BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017L02

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350963.1|  PREDICTED: mitogen-activated protein kinase ...    150   3e-38   Solanum tuberosum [potatoes]
ref|XP_009765252.1|  PREDICTED: mitogen-activated protein kinase ...    149   5e-38   Nicotiana sylvestris
ref|XP_009625680.1|  PREDICTED: mitogen-activated protein kinase ...    149   6e-38   Nicotiana tomentosiformis
ref|NP_001234485.1|  MAP3Ka                                             145   1e-36   Solanum lycopersicum
ref|XP_004288333.1|  PREDICTED: mitogen-activated protein kinase ...    135   6e-33   Fragaria vesca subsp. vesca
gb|AAS78639.1|  MAP3Ka                                                  135   7e-33   Nicotiana benthamiana
emb|CBI37539.3|  unnamed protein product                                127   3e-30   Vitis vinifera
ref|XP_002280682.1|  PREDICTED: mitogen-activated protein kinase ...    127   3e-30   Vitis vinifera
gb|KHG01918.1|  Mitogen-activated protein kinase kinase kinase 2        127   6e-30   Gossypium arboreum [tree cotton]
gb|ADI52619.1|  mitogen-activated protein kinase kinase kinase          127   7e-30   Gossypium hirsutum [American cotton]
ref|XP_007213592.1|  hypothetical protein PRUPE_ppa002709mg             126   2e-29   Prunus persica
ref|XP_006432224.1|  hypothetical protein CICLE_v10000585mg             125   2e-29   Citrus clementina [clementine]
gb|KDO50298.1|  hypothetical protein CISIN_1g040472mg                   125   2e-29   Citrus sinensis [apfelsine]
gb|KDP42587.1|  hypothetical protein JCGZ_24361                         124   1e-28   Jatropha curcas
ref|XP_008358959.1|  PREDICTED: mitogen-activated protein kinase ...    122   3e-28   
gb|KJB75259.1|  hypothetical protein B456_012G034500                    122   6e-28   Gossypium raimondii
emb|CDP04692.1|  unnamed protein product                                121   7e-28   Coffea canephora [robusta coffee]
ref|XP_009371492.1|  PREDICTED: mitogen-activated protein kinase ...    119   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_009347263.1|  PREDICTED: mitogen-activated protein kinase ...    119   7e-27   Pyrus x bretschneideri [bai li]
gb|KJB75261.1|  hypothetical protein B456_012G034500                    117   2e-26   Gossypium raimondii
ref|XP_004502938.1|  PREDICTED: mitogen-activated protein kinase ...    117   3e-26   
ref|XP_008363405.1|  PREDICTED: mitogen-activated protein kinase ...    117   3e-26   
ref|XP_003602611.1|  Mitogen-activated protein kinase kinase kinase     111   3e-24   Medicago truncatula
ref|XP_002309908.2|  mitogen-activated protein kinase kinase kinase     103   1e-21   
ref|XP_011022952.1|  PREDICTED: mitogen-activated protein kinase ...    103   1e-21   Populus euphratica
gb|KJB46890.1|  hypothetical protein B456_008G000500                    103   1e-21   Gossypium raimondii
gb|KJB46891.1|  hypothetical protein B456_008G000500                    103   1e-21   Gossypium raimondii
gb|KHG03029.1|  Mitogen-activated protein kinase kinase kinase 2        103   1e-21   Gossypium arboreum [tree cotton]
gb|KHN31145.1|  Mitogen-activated protein kinase kinase kinase 2        103   2e-21   Glycine soja [wild soybean]
ref|XP_003523226.1|  PREDICTED: mitogen-activated protein kinase ...    103   2e-21   Glycine max [soybeans]
ref|XP_003526863.1|  PREDICTED: mitogen-activated protein kinase ...    101   9e-21   Glycine max [soybeans]
ref|XP_007137724.1|  hypothetical protein PHAVU_009G150500g             100   2e-20   Phaseolus vulgaris [French bean]
ref|XP_008227651.1|  PREDICTED: mitogen-activated protein kinase ...  99.8    3e-20   Prunus mume [ume]
ref|XP_010270404.1|  PREDICTED: mitogen-activated protein kinase ...  99.4    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010270403.1|  PREDICTED: mitogen-activated protein kinase ...  98.2    9e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008441055.1|  PREDICTED: mitogen-activated protein kinase ...  97.4    2e-19   Cucumis melo [Oriental melon]
ref|XP_008441054.1|  PREDICTED: mitogen-activated protein kinase ...  97.4    2e-19   Cucumis melo [Oriental melon]
ref|XP_004171417.1|  PREDICTED: protein kinase wis1-like              96.7    3e-19   
ref|XP_004148657.1|  PREDICTED: serine/threonine-protein kinase K...  96.7    3e-19   Cucumis sativus [cucumbers]
ref|XP_010090849.1|  Mitogen-activated protein kinase kinase kina...  96.7    3e-19   Morus notabilis
ref|XP_007048387.1|  Mitogen-activated protein kinase kinase kina...  95.1    1e-18   
ref|XP_011099741.1|  PREDICTED: mitogen-activated protein kinase ...  90.5    4e-17   Sesamum indicum [beniseed]
ref|XP_010260483.1|  PREDICTED: mitogen-activated protein kinase ...  89.0    8e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010260482.1|  PREDICTED: mitogen-activated protein kinase ...  89.4    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010260481.1|  PREDICTED: mitogen-activated protein kinase ...  89.4    1e-16   Nelumbo nucifera [Indian lotus]
gb|KHN29245.1|  Mitogen-activated protein kinase kinase kinase ANP1   87.0    5e-16   Glycine soja [wild soybean]
ref|XP_006585362.1|  PREDICTED: mitogen-activated protein kinase ...  85.1    2e-15   Glycine max [soybeans]
dbj|BAD94298.1|  MEK kinase MAP3Ka                                    79.7    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891761.1|  MEK kinase                                       82.4    2e-14   Arabidopsis lyrata subsp. lyrata
ref|NP_001185211.1|  mitogen-activated protein kinase kinase kina...  82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD12492.1|  mitogen-activated kinase kinase kinase alpha         82.0    2e-14   Lotus japonicus
ref|XP_003525123.1|  PREDICTED: mitogen-activated protein kinase ...  81.6    3e-14   Glycine max [soybeans]
gb|KHN34079.1|  Mitogen-activated protein kinase kinase kinase 2      81.6    3e-14   Glycine soja [wild soybean]
ref|XP_010479928.1|  PREDICTED: mitogen-activated protein kinase ...  81.3    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010479930.1|  PREDICTED: mitogen-activated protein kinase ...  81.3    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002306242.1|  mitogen-activated protein kinase kinase kinase   80.9    6e-14   
ref|NP_849803.1|  mitogen-activated protein kinase kinase kinase 3    79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564635.1|  mitogen-activated protein kinase kinase kinase 3    79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAL31904.1|AF419572_1  At1g53570/F22G10_18                         79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185212.1|  mitogen-activated protein kinase kinase kina...  79.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547899.1|  PREDICTED: mitogen-activated protein kinase ...  79.3    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_006307045.1|  hypothetical protein CARUB_v10008633mg           79.0    2e-13   Capsella rubella
ref|XP_010530601.1|  PREDICTED: mitogen-activated protein kinase ...  79.0    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010530598.1|  PREDICTED: mitogen-activated protein kinase ...  79.0    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010479927.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010479926.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    3e-13   Camelina sativa [gold-of-pleasure]
gb|AAD10848.1|  MEK kinase                                            78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159841.1|  hypothetical protein PHAVU_002G272100g           78.6    3e-13   Phaseolus vulgaris [French bean]
emb|CAA08994.1|  MAP3K alpha protein kinase                           78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530597.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_010530599.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_010530600.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    3e-13   Tarenaya hassleriana [spider flower]
ref|XP_010501012.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010501011.1|  PREDICTED: mitogen-activated protein kinase ...  78.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010462255.1|  PREDICTED: mitogen-activated protein kinase ...  78.2    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010547898.1|  PREDICTED: mitogen-activated protein kinase ...  78.2    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_010547897.1|  PREDICTED: mitogen-activated protein kinase ...  78.2    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_011031200.1|  PREDICTED: mitogen-activated protein kinase ...  77.0    1e-12   Populus euphratica
ref|XP_010501010.1|  PREDICTED: mitogen-activated protein kinase ...  75.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010501009.1|  PREDICTED: mitogen-activated protein kinase ...  75.9    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010462253.1|  PREDICTED: mitogen-activated protein kinase ...  75.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010462254.1|  PREDICTED: mitogen-activated protein kinase ...  75.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010025592.1|  PREDICTED: mitogen-activated protein kinase ...  75.5    3e-12   Eucalyptus grandis [rose gum]
gb|KFK39944.1|  hypothetical protein AALP_AA3G309800                  75.5    4e-12   Arabis alpina [alpine rockcress]
gb|KFK39942.1|  hypothetical protein AALP_AA3G309800                  75.5    4e-12   Arabis alpina [alpine rockcress]
gb|KFK39943.1|  hypothetical protein AALP_AA3G309800                  74.7    6e-12   Arabis alpina [alpine rockcress]
ref|XP_003630274.1|  Protein kinase, putative                         73.6    1e-11   Medicago truncatula
ref|XP_010025591.1|  PREDICTED: mitogen-activated protein kinase ...  73.2    2e-11   
ref|XP_006409679.1|  hypothetical protein EUTSA_v10022608mg           72.8    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_004503937.1|  PREDICTED: mitogen-activated protein kinase ...  71.2    7e-11   Cicer arietinum [garbanzo]
emb|CDX89612.1|  BnaC03g45260D                                        69.7    2e-10   
ref|XP_009136221.1|  PREDICTED: mitogen-activated protein kinase ...  69.7    2e-10   Brassica rapa
ref|XP_007159840.1|  hypothetical protein PHAVU_002G272100g           69.7    2e-10   Phaseolus vulgaris [French bean]
emb|CAA08995.1|  MAP3K alpha 1 protein kinase                         69.7    3e-10   Brassica napus [oilseed rape]
emb|CDX93120.1|  BnaA03g38420D                                        69.7    3e-10   
ref|XP_010680195.1|  PREDICTED: mitogen-activated protein kinase ...  68.9    4e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN30597.1|  unknown                                               64.3    9e-09   Zea mays [maize]
ref|NP_001130692.1|  mitogen activated protein kinase kinase kinase   64.3    2e-08   Zea mays [maize]
gb|ACY01925.1|  mitogen activated protein kinase kinase kinase kkk 3  62.8    5e-08   Beta vulgaris [beet]
ref|XP_004975671.1|  PREDICTED: mitogen-activated protein kinase ...  60.5    3e-07   Setaria italica
ref|XP_004975670.1|  PREDICTED: mitogen-activated protein kinase ...  60.5    3e-07   Setaria italica
ref|XP_004975669.1|  PREDICTED: mitogen-activated protein kinase ...  60.5    3e-07   
gb|EYU18037.1|  hypothetical protein MIMGU_mgv1a002756mg              57.8    2e-06   Erythranthe guttata [common monkey flower]
gb|EYU24311.1|  hypothetical protein MIMGU_mgv1a025509mg              57.8    2e-06   Erythranthe guttata [common monkey flower]
gb|ABG22409.1|  mitogen-activated kinase kinase kinase alpha, put...  56.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979130.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    6e-06   Setaria italica
ref|NP_001067464.1|  Os11g0207200                                     56.2    6e-06   
gb|EEE51829.1|  hypothetical protein OsJ_33308                        56.2    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67854.1|  hypothetical protein OsI_35471                        56.2    7e-06   Oryza sativa Indica Group [Indian rice]
gb|AAF34436.1|AF172282_25  similar to mitogen-activated protein k...  56.2    7e-06   Oryza sativa [red rice]
gb|EEC77321.1|  hypothetical protein OsI_15990                        55.8    1e-05   Oryza sativa Indica Group [Indian rice]
emb|CAD40821.2|  OSJNBa0006B20.13                                     55.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052859.1|  Os04g0437600                                     55.8    1e-05   
gb|EEE61045.1|  hypothetical protein OsJ_14897                        55.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67577.1|  H0315A08.7                                           55.8    1e-05   Oryza sativa [red rice]
ref|XP_003577728.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_006663285.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    2e-05   
ref|XP_006653424.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    2e-04   
ref|XP_009416942.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047125.2|  Os02g0555900                                     50.4    7e-04   
ref|XP_010930646.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    8e-04   
ref|XP_010930645.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    8e-04   Elaeis guineensis
ref|XP_003581251.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    8e-04   Brachypodium distachyon [annual false brome]
ref|XP_008808477.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    9e-04   Phoenix dactylifera



