hircus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007105305.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Physeter 
catodon]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>sp|O46563.2|VATH_BOVIN RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=V-ATPase 50/57 kDa subunits; AltName: 
Full=Vacuolar proton pump subunit H; AltName: Full=Vacuolar 
proton pump subunit SFD [Bos taurus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004275066.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Orcinus 
orca]
Length=480

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  302  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  361

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  406


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  404  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_005638031.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Canis lupus 
familiaris]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_010586613.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Loxodonta 
africana]
Length=443

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  262  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  321

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  322  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  369


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  370  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_006495502.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236637.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236638.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236639.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
Length=276

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  95   RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  154

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  155  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  202


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  203  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  254



>ref|XP_003975495.1| PREDICTED: V-type proton ATPase subunit H-like [Takifugu rubripes]
Length=484

 Score = 89.7 bits (221),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  300  RQEYALAMIQCKVLKQLENLEQQKYDDEDITEDIKFLLERLGESVQDLSSFDEYSSELKS  359

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ +AV
Sbjct  360  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTRLLEVSDDPQVIAV  407


 Score = 43.5 bits (101),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+  V  NALLC+Q+L +
Sbjct  408  AAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQLVRYNALLCVQKLMV  459



>ref|XP_008141569.1| PREDICTED: V-type proton ATPase subunit H [Eptesicus fuscus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  410  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004697612.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Echinops 
telfairi]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004410073.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004410074.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004768878.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mustela 
putorius furo]
 ref|XP_004768879.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mustela 
putorius furo]
 ref|XP_004819700.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mustela 
putorius furo]
 ref|XP_004819701.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mustela 
putorius furo]
 ref|XP_008704908.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
 ref|XP_008704909.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
 ref|XP_008704910.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|ADI40571.1| lysosomal H+-transporting ATPase V1 subunit H [Scotophilus kuhlii]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004410075.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Odobenus 
rosmarus divergens]
 ref|XP_004768880.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mustela 
putorius furo]
 ref|XP_004819702.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mustela 
putorius furo]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>tpg|DAA22751.1| TPA: V-type proton ATPase subunit H [Bos taurus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_010586612.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Loxodonta 
africana]
Length=453

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  272  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  331

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  332  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  379


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  377  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  431



>ref|XP_005638032.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Canis lupus 
familiaris]
Length=443

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  262  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  321

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  322  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  369


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  370  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_008253747.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Oryctolagus 
cuniculus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007516038.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Erinaceus 
europaeus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005362304.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Microtus 
ochrogaster]
 ref|XP_007632664.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cricetulus 
griseus]
 gb|ERE85968.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004435755.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004435756.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Ceratotherium 
simum simum]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|ADI40572.1| lysosomal H+-transporting ATPase V1 subunit H [Miniopterus schreibersii]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003999862.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Felis catus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004410076.1| PREDICTED: V-type proton ATPase subunit H isoform 4 [Odobenus 
rosmarus divergens]
Length=419

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  238  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  297

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  298  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  345


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  346  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  397



>ref|XP_005966485.1| PREDICTED: V-type proton ATPase subunit H [Pantholops hodgsonii]
Length=493

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  312  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  371

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  372  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  419


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  417  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  471



>ref|XP_007950398.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Orycteropus 
afer afer]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005857374.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Myotis 
brandtii]
 ref|XP_006085328.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Myotis 
lucifugus]
 ref|XP_006085329.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Myotis 
lucifugus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003793748.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Otolemur 
garnettii]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_008542739.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Equus przewalskii]
Length=403

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  222  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  281

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  282  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  329


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  330  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  381



>ref|XP_006900599.1| PREDICTED: V-type proton ATPase subunit H-like [Elephantulus 
edwardii]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004375664.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Trichechus 
manatus latirostris]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004375665.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Trichechus 
manatus latirostris]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006871918.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Chrysochloris 
asiatica]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006745755.1| PREDICTED: V-type proton ATPase subunit H [Leptonychotes weddellii]
Length=470

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  289  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  348

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  349  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  396


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  397  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  448



>ref|XP_004479905.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Dasypus 
novemcinctus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006237863.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rattus 
norvegicus]
 ref|XP_006237864.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rattus 
norvegicus]
 gb|EDM11581.1| vacuolar ATPase subunit H, isoform CRA_a [Rattus norvegicus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006140948.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Tupaia 
chinensis]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003408364.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Loxodonta 
africana]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007464083.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Lipotes 
vexillifer]
Length=480

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  299  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  358

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  359  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  406


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  404  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_004479906.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Dasypus 
novemcinctus]
Length=464

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|ELK26175.1| V-type proton ATPase subunit H [Myotis davidii]
Length=504