>ref|XP_006350963.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=614

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 8/134 (6%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGS------LEADNSTKPV-TISRPMISSRESARTITSLPVSPC  542
            GSRTPP L+LHP    +         E + ++ PV T+SRP+I +RES + I SLPVSP 
Sbjct  482  GSRTPPVLELHPGGRNISPGRNISPAEGNYASHPVITVSRPLICTRESVKAIASLPVSPT  541

Query  541  SSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYR  362
            SSPLRQYEPAR+SCYLSP HPSY + GQSGY  NDYS +  ARP+TR+TL+PWLE+ Q+R
Sbjct  542  SSPLRQYEPARKSCYLSPPHPSYGIGGQSGYEANDYS-MFQARPSTRTTLEPWLEIPQFR  600

Query  361  GQTAGRSSKTRPIL  320
             QT  RS +TRPIL
Sbjct  601  AQTPSRSPRTRPIL  614



>ref|XP_009765252.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Nicotiana sylvestris]
Length=613

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP LDL      +   + + ++ PV TISRP+   RE  +TITSLPVSP SSPLRQ
Sbjct  487  GSRTPPVLDLQSGGRNISPSKGNYASHPVITISRPLSCPREIVKTITSLPVSPTSSPLRQ  546

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            YEPARRSCYLSP HP+Y + GQSGY+ NDYS   T RP TRSTL+PWLE+ Q++ QT  R
Sbjct  547  YEPARRSCYLSPPHPAYGIGGQSGYDANDYSMFQT-RPTTRSTLEPWLEIPQFKAQTPSR  605

Query  343  SSKTRPIL  320
            S KTRPIL
Sbjct  606  SPKTRPIL  613



>ref|XP_009625680.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Nicotiana tomentosiformis]
Length=608

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP LDL      +   + + ++ PV TISRP+   RE  +TITSLPVSP SSPLRQ
Sbjct  482  GSRTPPVLDLQSGGRNISPSKGNYASHPVITISRPLSCPREIVKTITSLPVSPTSSPLRQ  541

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            YEPARRSCYLSP HP+Y + GQSGY+ NDYS   T RP TRSTL+PWLE+ Q++ QT  R
Sbjct  542  YEPARRSCYLSPPHPAYGIGGQSGYDANDYSMFQT-RPTTRSTLEPWLEIPQFKAQTPSR  600

Query  343  SSKTRPIL  320
            S KTRPIL
Sbjct  601  SPKTRPIL  608



>ref|NP_001234485.1| MAP3Ka [Solanum lycopersicum]
 gb|AAS78640.1| MAP3Ka [Solanum lycopersicum]
Length=614

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 95/134 (71%), Gaps = 8/134 (6%)
 Frame = -2

Query  700  GSRTPPALDLHPCXG------YMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPC  542
            GSRTPP L+LHP          +   E + ++ PV T+SRP+I +RE+ + ITSLPVSP 
Sbjct  482  GSRTPPVLELHPGGRTISPGRNISPAEGNYASHPVITVSRPLICARENVKAITSLPVSPT  541

Query  541  SSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYR  362
            SSPLRQYEPAR+SCYLSP H SY + GQSGY  NDYS   T RP+TR TL+PWLE+  +R
Sbjct  542  SSPLRQYEPARKSCYLSPPHSSYGIGGQSGYEANDYSMFQT-RPSTRITLEPWLEIPHFR  600

Query  361  GQTAGRSSKTRPIL  320
             QT  RS KTRPIL
Sbjct  601  TQTPSRSPKTRPIL  614



>ref|XP_004288333.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Fragaria vesca subsp. vesca]
Length=618

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH     +   +AD+  KP VT SR + S R++AR ITSLPVSPCSSPLRQ
Sbjct  493  GSRTPPILELHSNRTSITLGDADHIMKPSVTTSRAIRSPRDNARMITSLPVSPCSSPLRQ  552

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA +SC+LSP HP+Y +MGQ+ YN+N+YS+ TT RPNT  TL+PW E    R QT G 
Sbjct  553  YGPAHKSCFLSPPHPTYAMMGQNNYNLNEYSSYTT-RPNTSYTLEPWRESPLLRPQTPGG  611

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  612  SPRTRPI  618



>gb|AAS78639.1| MAP3Ka [Nicotiana benthamiana]
Length=611

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 89/132 (67%), Gaps = 12/132 (9%)
 Frame = -2

Query  700  GSRTPPALD-----LHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSS  536
            G+RTPP LD     + P  G   S         +TISRP+   RE  +TITSLPVSP SS
Sbjct  487  GNRTPPVLDSGGRNISPTKGNYASHPV------ITISRPLSCPREIVKTITSLPVSPTSS  540

Query  535  PLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQ  356
            PLRQYEPARRSCYLSP HP+Y + G SGY+ NDY  +  ARP TR+TL+PWLE+ Q++ Q
Sbjct  541  PLRQYEPARRSCYLSPPHPAYGIGGHSGYDENDY-LMFQARPTTRNTLEPWLEIPQFKVQ  599

Query  355  TAGRSSKTRPIL  320
            T  RS K RPIL
Sbjct  600  TPSRSPKLRPIL  611



>emb|CBI37539.3| unnamed protein product [Vitis vinifera]
Length=600

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTP AL+LH     +   + D  TKPV T+SR   +SR+S RTITSLPVSPCSSPLR 
Sbjct  475  GSRTPTALELHSNRTSLTLFDGDYVTKPVGTVSRAAKNSRDSVRTITSLPVSPCSSPLRN  534

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA +SC+LSP HPSYP++GQS YN NDYS L   R  T+ T DPW +   +R  T   
Sbjct  535  YGPAHKSCFLSPPHPSYPIVGQSSYNSNDYS-LYPTRAITKYTHDPWSDNPPFRSLTPNG  593

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  594  SPRTRPI  600



>ref|XP_002280682.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Vitis vinifera]
Length=623

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTP AL+LH     +   + D  TKPV T+SR   +SR+S RTITSLPVSPCSSPLR 
Sbjct  498  GSRTPTALELHSNRTSLTLFDGDYVTKPVGTVSRAAKNSRDSVRTITSLPVSPCSSPLRN  557

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA +SC+LSP HPSYP++GQS YN NDYS L   R  T+ T DPW +   +R  T   
Sbjct  558  YGPAHKSCFLSPPHPSYPIVGQSSYNSNDYS-LYPTRAITKYTHDPWSDNPPFRSLTPNG  616

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  617  SPRTRPI  623



>gb|KHG01918.1| Mitogen-activated protein kinase kinase kinase 2 [Gossypium arboreum]
Length=661

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L++      + S + D  TK + T SR + + R++ARTITSLPVSPCSSPLR 
Sbjct  537  GSRTPPILEMQSNRNNILSFDGDYGTKGMATTSRALRTPRDNARTITSLPVSPCSSPLR-  595

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA RSC+LSP HP+Y  +GQSG+N+ D+S   T+RPN R T DPWLE  Q + QT G 
Sbjct  596  YGPAHRSCFLSPPHPAYQFVGQSGHNLGDFSG-NTSRPNPRYTHDPWLETPQLKVQTPGT  654

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  655  SPRTRPI  661



>gb|ADI52619.1| mitogen-activated protein kinase kinase kinase [Gossypium hirsutum]
Length=661

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L++      + S + D  TK + T SR + + R++ARTITSLPVSPCSSPLR 
Sbjct  537  GSRTPPILEMQSNRNNILSFDGDYGTKGMATTSRALRTPRDNARTITSLPVSPCSSPLR-  595

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA RSC+LSP HP+Y  +GQSG+N+ D+S   T+RPN R T DPWLE  Q + QT G 
Sbjct  596  YGPAHRSCFLSPPHPAYHFVGQSGHNLGDFSG-NTSRPNPRYTHDPWLETPQLKVQTPGT  654

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  655  SPRTRPI  661



>ref|XP_007213592.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
 gb|EMJ14791.1| hypothetical protein PRUPE_ppa002709mg [Prunus persica]
Length=642

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH     +   +AD++ KP    SR + S RE+ R ITSLPVSPCSSPLRQ
Sbjct  517  GSRTPPILELHSNRTSITLSDADHTAKPTAATSRAVRSPRENIRMITSLPVSPCSSPLRQ  576

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y P  +SC+LSP HP+Y +MGQS YN++D S   T  PNT  TLDPW + +  + QT G 
Sbjct  577  YGPTHKSCFLSPPHPTYAMMGQSSYNLSDLS-YNTLSPNTSYTLDPWQDTSILKAQTPGG  635

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  636  SPRTRPI  642



>ref|XP_006432224.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
 ref|XP_006464984.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Citrus sinensis]
 gb|ESR45464.1| hypothetical protein CICLE_v10000585mg [Citrus clementina]
Length=628

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP LDL P    +   E D    P V  SR + + RE+ARTITSLPVSPCSSPLRQ
Sbjct  502  GSRTPPKLDLLPTRKSITLCEGDYLANPLVPTSRALNNPRENARTITSLPVSPCSSPLRQ  561

Query  523  YEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAG  347
            Y P+ +SC+LSP HPSY +MGQ SGYN+ DYS   T R N R   DPWLE +  + QT G
Sbjct  562  YGPSHKSCFLSPPHPSYAVMGQSSGYNLGDYSGYPT-RSNPRYINDPWLETSLLKAQTPG  620

Query  346  RSSKTRPI  323
             S ++RPI
Sbjct  621  TSPRSRPI  628



>gb|KDO50298.1| hypothetical protein CISIN_1g040472mg [Citrus sinensis]
Length=628

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP LDL P    +   E D    P V  SR + + RE+ARTITSLPVSPCSSPLRQ
Sbjct  502  GSRTPPKLDLLPTRKSITLCEGDYLANPLVPTSRALNNPRENARTITSLPVSPCSSPLRQ  561

Query  523  YEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAG  347
            Y P+ +SC+LSP HPSY +MGQ SGYN+ DYS   T R N R   DPWLE +  + QT G
Sbjct  562  YGPSHKSCFLSPPHPSYAVMGQSSGYNLGDYSGYPT-RSNPRYINDPWLETSLLKAQTPG  620

Query  346  RSSKTRPI  323
             S ++RPI
Sbjct  621  TSPRSRPI  628



>gb|KDP42587.1| hypothetical protein JCGZ_24361 [Jatropha curcas]
Length=644

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 7/127 (6%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP LDLH         + D + K  VT +R + ++R+  R ITSLPVSPCSSPLR 
Sbjct  524  GSRTPPVLDLHSNRS-----DGDYAMKQIVTNTRALKNTRDDVRMITSLPVSPCSSPLRH  578

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA +SC+LSP HP+Y L+GQSGYN++DYS L + RPNT  T DP  E +  + QT G 
Sbjct  579  YGPAHKSCFLSPPHPTYALVGQSGYNLSDYS-LYSTRPNTIYTHDPGFENSILKAQTPGA  637

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  638  SPRTRPI  644



>ref|XP_008358959.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008358960.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=642

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH         +AD++ KP +  SR + S RE+ R ITSLPVSPCSSPLRQ
Sbjct  514  GSRTPPVLELHSNRTSFTLSDADHTVKPTIATSRDVRSPRENIRMITSLPVSPCSSPLRQ  573

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y    +  +LSP HP+Y +MGQS YN++DYS+     P T  TLDPW E      QT G 
Sbjct  574  YGATHKXSFLSPPHPTYAMMGQSSYNLSDYSSYNKLSPTTPYTLDPWQETTLLNAQTLGS  633

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  634  SPRTRPI  640



>gb|KJB75259.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=661

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L++      + S + D  T+ + T SR + + R++ARTITSLPVSPCSSPLR 
Sbjct  537  GSRTPPILEMQSNRNNILSFDGDYGTQGMATTSRALRTPRDNARTITSLPVSPCSSPLR-  595

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y P   SC+LSP HP+Y  +GQSG+N+ D+S   T+RPN R T DPW E  Q + QT G 
Sbjct  596  YGPVHMSCFLSPPHPAYQFVGQSGHNLGDFSG-NTSRPNPRYTHDPWFEAPQLKVQTTGT  654

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  655  SPRTRPI  661



>emb|CDP04692.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTP AL+L      +G  E   S + +T+SR  IS RE+ARTITSLPVSPCSSPLRQ+
Sbjct  500  GSRTPTALELRGSRSNIGP-EDYTSRQVLTVSRGNISPRENARTITSLPVSPCSSPLRQH  558

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRS  341
              + R  +LSP HPSY   GQS Y  NDYS     RPN+R+ L+PW E  Q+R QT GR+
Sbjct  559  GGSYRG-FLSPTHPSYAFAGQSTYTSNDYSMFPM-RPNSRNILEPWNEAPQFRAQTPGRT  616

Query  340  SKTRPIL  320
             +TRPIL
Sbjct  617  IRTRPIL  623



>ref|XP_009371492.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009371493.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=642

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH         + D++ KP +  SR + S RE+ R ITSLPVSPCSSPLRQ
Sbjct  514  GSRTPPVLELHSNRTSFTLSDTDHTVKPTMATSRDLRSPRENIRMITSLPVSPCSSPLRQ  573

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y    +S +LSP HP+Y +MGQS YN++DYS+     P    TLDPW E      QT G 
Sbjct  574  YGATHKSSFLSPPHPTYAMMGQSSYNLSDYSSYNKLSPTMPYTLDPWQETTLLNAQTLGS  633

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  634  SPRTRPI  640



>ref|XP_009347263.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347264.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
 ref|XP_009347265.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Pyrus x bretschneideri]
Length=640

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH         +AD++ KP +  SR   S  E+ R ITSLPVSPCSSPLRQ
Sbjct  514  GSRTPPVLELHSNRTSFTLSDADHTAKPTIATSRDWRSPSENIRMITSLPVSPCSSPLRQ  573

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y    +S  LSP HP+Y +MGQS YN++DYS+     P T  TLDPW E    + QT G 
Sbjct  574  YGQTHKSSLLSPPHPTYAMMGQSSYNLSDYSSYNKLSPTTSYTLDPWQETTLLKAQTLGS  633

Query  343  SSKTRPI  323
            S + RPI
Sbjct  634  SPRARPI  640



>gb|KJB75261.1| hypothetical protein B456_012G034500 [Gossypium raimondii]
Length=662

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = -2

Query  700  GSRTP-PALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLR  527
            GSRTP P L++      + S + D  T+ + T SR + + R++ARTITSLPVSPCSSPLR
Sbjct  537  GSRTPQPILEMQSNRNNILSFDGDYGTQGMATTSRALRTPRDNARTITSLPVSPCSSPLR  596

Query  526  QYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAG  347
             Y P   SC+LSP HP+Y  +GQSG+N+ D+S   T+RPN R T DPW E  Q + QT G
Sbjct  597  -YGPVHMSCFLSPPHPAYQFVGQSGHNLGDFSG-NTSRPNPRYTHDPWFEAPQLKVQTTG  654

Query  346  RSSKTRPI  323
             S +TRPI
Sbjct  655  TSPRTRPI  662



>ref|XP_004502938.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=631

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP  DLH     + S + D +TKPV T SR + S R++ R ITSLPVSPCSSPLRQ
Sbjct  507  GSRTPPVSDLHSNRTCIASQDGDYATKPVVTASRAVRSPRDNTRMITSLPVSPCSSPLRQ  566

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y P  +SC+LSP HP+Y +MGQ+   ++ Y +    R N + +LDPW E   Y+G T G 
Sbjct  567  YVPTHKSCFLSPPHPTYTMMGQN--TLSSYESYPPMRSNAKFSLDPWQETPMYKGHTPGG  624

Query  343  SSKTR  329
            S +TR
Sbjct  625  SPRTR  629



>ref|XP_008363405.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
 ref|XP_008363406.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Malus domestica]
Length=640

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 1/127 (1%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKP-VTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH         +AD++ KP +  SR   S  E+ R ITSLPVSPCSSPLRQ
Sbjct  514  GSRTPPVLELHSNRTSFTLSDADHTAKPTIATSRDWRSPSENIRMITSLPVSPCSSPLRQ  573

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y    +S  LSP HP+Y +MGQS YN++DYS+     P T  TLDPW E    + QT G 
Sbjct  574  YGQTHKSSLLSPPHPTYAMMGQSSYNLSDYSSYNKLSPTTSYTLDPWQETTLLKAQTLGS  633

Query  343  SSKTRPI  323
            S + RP 
Sbjct  634  SPRARPF  640



>ref|XP_003602611.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula]
 gb|AES72862.1| MAP kinase kinase kinase [Medicago truncatula]
Length=647

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 84/132 (64%), Gaps = 14/132 (11%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPPA DLH     + S +AD +TK V   SR + S R++ R ITSLPVSPCSSPLRQ
Sbjct  524  GSRTPPASDLHSNRTCIASQDADYATKSVLAASRAVRSPRDNTRMITSLPVSPCSSPLRQ  583

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTT-----ARPNTRSTLDPWLEMAQYRG  359
              PA +SC+LSP HP+Y +MGQ        +TLT+      R NT+ TLDPW E   Y+ 
Sbjct  584  SGPAHKSCFLSPPHPTYAMMGQ--------NTLTSYESYPMRSNTKFTLDPWHETHMYKV  635

Query  358  QTAGRSSKTRPI  323
            +T G S +TR I
Sbjct  636  RTPGASPRTRLI  647



>ref|XP_002309908.2| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
 gb|EEE90358.2| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
Length=610

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPPAL+LH       S + D + KPV  + R + + R+  R ITS+PVSPCSSPLRQ
Sbjct  486  GSRTPPALELHSNRTNANSCDGDFAMKPVVNNIRALKNPRDDGRMITSMPVSPCSSPLRQ  545

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTAR-PNTRSTLDPWLEMAQYRGQTAG  347
            + PA RS YLSP HP++ +MGQS YN++D+S     + P T    D + +    + QT G
Sbjct  546  HGPAHRSSYLSPPHPAFAMMGQSSYNLSDFSLYPIRQGPYTH---DLFFDTPPLKFQTPG  602

Query  346  RSSKTRPI  323
             S +TRPI
Sbjct  603  TSPRTRPI  610



>ref|XP_011022952.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=635

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPPAL+LH       S + D + KPV  + R + + R+  R ITS+PVSPCSSPLRQ
Sbjct  511  GSRTPPALELHSNRTNANSCDGDFAMKPVVNNIRALKNPRDDGRMITSMPVSPCSSPLRQ  570

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTAR-PNTRSTLDPWLEMAQYRGQTAG  347
            + PA RS YLSP HP++ +MGQS YN++D+S     + P T    D + +    + QT G
Sbjct  571  HGPAHRSSYLSPPHPAFAMMGQSSYNLSDFSLYPIRQGPYTH---DLFFDTPPLKFQTPG  627

Query  346  RSSKTRPI  323
             S +TRPI
Sbjct  628  TSPRTRPI  635



>gb|KJB46890.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=654

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+L      + S + D   + +T  SR + + R++AR ITSLPVSPCSSPLR 
Sbjct  530  GSRTPPILELQSIRNNVPSFDGDYEMRGMTTASRALRNPRDNARAITSLPVSPCSSPLR-  588

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y  A +SC+LSP HP+Y  +GQS YN+   S    +RPN +  LDPWL+ +  + QT   
Sbjct  589  YGAAHKSCFLSPPHPAYQFVGQSDYNLCGISG-NASRPNPKYNLDPWLQTSLLKVQTPST  647

Query  343  SSKTRPI  323
              +TRPI
Sbjct  648  PPRTRPI  654



>gb|KJB46891.1| hypothetical protein B456_008G000500 [Gossypium raimondii]
Length=660