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007168671.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004887507.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Heterocephalus 
glaber]
 ref|XP_004887508.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Heterocephalus 
glaber]
 ref|XP_004837569.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Heterocephalus 
glaber]
 ref|XP_004837570.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Heterocephalus 
glaber]
 gb|EHB04729.1| V-type proton ATPase subunit H [Heterocephalus glaber]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007090623.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Panthera 
tigris altaica]
Length=475

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  294  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  353

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  354  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  401


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  399  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  453



>ref|XP_010586611.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Loxodonta 
africana]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007904109.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Callorhinchus 
milii]
Length=440

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ + +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  262  YALAMIQCKVLKQLENLEQQKYDDEDIADDIKYLLEKLGESVQDLSSFDEYSSELKSGRL  321

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N +   E ++++L++L  +L+ S DP+ LAV
Sbjct  322  EWSPVHKSEKFWRENASRLNEKNYELLKILTRLLEVSDDPQVLAV  366


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  367  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  418



>ref|XP_008842646.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Nannospalax 
galili]
Length=403

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  222  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  281

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  282  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  329


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  330  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  381



>ref|XP_005085988.1| PREDICTED: V-type proton ATPase subunit H [Mesocricetus auratus]
Length=483

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005322961.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005322962.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ictidomys 
tridecemlineatus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|AAH09154.1| ATPase, H+ transporting, lysosomal V1 subunit H [Mus musculus]
 gb|EDL14258.1| ATPase, H+ transporting, lysosomal V1 subunit H [Mus musculus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  305  YALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRL  364

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  365  EWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006495497.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mus musculus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004679937.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Condylura 
cristata]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_002758941.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Callithrix 
jacchus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004633431.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Octodon 
degus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003793747.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Otolemur 
garnettii]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_008842643.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Nannospalax 
galili]
 ref|XP_008842644.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Nannospalax 
galili]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|NP_598587.2| V-type proton ATPase subunit H [Mus musculus]
 ref|XP_006495496.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mus musculus]
 sp|Q8BVE3.1|VATH_MOUSE RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit H [Mus 
musculus]
 dbj|BAC37382.1| unnamed protein product [Mus musculus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|NP_001279139.1| ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H [Callorhinchus 
milii]
 ref|XP_007904107.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Callorhinchus 
milii]
 ref|XP_007904108.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Callorhinchus 
milii]
 gb|AFK11057.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Callorhinchus 
milii]
 gb|AFM90983.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Callorhinchus 
milii]
Length=482

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -3

Query  753  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  574
            +   ++   VL  ++NL+ Q + DED+ + +  L E L ++++ LSSFD+Y  E+  G L
Sbjct  304  YALAMIQCKVLKQLENLEQQKYDDEDIADDIKYLLEKLGESVQDLSSFDEYSSELKSGRL  363

Query  573  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            +WSP+HK   FWR+N +   E ++++L++L  +L+ S DP+ LAV
Sbjct  364  EWSPVHKSEKFWRENASRLNEKNYELLKILTRLLEVSDDPQVLAV  408


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  460



>ref|XP_004435757.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Ceratotherium 
simum simum]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004653416.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Jaculus 
jaculus]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006237866.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Rattus 
norvegicus]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 42.7 bits (99),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007464084.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Lipotes 
vexillifer]
Length=462

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  281  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  340

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  341  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  388


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  386  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  440



>ref|XP_007998823.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Chlorocebus 
sabaeus]
Length=453

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  272  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  331

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  332  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  379


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  377  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  431



>ref|XP_010609402.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Fukomys 
damarensis]
 ref|XP_010609403.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Fukomys 
damarensis]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004887509.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Heterocephalus 
glaber]
 ref|XP_004837571.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Heterocephalus 
glaber]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_003734984.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Callithrix 
jacchus]
 ref|XP_003940900.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Saimiri 
boliviensis boliviensis]
 ref|XP_006140949.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Tupaia 
chinensis]
Length=465

 Score = 90.5 bits (223),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 42.7 bits (99),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007516039.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Erinaceus 
europaeus]
Length=465

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006077052.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Bubalus 
bubalis]
 ref|XP_010837256.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Bison bison 
bison]
Length=465

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_005362305.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Microtus 
ochrogaster]
 ref|XP_007632665.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cricetulus 
griseus]
 gb|ERE85969.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=465

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  284  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  343

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  344  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  391


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  389  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_003902802.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Papio anubis]
 ref|XP_005563371.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Macaca 
fascicularis]
 ref|XP_007998821.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_010386312.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Rhinopithecus 
roxellana]
 gb|EHH64165.1| V-type proton ATPase subunit H [Macaca fascicularis]
Length=483

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  762  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  583
            +  +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ LSSFD+Y  E+  
Sbjct  302  RQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKS  361

Query  582  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  439
            G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  362  GRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  409


 Score = 43.1 bits (100),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  446  LLSACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  407  LAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890