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+L      + S + D   + +T  SR + + R++AR ITSLPVSPCSSPLR 
Sbjct  536  GSRTPPILELQSIRNNVPSFDGDYEMRGMTTASRALRNPRDNARAITSLPVSPCSSPLR-  594

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y  A +SC+LSP HP+Y  +GQS YN+   S    +RPN +  LDPWL+ +  + QT   
Sbjct  595  YGAAHKSCFLSPPHPAYQFVGQSDYNLCGISG-NASRPNPKYNLDPWLQTSLLKVQTPST  653

Query  343  SSKTRPI  323
              +TRPI
Sbjct  654  PPRTRPI  660



>gb|KHG03029.1| Mitogen-activated protein kinase kinase kinase 2 [Gossypium arboreum]
Length=660

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 82/127 (65%), Gaps = 4/127 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+L      + S + D   + +T  SR + + R++AR ITSLPVSPCSSPLR 
Sbjct  537  GSRTPPILELQSTRNNVPSFDGDYEMRGMTTTSRALRNPRDNARAITSLPVSPCSSPLR-  595

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y  A +SC+LSP HP+Y  +GQSGY + D S    +RPN + TLDPWL+ +  + QT   
Sbjct  596  YGAAHKSCFLSPPHPAYQFVGQSGY-LCDISG-NASRPNPKYTLDPWLQTSLLKVQTPST  653

Query  343  SSKTRPI  323
              +TRPI
Sbjct  654  PPRTRPI  660



>gb|KHN31145.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=593

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 78/123 (63%), Gaps = 11/123 (9%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP +  H     + SL+ D +TKPV + SR   S R++ R ITSLPVSPCSSPLRQ
Sbjct  474  GSRTPPPVLDHSNRTSLTSLDGDYATKPVPVTSRAERSPRDNTRMITSLPVSPCSSPLRQ  533

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTT--ARPNTRSTLDPWLEMAQYRGQTA  350
            YEPA +SC+LSP HP+Y LMGQ        +TL +   R N   TLDP+ E + Y+  T 
Sbjct  534  YEPAHKSCFLSPPHPTYTLMGQ--------NTLPSYPVRSNATFTLDPFQETSFYKAHTP  585

Query  349  GRS  341
            G S
Sbjct  586  GGS  588



>ref|XP_003523226.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform 1 [Glycine max]
Length=601

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 78/123 (63%), Gaps = 11/123 (9%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP +  H     + SL+ D +TKPV + SR   S R++ R ITSLPVSPCSSPLRQ
Sbjct  482  GSRTPPPVLDHSNRTSLTSLDGDYATKPVPVTSRAERSPRDNTRMITSLPVSPCSSPLRQ  541

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTT--ARPNTRSTLDPWLEMAQYRGQTA  350
            YEPA +SC+LSP HP+Y LMGQ        +TL +   R N   TLDP+ E + Y+  T 
Sbjct  542  YEPAHKSCFLSPPHPTYTLMGQ--------NTLPSYPVRSNATFTLDPFQETSFYKAHTP  593

Query  349  GRS  341
            G S
Sbjct  594  GGS  596



>ref|XP_003526863.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=616

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 77/123 (63%), Gaps = 11/123 (9%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP +  H     + S + D +TKP+ + SR + S R++ R ITSLPVSPCSSPLRQ
Sbjct  497  GSRTPPPVLDHSNRTSLTSFDGDYATKPIPVTSRTVRSPRDNTRMITSLPVSPCSSPLRQ  556

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTT--ARPNTRSTLDPWLEMAQYRGQTA  350
            Y PA +SC+LSP HP+Y LMGQ        +TL +   R N   TLDP+ E A Y+  T 
Sbjct  557  YGPAHKSCFLSPPHPTYTLMGQ--------NTLPSYPVRSNATFTLDPFHETAFYKAHTP  608

Query  349  GRS  341
            G S
Sbjct  609  GGS  611



>ref|XP_007137724.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
 gb|ESW09718.1| hypothetical protein PHAVU_009G150500g [Phaseolus vulgaris]
Length=612

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 76/123 (62%), Gaps = 11/123 (9%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP +  H     + S + D +TKPV + SR + S R++ R ITSLPVSPCSSPLRQ
Sbjct  493  GSRTPPPVLDHSNRTSINSFDGDYATKPVPVTSRAVRSPRDNTRMITSLPVSPCSSPLRQ  552

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTT--ARPNTRSTLDPWLEMAQYRGQTA  350
            Y PA +SC+LSP HPSY LMGQ        +TL +   R N    LDP+ E + Y+  T 
Sbjct  553  YGPAHKSCFLSPPHPSYTLMGQ--------NTLPSYPVRSNATFALDPFQEKSFYKAHTP  604

Query  349  GRS  341
            G S
Sbjct  605  GGS  607



>ref|XP_008227651.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Prunus mume]
Length=643

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTI-SRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+LH     +   +AD++ KP  + SR + S RE+ R ITSLPVSP SSPLRQ
Sbjct  517  GSRTPPILELHSNRTSITLSDADHTAKPTAVTSRAVRSPRENIRMITSLPVSPSSSPLRQ  576

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y P  ++ +LSP HP+Y +MGQS YN++D S+  T  PNT  TLDPW + +  +  T G 
Sbjct  577  YGPTHKNGFLSPPHPTYAMMGQSSYNLSDLSSYNTLSPNTSYTLDPWQDTSILKAHTPGG  636

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  637  SPRTRPI  643



>ref|XP_010270404.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Nelumbo nucifera]
Length=640

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQ  524
            G+ + P  + H       SL  D + KPV T SR +  SR+SAR   SLPVSPCSSPLRQ
Sbjct  515  GNHSLPTSEFHFKGINTTSLHGDYAMKPVVTSSRALKISRDSARVNMSLPVSPCSSPLRQ  574

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            +  A RS +LSP H SYP + QS Y + DYS L+T RPNT  T D W +  Q R  T G 
Sbjct  575  HCTANRSYFLSPPHLSYPFIAQSSYGMTDYSALST-RPNTNYTADVWWDSPQIRTPTPGG  633

Query  343  SSKTRP  326
            S + RP
Sbjct  634  SPRARP  639



>ref|XP_010270403.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Nelumbo nucifera]
Length=641

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = -2

Query  646  SLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYP  470
            SL  D + KPV T SR +  SR+SAR   SLPVSPCSSPLRQ+  A RS +LSP H SYP
Sbjct  534  SLHGDYAMKPVVTSSRALKISRDSARVNMSLPVSPCSSPLRQHCTANRSYFLSPPHLSYP  593

Query  469  LMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTRP  326
             + QS Y + DYS L+T RPNT  T D W +  Q R  T G S + RP
Sbjct  594  FIAQSSYGMTDYSALST-RPNTNYTADVWWDSPQIRTPTPGGSPRARP  640



>ref|XP_008441055.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Cucumis melo]
Length=619

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            G +T P LD HP    +   + D  T P T S    S R + R ITSLPVSPCSSPLR Y
Sbjct  498  GIQTSPLLDRHPNRKSISICDGDYVTNP-TFSSRAPSPRGNGRLITSLPVSPCSSPLRSY  556

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
             P  +SCYLSP H SY  +GQSGYN+N+Y+  T  RPNT  TLDP  E +  + QT
Sbjct  557  GPTHQSCYLSPPHTSYMGVGQSGYNLNEYAYNT--RPNTLFTLDPLRESSLLKVQT  610



>ref|XP_008441054.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Cucumis melo]
Length=625

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            G +T P LD HP    +   + D  T P T S    S R + R ITSLPVSPCSSPLR Y
Sbjct  504  GIQTSPLLDRHPNRKSISICDGDYVTNP-TFSSRAPSPRGNGRLITSLPVSPCSSPLRSY  562

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
             P  +SCYLSP H SY  +GQSGYN+N+Y+  T  RPNT  TLDP  E +  + QT
Sbjct  563  GPTHQSCYLSPPHTSYMGVGQSGYNLNEYAYNT--RPNTLFTLDPLRESSLLKVQT  616



>ref|XP_004171417.1| PREDICTED: protein kinase wis1-like [Cucumis sativus]
Length=623

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            G +T P LD HP    +   + D  T P T S    S R + R ITSLPVSPCSSPLR Y
Sbjct  502  GIQTSPLLDRHPNRKSISICDGDYVTNP-TFSSRAPSPRGNGRLITSLPVSPCSSPLRSY  560

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
             P  +SCYLSP H SY  +GQSGYN+N+Y+  T  RPNT  TLDP  E +  + QT
Sbjct  561  GPTHQSCYLSPPHTSYMGVGQSGYNLNEYAYNT--RPNTLFTLDPSRESSLLKVQT  614



>ref|XP_004148657.1| PREDICTED: serine/threonine-protein kinase KIC1-like [Cucumis 
sativus]
 gb|KGN48350.1| hypothetical protein Csa_6G483320 [Cucumis sativus]
Length=623

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            G +T P LD HP    +   + D  T P T S    S R + R ITSLPVSPCSSPLR Y
Sbjct  502  GIQTSPLLDRHPNRKSISICDGDYVTNP-TFSSRAPSPRGNGRLITSLPVSPCSSPLRSY  560

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
             P  +SCYLSP H SY  +GQSGYN+N+Y+  T  RPNT  TLDP  E +  + QT
Sbjct  561  GPTHQSCYLSPPHTSYMGVGQSGYNLNEYAYNT--RPNTLFTLDPSRESSLLKVQT  614



>ref|XP_010090849.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
 gb|EXB40974.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
Length=616

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 76/126 (60%), Gaps = 18/126 (14%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTPP L+              +   P + +R   S R++ARTI SLPVSPCSSPLRQY
Sbjct  509  GSRTPPVLE--------------SVVAPSSGTR---SPRDNARTIASLPVSPCSSPLRQY  551

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRS  341
                R+ +LSP HP++ +MGQ+GYN+N YS+    R N   TLDP  E+   + QT G S
Sbjct  552  GATHRNFFLSPPHPTFAMMGQNGYNMNAYSSYPL-RSNVLYTLDPLREVPLLKAQTPGGS  610

Query  340  SKTRPI  323
             +TRPI
Sbjct  611  PRTRPI  616



>ref|XP_007048387.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
 gb|EOX92544.1| Mitogen-activated protein kinase kinase kinase 3 [Theobroma cacao]
Length=668

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVT-ISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+L      + S + D  T+ V+  SR + S R++ARTITSLPVSP SSPLR 
Sbjct  544  GSRTPPILELQSNRNNILSFDGDYGTRGVSATSRALRSPRDNARTITSLPVSPSSSPLR-  602

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGR  344
            Y PA +SC+ SP HP+Y  +GQSGYN  D+S  +  R + R T DPWLE +Q + QT G 
Sbjct  603  YAPAHKSCFYSPPHPAYQFVGQSGYNFGDFSG-SALRTSPRYTHDPWLESSQLKVQTPGT  661

Query  343  SSKTRPI  323
            S +TRPI
Sbjct  662  SPRTRPI  668



>ref|XP_011099741.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Sesamum indicum]
Length=625

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTP AL++H    +  S + D +++ +T+ R +IS R++ RTITSLPVSP SSPLR  
Sbjct  502  GSRTPTALEMHSSRMHNSSSDRDEASR-LTVPRTLISPRDNTRTITSLPVSPSSSPLRHD  560

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
              A RS +LSP HPSY  +GQ  +N +D+S   + RPN+RS+ DPWLE+ Q+R QT
Sbjct  561  GAAHRSFFLSPPHPSYTSVGQGNHNYSDHSVFPS-RPNSRSSFDPWLEIPQFRSQT  615



>ref|XP_010260483.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Nelumbo nucifera]
Length=479

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = -2

Query  646  SLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYP  470
            SL  D   K V T SR   SSR+S R   SLPVSPCSSPLR +  A RS +LSP HPSYP
Sbjct  356  SLHGDYGMKQVVTSSRAFKSSRDSVRLNVSLPVSPCSSPLRNHGTANRSYFLSPPHPSYP  415

Query  469  LMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRS  341
               QSGY   DYS L+T RPNT    D W +  Q R  T G S
Sbjct  416  FGAQSGYGPTDYSALST-RPNTNFPTDAWWDNPQPRTTTPGGS  457



>ref|XP_010260482.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Nelumbo nucifera]
Length=664

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = -2

Query  646  SLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYP  470
            SL  D   K V T SR   SSR+S R   SLPVSPCSSPLR +  A RS +LSP HPSYP
Sbjct  541  SLHGDYGMKQVVTSSRAFKSSRDSVRLNVSLPVSPCSSPLRNHGTANRSYFLSPPHPSYP  600

Query  469  LMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRS  341
               QSGY   DYS L+T RPNT    D W +  Q R  T G S
Sbjct  601  FGAQSGYGPTDYSALST-RPNTNFPTDAWWDNPQPRTTTPGGS  642



>ref|XP_010260481.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Nelumbo nucifera]
Length=665

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = -2

Query  646  SLEADNSTKPV-TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYP  470
            SL  D   K V T SR   SSR+S R   SLPVSPCSSPLR +  A RS +LSP HPSYP
Sbjct  542  SLHGDYGMKQVVTSSRAFKSSRDSVRLNVSLPVSPCSSPLRNHGTANRSYFLSPPHPSYP  601

Query  469  LMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRS  341
               QSGY   DYS L+T RPNT    D W +  Q R  T G S
Sbjct  602  FGAQSGYGPTDYSALST-RPNTNFPTDAWWDNPQPRTTTPGGS  643



>gb|KHN29245.1| Mitogen-activated protein kinase kinase kinase ANP1 [Glycine 
soja]
Length=596

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + SL+ D ++KP   + R + SSR++ R ITSLPVSP SSPLR+
Sbjct  470  GSRTPPVLESHSNRTSITSLDGDYASKPALAAPRALRSSRDNTRIITSLPVSPSSSPLRR  529

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            YEP  +SC+ SP HP+Y  MGQS Y +ND S+    R N    LDPW E ++YR  T
Sbjct  530  YEPMHQSCFFSPPHPAYTTMGQSSYTLNDRSSYPM-RSNATFALDPWHETSRYRANT  585



>ref|XP_006585362.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Glycine max]
Length=596

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + SL+ D ++KP   + R + SSR++ R ITSLPVSP SSPLR+
Sbjct  470  GSRTPPVLESHSNRTSITSLDGDYASKPALAAPRALRSSRDNTRIITSLPVSPSSSPLRR  529

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            YEP  +SC+ SP HP+Y  MGQS Y +ND S+      N    LDPW E ++YR  T
Sbjct  530  YEPMHQSCFFSPPHPAYTTMGQSSYTLNDRSSYPMTS-NATFALDPWHETSRYRANT  585



>dbj|BAD94298.1| MEK kinase MAP3Ka [Arabidopsis thaliana]
Length=162

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  56   YPGRLSHDNYAK-QPLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  114

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTR  329
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT     ++R
Sbjct  115  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQTPNSPLRSR  160



>ref|XP_002891761.1| MEK kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68020.1| MEK kinase [Arabidopsis lyrata subsp. lyrata]
Length=603

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 8/113 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  497  YPGRLSHDNYPRQ-PLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  555

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTRPI  323
            SY   GQ SGYN+ +++    A P  R   D  +E A +RGQT+    ++R +
Sbjct  556  SYAFPGQDSGYNLAEFA----ASP-FRMKKDTMMEPASFRGQTSNFPLRSRLV  603



>ref|NP_001185211.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32963.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=608

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  K   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  503  YPGRLSHDNYAKQ-PLSRTIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  561

Query  475  YPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  562  YAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  598



>dbj|BAD12492.1| mitogen-activated kinase kinase kinase alpha [Lotus japonicus]
Length=627

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + +L+ D +TKP   + R + + R+S RTITSLPVSP SSPLRQ
Sbjct  501  GSRTPPVLEPHSNRSSITTLDVDYATKPALAAVRTLRNPRDSTRTITSLPVSPSSSPLRQ  560

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            + P   S + SP HPSY +MGQS Y  N+      AR N   TLDPWLE ++Y+  T
Sbjct  561  HRPTHNSPFFSPPHPSYAMMGQSSYTSNNMHK-NPARSNATLTLDPWLETSRYKAHT  616



>ref|XP_003525123.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=600

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + SL+ D ++KP   + R + S R++ R ITSLPVSP SSPLR+
Sbjct  474  GSRTPPVLESHSNRTSITSLDGDFASKPALAAPRALRSPRDNTRMITSLPVSPSSSPLRR  533

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y P  +SC+ SP HP+Y +MGQS Y +ND S+      N    LDPW E ++YR  T
Sbjct  534  YGPTHQSCFFSPPHPAYTIMGQSSYTLNDISSYPMTS-NATFALDPWHETSRYRANT  589



>gb|KHN34079.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=600

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + SL+ D ++KP   + R + S R++ R ITSLPVSP SSPLR+
Sbjct  474  GSRTPPVLESHSNRTSITSLDGDFASKPALAAPRALRSPRDNTRMITSLPVSPSSSPLRR  533

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y P  +SC+ SP HP+Y +MGQS Y +ND S+      N    LDPW E ++YR  T
Sbjct  534  YGPTHQSCFFSPPHPAYTIMGQSSYTLNDISSYPMTS-NATFALDPWHETSRYRANT  589



>ref|XP_010479928.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=607

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  +   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  502  YPGRLSHDNYQRQ-PLSRAIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  560

Query  475  YPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   G  SGYN+ ++     A    R   D  +E + +RGQT
Sbjct  561  YAFPGLDSGYNLAEF-----ASSPFRMKKDTMIEPSSFRGQT  597



>ref|XP_010479930.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Camelina sativa]
Length=606

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  +   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  501  YPGRLSHDNYQRQ-PLSRAIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  559

Query  475  YPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   G  SGYN+ ++     A    R   D  +E + +RGQT
Sbjct  560  YAFPGLDSGYNLAEF-----ASSPFRMKKDTMIEPSSFRGQT  596



>ref|XP_002306242.1| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
 gb|EEE93238.1| mitogen-activated protein kinase kinase kinase [Populus trichocarpa]
Length=594

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 74/128 (58%), Gaps = 6/128 (5%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS--RPMISSRESARTITSLPVSPCSSPLR  527
            GSRTPP LDLH       S + D + KP   S  R + + R+    ITS+PVSPCSSPLR
Sbjct  471  GSRTPPVLDLHSNRTSANSWDGDFAMKPGVNSNTRALKNPRDDGGMITSMPVSPCSSPLR  530

Query  526  QYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAG  347
            Q+  A R+ Y SP  P Y ++GQS Y+V+D S L   R  T  T D + +    + QT G
Sbjct  531  QHGSAYRN-YFSPHSP-YAMVGQSSYHVSDPS-LHPIRQTTY-THDLFFDTTLLKVQTPG  586

Query  346  RSSKTRPI  323
             S +TRPI
Sbjct  587  TSPRTRPI  594



>ref|NP_849803.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 ref|NP_001031181.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AAF78433.1|AC018748_12 Identical to MEK kinase from Arabidopsis thaliana gb|U58918 and 
contains protein kinase PF|00069 domain. ESTs gb|Z33980, 
gb|T20498, gb|AA650775 come from this gene [Arabidopsis thaliana]
 gb|AAG51965.1|AC024260_3 MEK kinase MAP3Ka, putative; 84794-81452 [Arabidopsis thaliana]
 gb|AAM98147.1| MAP3K alpha protein kinase, putative [Arabidopsis thaliana]
 gb|AAO00958.1| MAP3K alpha protein kinase, putative [Arabidopsis thaliana]
 gb|AEE32961.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32962.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=608

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  502  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  560

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  561  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  598



>ref|NP_564635.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32960.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=609

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  503  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  561

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  562  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  599



>gb|AAL31904.1|AF419572_1 At1g53570/F22G10_18 [Arabidopsis thaliana]
Length=609

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  503  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  561

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  562  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  599



>ref|NP_001185212.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
 gb|AEE32964.1| mitogen-activated protein kinase kinase kinase 3 [Arabidopsis 
thaliana]
Length=583

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  477  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  535

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  536  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  573



>ref|XP_010547899.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Tarenaya hassleriana]
Length=599

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = -2

Query  607  SRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYS  431
            SR + S RE+ R I SLPVSPCSSPLRQ  PA +SC+LSP HPS+P  GQ S YN+++++
Sbjct  504  SRAIKSPRENVRAIASLPVSPCSSPLRQNGPAYKSCFLSPHHPSFPFAGQDSNYNLSEFA  563

Query  430  T----LTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTR  329
                   TA  N ++ ++P    + +R QT  +  ++R
Sbjct  564  ARPFRANTAYTNDKTMVEP----SMFRPQTPDKFMRSR  597



>ref|XP_006307045.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
 gb|EOA39943.1| hypothetical protein CARUB_v10008633mg [Capsella rubella]
Length=600

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 12/105 (11%)
 Frame = -2

Query  655  YMGSLEADN-STKPV--TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQ  485
            Y G L  DN   +PV  TI  P   SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP 
Sbjct  494  YPGRLSHDNYQRQPVSRTIKSP---SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPP  550

Query  484  HPSYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            HPSY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  551  HPSYLFPGQDSGYNLAEFA----ASP-FRVKKDTMIEPSSFRAQT  590



>ref|XP_010530601.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X5 [Tarenaya hassleriana]
Length=597

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  607  SRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYS  431
            SR   S RE+ RTI SLPVSPCSSPLRQ+ PA +SC+LSP HPS+   GQ S YN+ D++
Sbjct  503  SRATKSPRENIRTIASLPVSPCSSPLRQHGPAYKSCFLSPPHPSFVFAGQDSNYNLVDFA  562

Query  430  TLTTARPNTRSTLDPWLEMAQYRGQT  353
                 R NT  T D  +E +  R QT
Sbjct  563  A-RPFRANTAYTNDTTIEPSMVRAQT  587



>ref|XP_010530598.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Tarenaya hassleriana]
Length=600

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  607  SRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYS  431
            SR   S RE+ RTI SLPVSPCSSPLRQ+ PA +SC+LSP HPS+   GQ S YN+ D++
Sbjct  506  SRATKSPRENIRTIASLPVSPCSSPLRQHGPAYKSCFLSPPHPSFVFAGQDSNYNLVDFA  565

Query  430  TLTTARPNTRSTLDPWLEMAQYRGQT  353
                 R NT  T D  +E +  R QT
Sbjct  566  A-RPFRANTAYTNDTTIEPSMVRAQT  590



>ref|XP_010479927.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=607

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  501  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  559

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ ++     A    R   D  +E + +RGQT
Sbjct  560  SYAFPGLDSGYNLAEF-----ASSPFRMKKDTMIEPSSFRGQT  597



>ref|XP_010479926.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=608

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  502  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  560

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ ++     A    R   D  +E + +RGQT
Sbjct  561  SYAFPGLDSGYNLAEF-----ASSPFRMKKDTMIEPSSFRGQT  598



>gb|AAD10848.1| MEK kinase [Arabidopsis thaliana]
Length=608

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  502  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRPITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  560

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  561  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  598



>ref|XP_007159841.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
 gb|ESW31835.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
Length=608

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS-RPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H     + SL+ D ++KP   + R + S R+S R ITSLPVSP SSPLR+
Sbjct  482  GSRTPPVLESHSNRTSITSLDGDYASKPALAAPRALRSPRDSTRMITSLPVSPSSSPLRR  541

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y P  +SC+ SP HP+Y +MGQS Y +ND  +    R N   TLDP  E ++Y+  T
Sbjct  542  YGPTHQSCFFSPPHPAYTIMGQSSYTLNDACSF-PVRSNATLTLDPRHETSRYKANT  597



>emb|CAA08994.1| MAP3K alpha protein kinase [Arabidopsis thaliana]
Length=582

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  K   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  476  YPGRLSHDNYAKQ-PLSRTIKSPSRENVRPITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  534

Query  478  SYPLMGQ-SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   GQ SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  535  SYAFPGQDSGYNLAEFA----ASP-FRMKKDAMMEPSSFRTQT  572



>ref|XP_010530597.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYSTLTTAR  413
            SRE+ RTI SLPVSPCSSPLRQ+ PA +SC+LSP HPS+   GQ S YN+ D++     R
Sbjct  513  SRENIRTIASLPVSPCSSPLRQHGPAYKSCFLSPPHPSFVFAGQDSNYNLVDFAA-RPFR  571

Query  412  PNTRSTLDPWLEMAQYRGQT  353
             NT  T D  +E +  R QT
Sbjct  572  ANTAYTNDTTIEPSMVRAQT  591



>ref|XP_010530599.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Tarenaya hassleriana]
Length=599

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYSTLTTAR  413
            SRE+ RTI SLPVSPCSSPLRQ+ PA +SC+LSP HPS+   GQ S YN+ D++     R
Sbjct  511  SRENIRTIASLPVSPCSSPLRQHGPAYKSCFLSPPHPSFVFAGQDSNYNLVDFAA-RPFR  569

Query  412  PNTRSTLDPWLEMAQYRGQT  353
             NT  T D  +E +  R QT
Sbjct  570  ANTAYTNDTTIEPSMVRAQT  589



>ref|XP_010530600.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Tarenaya hassleriana]
Length=598

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGYNVNDYSTLTTAR  413
            SRE+ RTI SLPVSPCSSPLRQ+ PA +SC+LSP HPS+   GQ S YN+ D++     R
Sbjct  510  SRENIRTIASLPVSPCSSPLRQHGPAYKSCFLSPPHPSFVFAGQDSNYNLVDFAA-RPFR  568

Query  412  PNTRSTLDPWLEMAQYRGQT  353
             NT  T D  +E +  R QT
Sbjct  569  ANTAYTNDTTIEPSMVRAQT  588



>ref|XP_010501012.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Camelina sativa]
Length=612

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  +   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  507  YPGRLSHDNYQRQ-PLSRAIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  565

Query  475  YPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  566  YAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSSFRTQT  602



>ref|XP_010501011.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=613

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  +   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  508  YPGRLSHDNYQRQ-PLSRAIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  566

Query  475  YPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  567  YAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSSFRTQT  603



>ref|XP_010462255.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Camelina sativa]
Length=596

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPS  476
            Y G L  DN  +   +SR + S RE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPS
Sbjct  491  YPGRLSHDNYQRQ-PLSRAIKSPRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPS  549

Query  475  YPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  550  YAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSGFRTQT  586



>ref|XP_010547898.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Tarenaya hassleriana]
Length=599

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = -2

Query  619  PVTISRPMISS--RESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGY  449
            P+ +S   I S  RE+ R I SLPVSPCSSPLRQ  PA +SC+LSP HPS+P  GQ S Y
Sbjct  498  PLAVSSRAIKSPSRENVRAIASLPVSPCSSPLRQNGPAYKSCFLSPHHPSFPFAGQDSNY  557

Query  448  NVNDYST----LTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTR  329
            N+++++       TA  N ++ ++P    + +R QT  +  ++R
Sbjct  558  NLSEFAARPFRANTAYTNDKTMVEP----SMFRPQTPDKFMRSR  597



>ref|XP_010547897.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Tarenaya hassleriana]
Length=600

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 11/104 (11%)
 Frame = -2

Query  619  PVTISRPMISS--RESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SGY  449
            P+ +S   I S  RE+ R I SLPVSPCSSPLRQ  PA +SC+LSP HPS+P  GQ S Y
Sbjct  499  PLAVSSRAIKSPSRENVRAIASLPVSPCSSPLRQNGPAYKSCFLSPHHPSFPFAGQDSNY  558

Query  448  NVNDYST----LTTARPNTRSTLDPWLEMAQYRGQTAGRSSKTR  329
            N+++++       TA  N ++ ++P    + +R QT  +  ++R
Sbjct  559  NLSEFAARPFRANTAYTNDKTMVEP----SMFRPQTPDKFMRSR  598



>ref|XP_011031200.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=670

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTIS--RPMISSRESARTITSLPVSPCSSPLR  527
            GSRTPP LDLH       S + D + KP   S  R + + R+    ITS+PVSPCSSPLR
Sbjct  547  GSRTPPVLDLHSNRTSAHSWDGDFAMKPGVNSNTRALKNPRDDGGMITSMPVSPCSSPLR  606

Query  526  QYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTAG  347
            Q+  A R+ YLSP  P Y ++GQS Y+++D   L      T  T D + +    + QT G
Sbjct  607  QHGSAYRN-YLSPHSP-YAMVGQSSYHLSD--PLLHPIRQTTYTHDLFFDTTLLKVQTPG  662

Query  346  RSSKTRPI  323
             S + RPI
Sbjct  663  TSPRRRPI  670



>ref|XP_010501010.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=613

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  507  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  565

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  566  SYAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSSFRTQT  603



>ref|XP_010501009.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=614

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  508  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  566

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  567  SYAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSSFRTQT  604



>ref|XP_010462253.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Camelina sativa]
Length=597

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  491  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  549

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  550  SYAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSGFRTQT  587



>ref|XP_010462254.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Camelina sativa]
Length=596

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = -2

Query  655  YMGSLEADNSTKPVTISRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHP  479
            Y G L  DN  +   +SR + S SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HP
Sbjct  490  YPGRLSHDNYQRQ-PLSRAIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHP  548

Query  478  SYPLMG-QSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            SY   G  SGYN+ +++    A P  R   D  +E + +R QT
Sbjct  549  SYAFPGLDSGYNLAEFA----ASP-FRMKKDTMIEPSGFRTQT  586



>ref|XP_010025592.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X2 [Eucalyptus grandis]
 gb|KCW62309.1| hypothetical protein EUGRSUZ_H04962 [Eucalyptus grandis]
Length=649

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 78/147 (53%), Gaps = 32/147 (22%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYM-------------------------GSL---EADNSTKPVTI-  608
            G+RTPPALDLHP  G +                         GS+   E D + +P  + 
Sbjct  494  GTRTPPALDLHPNRGNVTPGTVTPPEVDYPRQPVGMVSLSNRGSMTPPEVDYTRRPAGML  553

Query  607  --SRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDY  434
              SR + S R   R ITSLPVSP SSPLR +  A+RS +LSP HPSY  +G SGY +NDY
Sbjct  554  SPSRALRSPRNDVRMITSLPVSPSSSPLRNFGNAQRSGFLSPPHPSYANVGHSGYTLNDY  613

Query  433  STLTTARPNTRSTLDPWLEMAQYRGQT  353
                T RPNTR  LDPW E   +  +T
Sbjct  614  PIYPT-RPNTRQPLDPWHETPLFSSRT  639



>gb|KFK39944.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=608

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = -2

Query  625  TKPVTISRPMIS--SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-S  455
            T+P+ +S  +I   SRE+ R ITSLPVSPCSSPLRQ  PA +SCYLSP HPSY   GQ S
Sbjct  510  TQPLAVSSRVIKNPSRENMRAITSLPVSPCSSPLRQLGPAYKSCYLSPPHPSYSFPGQDS  569

Query  454  GYNVNDYST  428
            GYN  +++ 
Sbjct  570  GYNPVEFAV  578



>gb|KFK39942.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=609

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = -2

Query  625  TKPVTISRPMIS--SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-S  455
            T+P+ +S  +I   SRE+ R ITSLPVSPCSSPLRQ  PA +SCYLSP HPSY   GQ S
Sbjct  511  TQPLAVSSRVIKNPSRENMRAITSLPVSPCSSPLRQLGPAYKSCYLSPPHPSYSFPGQDS  570

Query  454  GYNVNDYST  428
            GYN  +++ 
Sbjct  571  GYNPVEFAV  579



>gb|KFK39943.1| hypothetical protein AALP_AA3G309800 [Arabis alpina]
Length=607

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = -2

Query  625  TKPVTISRPMISS-RESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQ-SG  452
            T+P+ +S  +I + RE+ R ITSLPVSPCSSPLRQ  PA +SCYLSP HPSY   GQ SG
Sbjct  510  TQPLAVSSRVIKNPRENMRAITSLPVSPCSSPLRQLGPAYKSCYLSPPHPSYSFPGQDSG  569

Query  451  YNVNDYST  428
            YN  +++ 
Sbjct  570  YNPVEFAV  577



>ref|XP_003630274.1| Protein kinase, putative [Medicago truncatula]
 gb|AET04750.1| MAP kinase kinase kinase [Medicago truncatula]
Length=701

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTK-PVTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ +     + S + D +TK  +   R   S R+ +RTITSLPVSP SSPLRQ
Sbjct  575  GSRTPPVLEPNSNRRSITSFDGDYATKSAIAAPRTTRSPRDHSRTITSLPVSPSSSPLRQ  634

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y    RSC+ SP HPSY ++GQ+ Y +ND  +    R N   TLDPW E ++Y+  T
Sbjct  635  YGQEHRSCFYSPPHPSYTILGQNSYTLNDTPSY-PVRSNAPFTLDPWHETSRYKAHT  690



>ref|XP_010025591.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
isoform X1 [Eucalyptus grandis]
Length=650

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 79/148 (53%), Gaps = 33/148 (22%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYM-------------------------GSL---EADNSTKPVTI-  608
            G+RTPPALDLHP  G +                         GS+   E D + +P  + 
Sbjct  494  GTRTPPALDLHPNRGNVTPGTVTPPEVDYPRQPVGMVSLSNRGSMTPPEVDYTRRPAGML  553

Query  607  --SRPMIS-SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVND  437
              SR + S SR   R ITSLPVSP SSPLR +  A+RS +LSP HPSY  +G SGY +ND
Sbjct  554  SPSRALRSPSRNDVRMITSLPVSPSSSPLRNFGNAQRSGFLSPPHPSYANVGHSGYTLND  613

Query  436  YSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y    T RPNTR  LDPW E   +  +T
Sbjct  614  YPIYPT-RPNTRQPLDPWHETPLFSSRT  640



>ref|XP_006409679.1| hypothetical protein EUTSA_v10022608mg [Eutrema salsugineum]
 gb|ESQ51132.1| hypothetical protein EUTSA_v10022608mg [Eutrema salsugineum]
Length=603

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 6/79 (8%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPL-MGQSGYNVNDYSTLTTAR  413
            SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPSY   +  SGYN+ +++    A 
Sbjct  519  SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPVQDSGYNLAEFA----AS  574

Query  412  PNTRSTLDPWLEMAQYRGQ  356
            P  R   D  +E + YR Q
Sbjct  575  P-FRFKKDTMMEPSSYRAQ  592



>ref|XP_004503937.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cicer arietinum]
Length=625

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTK-PVTISRPMISSRESARTITSLPVSPCSSPLRQ  524
            GSRTPP L+ H       SL+ D +TK  +   R + S R+  R ITSLPVSP SSPLR 
Sbjct  501  GSRTPPVLESHSNRRTKTSLDGDYATKSAIAAPRAIRSPRDHTRMITSLPVSPSSSPLR-  559

Query  523  YEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
            Y P  RSC+ SP HP+Y LMGQ+   +  Y T   AR N   TLDPW E ++Y+  T
Sbjct  560  YGPEHRSCFYSPPHPTYTLMGQNSNTL--YDTPYPARSNATFTLDPWHETSRYKAHT  614



>emb|CDX89612.1| BnaC03g45260D [Brassica napus]
Length=579

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPL-MGQSGYNVNDYSTLTTAR  413
            SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPSY   + +SGYN       +  R
Sbjct  493  SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPVQESGYNHQAEFAASPFR  552

Query  412  PNTRSTLDPWLEMAQYRGQ  356
                ++L   +E + YR Q
Sbjct  553  FKKDTSL---IEPSSYRAQ  568



>ref|XP_009136221.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Brassica rapa]
Length=592

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPL-MGQSGYNVNDYSTLTTAR  413
            SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPSY   + +SGYN       +  R
Sbjct  506  SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPVQESGYNHQAEFAASPFR  565

Query  412  PNTRSTLDPWLEMAQYRGQ  356
                ++L   +E + YR Q
Sbjct  566  FKKDTSL---IEPSSYRAQ  581



>ref|XP_007159840.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
 gb|ESW31834.1| hypothetical protein PHAVU_002G272100g [Phaseolus vulgaris]
Length=592

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (52%), Gaps = 16/116 (14%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTPP L+ H     + SL+ D ++KP   +   + S                SPLR+Y
Sbjct  482  GSRTPPVLESHSNRTSITSLDGDYASKPALAAPRALRS---------------PSPLRRY  526

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQT  353
             P  +SC+ SP HP+Y +MGQS Y +ND  +    R N   TLDP  E ++Y+  T
Sbjct  527  GPTHQSCFFSPPHPAYTIMGQSSYTLNDACSFPV-RSNATLTLDPRHETSRYKANT  581



>emb|CAA08995.1| MAP3K alpha 1 protein kinase [Brassica napus]
Length=591

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPL-MGQSGYNVNDYSTLTTAR  413
            SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPSY   + +SGYN       +  R
Sbjct  505  SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPVQESGYNHQAEFAASPFR  564

Query  412  PNTRSTLDPWLEMAQYRGQ  356
                ++L   +E + YR Q
Sbjct  565  FKKDTSL---IEPSSYRAQ  580



>emb|CDX93120.1| BnaA03g38420D [Brassica napus]
Length=593

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  589  SRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPL-MGQSGYNVNDYSTLTTAR  413
            SRE+ R ITSLPVSPCSSPLRQ  PA +SC+LSP HPSY   + +SGYN       +  R
Sbjct  507  SRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPVQESGYNHQAEFAASPFR  566

Query  412  PNTRSTLDPWLEMAQYRGQ  356
                ++L   +E + YR Q
Sbjct  567  FKKDTSL---IEPSSYRAQ  582



>ref|XP_010680195.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Beta vulgaris subsp. vulgaris]
Length=647

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 70/117 (60%), Gaps = 5/117 (4%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            G R P  L++HP    + S + DN  +P      +  +R++ R+I SLPVSP SSPL + 
Sbjct  524  GRRKPQPLEIHPRRKSISSYDTDNIKRPGV---AIFEARDNPRSIMSLPVSPSSSPLHRL  580

Query  520  EPARRSCYLSPQHPSYPLMGQSGYNVNDYSTL-TTARPNTRSTLDPWLEMAQYRGQT  353
             PA +SC LSP HPSY   GQS YN+ND+S   T  R     TLDPW+E + ++ QT
Sbjct  581  VPASKSCLLSPPHPSYAWPGQSSYNINDHSISPTRGRTTAGFTLDPWIE-STFKTQT  636



>gb|ACN30597.1| unknown [Zea mays]
 gb|ADM88868.1| mitogen activated protein kinase kinase kinase [Zea mays]
Length=352

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + YN +N+   L   RP++
Sbjct  273  NVRMNMSLPVSPCSSPLRQYRQSNRSCLRSPPHPAYS-AGAANYNPINN--ALYPTRPSS  329

Query  403  RSTLDPWLEMAQYRGQT  353
              T DPWLE++Q + QT
Sbjct  330  GLT-DPWLEISQVKTQT  345



>ref|NP_001130692.1| mitogen activated protein kinase kinase kinase [Zea mays]
 gb|ACF79010.1| unknown [Zea mays]
Length=604

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + YN +N+   L   RP++
Sbjct  525  NVRMNMSLPVSPCSSPLRQYRQSNRSCLRSPPHPAYS-AGAANYNPINN--ALYPTRPSS  581

Query  403  RSTLDPWLEMAQYRGQT  353
              T DPWLE++Q + QT
Sbjct  582  GLT-DPWLEISQVKTQT  597



>gb|ACY01925.1| mitogen activated protein kinase kinase kinase kkk 3 [Beta vulgaris]
Length=680

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 5/110 (5%)
 Frame = -2

Query  679  LDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSC  500
            L++HP    + S + +N  +P      +  +R++ R+I SLPVSP SSPL +  PA +SC
Sbjct  564  LEIHPRRKSISSYDTENIKRPGV---AIFEARDNPRSIMSLPVSPSSSPLHRLVPASKSC  620

Query  499  YLSPQHPSYPLMGQSGYNVNDYSTL-TTARPNTRSTLDPWLEMAQYRGQT  353
             LSP HPSY   GQS YN+ND+S   T  R     TLDPW+E + ++ QT
Sbjct  621  LLSPPHPSYAWPGQSSYNINDHSISPTRGRTTAGFTLDPWIE-STFKTQT  669



>ref|XP_004975671.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Setaria italica]
Length=727

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  S+PVSPCSSPLRQ++ + RSC  SP HP   L   +GYN   Y+   T R    +
Sbjct  647  GRTNMSMPVSPCSSPLRQFKQSNRSCMPSPPHPM--LSPGAGYNTLSYAQNQTRRSPAPA  704

Query  397  TLDPWLEMAQYRGQT  353
              DPW+++ Q + Q+
Sbjct  705  ISDPWMDVGQLKLQS  719



>ref|XP_004975670.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Setaria italica]
Length=728

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  S+PVSPCSSPLRQ++ + RSC  SP HP   L   +GYN   Y+   T R    +
Sbjct  648  GRTNMSMPVSPCSSPLRQFKQSNRSCMPSPPHPM--LSPGAGYNTLSYAQNQTRRSPAPA  705

Query  397  TLDPWLEMAQYRGQT  353
              DPW+++ Q + Q+
Sbjct  706  ISDPWMDVGQLKLQS  720



>ref|XP_004975669.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Setaria italica]
Length=753

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 2/75 (3%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  S+PVSPCSSPLRQ++ + RSC  SP HP   L   +GYN   Y+   T R    +
Sbjct  673  GRTNMSMPVSPCSSPLRQFKQSNRSCMPSPPHPM--LSPGAGYNTLSYAQNQTRRSPAPA  730

Query  397  TLDPWLEMAQYRGQT  353
              DPW+++ Q + Q+
Sbjct  731  ISDPWMDVGQLKLQS  745



>gb|EYU18037.1| hypothetical protein MIMGU_mgv1a002756mg [Erythranthe guttata]
Length=641

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTP AL+L        S E    T     SR ++S R++ARTI SLPVSP SSPLR  
Sbjct  514  GSRTPTALELRSNRTSNSSFE---DTSRSAASRTLLSPRDNARTIASLPVSPSSSPLRSD  570

Query  520  EPARRSCYLSPQHPSYPLMGQ---SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTA  350
              A R+ +LSP HPSY  +GQ   +  N ND+S L   RPN+R+  DPW E+  +  QT 
Sbjct  571  GAAYRNFFLSPPHPSYASVGQNGHNNNNYNDHS-LFPLRPNSRTGADPWPEIPHFGAQTH  629

Query  349  GRS  341
             RS
Sbjct  630  ARS  632



>gb|EYU24311.1| hypothetical protein MIMGU_mgv1a025509mg [Erythranthe guttata]
Length=641

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -2

Query  700  GSRTPPALDLHPCXGYMGSLEADNSTKPVTISRPMISSRESARTITSLPVSPCSSPLRQY  521
            GSRTP AL+L        S E  + +     SR ++S R++ARTI SLPVSP SSPLR  
Sbjct  514  GSRTPTALELRSNRTSNSSFEDSSRS---AASRTLLSPRDNARTIASLPVSPSSSPLRSD  570

Query  520  EPARRSCYLSPQHPSYPLMGQ---SGYNVNDYSTLTTARPNTRSTLDPWLEMAQYRGQTA  350
              A R+ +LSP HPSY  +GQ   +  N ND+S L   RPN+R+ +DPW E+  +  QT 
Sbjct  571  GAAYRNFFLSPPHPSYASVGQNGHNNNNYNDHS-LFPLRPNSRTAVDPWPEIPHFGVQTH  629

Query  349  GRS  341
             RS
Sbjct  630  ARS  632



>gb|ABG22409.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99952.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  303  NVRMNMSLPVSPCSSPLRQYRQSNRSCMPSPPHPAYS-AGAANYSPINN--ALYPKRPSN  359

Query  403  RSTLDPWLEMAQYRG  359
                DPWLE++Q + 
Sbjct  360  HVP-DPWLEISQLKA  373



>ref|XP_004979130.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Setaria italica]
Length=671

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP++
Sbjct  592  NVRMNMSLPVSPCSSPLRQYRQSNRSCLPSPPHPAYS-AGAANYSPINN--ALYPMRPSS  648

Query  403  RSTLDPWLEMAQYRGQT  353
              T DPWLE++    QT
Sbjct  649  GLT-DPWLEISPLNTQT  664



>ref|NP_001067464.1| Os11g0207200 [Oryza sativa Japonica Group]
 dbj|BAF27827.1| Os11g0207200, partial [Oryza sativa Japonica Group]
Length=554

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  475  NVRMNMSLPVSPCSSPLRQYRQSNRSCMPSPPHPAYS-AGAANYSPINN--ALYPKRPSN  531

Query  403  RSTLDPWLEMAQYRG  359
                DPWLE++Q + 
Sbjct  532  H-VPDPWLEISQLKA  545



>gb|EEE51829.1| hypothetical protein OsJ_33308 [Oryza sativa Japonica Group]
Length=667

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  588  NVRMNMSLPVSPCSSPLRQYRQSNRSCMPSPPHPAYS-AGAANYSPINN--ALYPKRPSN  644

Query  403  RSTLDPWLEMAQYR  362
                DPWLE++Q +
Sbjct  645  H-VPDPWLEISQLK  657



>gb|EEC67854.1| hypothetical protein OsI_35471 [Oryza sativa Indica Group]
Length=653

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  574  NVRMNMSLPVSPCSSPLRQYRQSNRSCMPSPPHPAYS-AGAANYSPINN--ALYPKRPSN  630

Query  403  RSTLDPWLEMAQYRG  359
                DPWLE++Q + 
Sbjct  631  H-VPDPWLEISQLKA  644



>gb|AAF34436.1|AF172282_25 similar to mitogen-activated protein kinases [Oryza sativa]
 gb|ABA92000.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
Length=653

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 5/75 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY  + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  574  NVRMNMSLPVSPCSSPLRQYRQSNRSCMPSPPHPAYS-AGAANYSPINN--ALYPKRPSN  630

Query  403  RSTLDPWLEMAQYRG  359
                DPWLE++Q + 
Sbjct  631  H-VPDPWLEISQLKA  644



>gb|EEC77321.1| hypothetical protein OsI_15990 [Oryza sativa Indica Group]
Length=637

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + YN++ Y    T R  T S
Sbjct  558  VRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-NGATSYNLSSYMMNETRRIPTIS  616

Query  397  TLDPWLEMAQYRGQT  353
              D W +++Q + Q+
Sbjct  617  --DTWQDISQLKVQS  629



>emb|CAD40821.2| OSJNBa0006B20.13 [Oryza sativa Japonica Group]
Length=709

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + YN++ Y    T R  T S
Sbjct  630  VRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-NGATSYNLSSYMMNETRRIPTIS  688

Query  397  TLDPWLEMAQYRGQT  353
              D W +++Q + Q+
Sbjct  689  --DTWQDISQLKVQS  701



>ref|NP_001052859.1| Os04g0437600 [Oryza sativa Japonica Group]
 dbj|BAF14773.1| Os04g0437600 [Oryza sativa Japonica Group]
 dbj|BAG91050.1| unnamed protein product [Oryza sativa Japonica Group]
Length=708

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + YN++ Y    T R  T S
Sbjct  629  VRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-NGATSYNLSSYMMNETRRIPTIS  687

Query  397  TLDPWLEMAQYRGQT  353
              D W +++Q + Q+
Sbjct  688  --DTWQDISQLKVQS  700



>gb|EEE61045.1| hypothetical protein OsJ_14897 [Oryza sativa Japonica Group]
Length=711

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + YN++ Y    T R  T S
Sbjct  632  VRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-NGATSYNLSSYMMNETRRIPTIS  690

Query  397  TLDPWLEMAQYRGQT  353
              D W +++Q + Q+
Sbjct  691  --DTWQDISQLKVQS  703



>emb|CAH67577.1| H0315A08.7 [Oryza sativa Indica Group]
Length=709

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  577  ARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRS  398
             RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + YN++ Y    T R  T S
Sbjct  630  VRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-NGATSYNLSSYMMNETRRIPTIS  688

Query  397  TLDPWLEMAQYRGQT  353
              D W +++Q + Q+
Sbjct  689  --DTWQDISQLKVQS  701



>ref|XP_003577728.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Brachypodium distachyon]
Length=663

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY+ + RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  584  NVRMNMSLPVSPCSSPLRQYKQSNRSCLPSPPHPAYS-AGAANYSPINN--VLYPTRPSN  640

Query  403  RSTLDPWLEMAQYRGQT  353
              T D WLE+ + + QT
Sbjct  641  YLT-DQWLEVPRQKTQT  656



>ref|XP_006663285.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Oryza brachyantha]
Length=623

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 5/74 (7%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYN-VNDYSTLTTARPNT  404
            + R   SLPVSPCSSPLRQY    RSC  SP HP+Y   G + Y+ +N+   L   RP+ 
Sbjct  544  NVRMNMSLPVSPCSSPLRQYRQLNRSCMPSPPHPAYS-AGAANYSPINN--ALYPTRPSN  600

Query  403  RSTLDPWLEMAQYR  362
                DPWLE++Q +
Sbjct  601  HLP-DPWLEISQLK  613



>ref|XP_006653424.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Oryza brachyantha]
Length=769

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = -2

Query  574  RTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRST  395
            RT  SLPVSPCSSPLRQ++ +  SC  SP HP++   G + +N++ Y +    R  T S 
Sbjct  691  RTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTFS-HGPASHNLSSYMSSEMRRIPTIS-  748

Query  394  LDPWLEMAQYRGQT  353
             D W +++Q + Q+
Sbjct  749  -DTWQDISQLKVQS  761



>ref|XP_009416942.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Musa acuminata subsp. malaccensis]
Length=669

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = -2

Query  574  RTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTRST  395
            R   SLPVSPCSSPLRQ++ + RSC  SP HP+Y     +   VN    L + RP +   
Sbjct  587  RMNMSLPVSPCSSPLRQFKQSNRSCLPSPPHPTYSSGAANHSPVN--LALHSTRPCSNRP  644

Query  394  LDPWLEMAQYRGQT  353
             DPW ++  ++ Q+
Sbjct  645  -DPWFDITLFKPQS  657



>ref|NP_001047125.2| Os02g0555900 [Oryza sativa Japonica Group]
 dbj|BAF09039.2| Os02g0555900 [Oryza sativa Japonica Group]
Length=690

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 4/78 (5%)
 Frame = -2

Query  592  SSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSY-PLMGQSGYNVNDYSTLTTA  416
            SS  + R   SLPVSPCSSPLRQ++ +  SC  SP HP+  P +  + Y  N    L   
Sbjct  605  SSPTAVRANMSLPVSPCSSPLRQFKQSNWSCLPSPTHPALSPGLSAAAYPNN---PLQNQ  661

Query  415  RPNTRSTLDPWLEMAQYR  362
               + +  DPWLE++Q R
Sbjct  662  SRRSAAVPDPWLELSQPR  679



>ref|XP_010930646.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Elaeis guineensis]
Length=659

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTR  401
            S R   SLPVSPCSSPLRQ++   RSC  SP HP++   G   Y+  +++ L   RP+  
Sbjct  579  SMRMNMSLPVSPCSSPLRQFKQYNRSCLPSPPHPAFS-AGAINYSPINHA-LYPVRPSGN  636

Query  400  STLDPWLEMAQYR  362
             T DPW +++Q +
Sbjct  637  LT-DPWPDISQLK  648



>ref|XP_010930645.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Elaeis guineensis]
Length=680

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTR  401
            S R   SLPVSPCSSPLRQ++   RSC  SP HP++   G   Y+  +++ L   RP+  
Sbjct  600  SMRMNMSLPVSPCSSPLRQFKQYNRSCLPSPPHPAFS-AGAINYSPINHA-LYPVRPSGN  657

Query  400  STLDPWLEMAQYR  362
             T DPW +++Q +
Sbjct  658  LT-DPWPDISQLK  669



>ref|XP_003581251.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Brachypodium distachyon]
Length=695

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 3/87 (3%)
 Frame = -2

Query  613  TISRPMISSRESARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDY  434
            T+S P  SS    RT  SLPVSPCSSPLRQ++ +  SC  SP HP+        YN + Y
Sbjct  604  TVSSPRTSSPIPVRTNMSLPVSPCSSPLRQFKQSNWSCLPSPPHPTLS-SSTMAYNSSGY  662

Query  433  STLTTARPNTRSTLDPWLEMAQYRGQT  353
              L  AR  + +  DPW +    + Q+
Sbjct  663  G-LNQAR-RSPAVSDPWQDAGPLKLQS  687



>ref|XP_008808477.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=683

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -2

Query  580  SARTITSLPVSPCSSPLRQYEPARRSCYLSPQHPSYPLMGQSGYNVNDYSTLTTARPNTR  401
            S R   SLPVSPCSSPLRQ++   RSC  SP HP++   G   Y+  +Y+       N  
Sbjct  603  SLRMNMSLPVSPCSSPLRQFKQCNRSCLPSPPHPAFS-AGAINYSPINYALYPVRTSNNF  661

Query  400  STLDPWLEMAQYR  362
            +  DPW ++ Q +
Sbjct  662  T--DPWPDITQMK  672



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320