BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017H14

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010258379.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   6e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010258381.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   6e-68   
ref|XP_010257275.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    177   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_006827209.1|  hypothetical protein AMTR_s00010p00259410          180   4e-67   Amborella trichopoda
ref|XP_008781839.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    179   2e-66   Phoenix dactylifera
ref|XP_008781840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    179   2e-66   
ref|XP_009404386.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   2e-66   
ref|XP_002278018.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   2e-66   Vitis vinifera
emb|CBI22198.3|  unnamed protein product                                176   4e-66   Vitis vinifera
ref|XP_010917037.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   8e-66   Elaeis guineensis
ref|XP_004250136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    177   2e-65   Solanum lycopersicum
ref|XP_004288505.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    177   3e-65   Fragaria vesca subsp. vesca
ref|XP_008455602.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    177   3e-65   Cucumis melo [Oriental melon]
ref|XP_009409142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    174   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409144.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    175   5e-65   
gb|KCW54603.1|  hypothetical protein EUGRSUZ_I005552                    177   6e-65   Eucalyptus grandis [rose gum]
ref|XP_009409133.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006353187.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    177   6e-65   Solanum tuberosum [potatoes]
ref|XP_004137185.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    177   6e-65   Cucumis sativus [cucumbers]
ref|XP_004154749.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    177   7e-65   
ref|XP_008802617.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    175   9e-65   Phoenix dactylifera
ref|XP_004236699.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    179   1e-64   Solanum lycopersicum
ref|XP_006466285.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    176   1e-64   Citrus sinensis [apfelsine]
ref|XP_009599322.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   2e-64   Nicotiana tomentosiformis
ref|XP_004956817.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    176   2e-64   Setaria italica
ref|XP_006426295.1|  hypothetical protein CICLE_v10025337mg             176   2e-64   Citrus clementina [clementine]
ref|XP_004983148.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    173   2e-64   Setaria italica
ref|XP_006346747.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    178   2e-64   Solanum tuberosum [potatoes]
ref|XP_010027951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   2e-64   Eucalyptus grandis [rose gum]
dbj|BAK00986.1|  predicted protein                                      174   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009785216.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    178   2e-64   Nicotiana sylvestris
tpg|DAA50031.1|  TPA: hypothetical protein ZEAMMB73_945143              175   2e-64   
ref|XP_010238165.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   2e-64   
gb|EYU30954.1|  hypothetical protein MIMGU_mgv1a004409mg                181   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_002462379.1|  hypothetical protein SORBIDRAFT_02g024680          173   3e-64   Sorghum bicolor [broomcorn]
ref|XP_008670192.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   4e-64   Zea mays [maize]
ref|XP_010939502.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    176   7e-64   Elaeis guineensis
ref|NP_001147085.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    173   1e-63   
gb|ACR35078.1|  unknown                                                 173   1e-63   Zea mays [maize]
ref|XP_009348246.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   1e-63   Pyrus x bretschneideri [bai li]
gb|EMT10326.1|  6-phosphofructokinase 5, chloroplastic                  172   1e-63   
gb|EMS54985.1|  6-phosphofructokinase 5, chloroplastic                  172   1e-63   Triticum urartu
ref|XP_010266371.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010693230.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    173   1e-63   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY13756.1|  BnaA09g42580D                                          172   1e-63   Brassica napus [oilseed rape]
emb|CDX76918.1|  BnaC08g35040D                                          172   1e-63   
gb|AIE16182.1|  chloroplast 6-phosphofructokinase 4                     178   2e-63   Nicotiana tabacum [American tobacco]
ref|XP_008385679.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   2e-63   
ref|XP_009340975.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   2e-63   Pyrus x bretschneideri [bai li]
gb|KJB18252.1|  hypothetical protein B456_003G042800                    174   2e-63   Gossypium raimondii
ref|XP_002464639.1|  hypothetical protein SORBIDRAFT_01g022370          174   2e-63   Sorghum bicolor [broomcorn]
gb|KJB18249.1|  hypothetical protein B456_003G042800                    174   2e-63   Gossypium raimondii
ref|XP_008385677.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   2e-63   Malus domestica [apple tree]
gb|AIE47273.1|  phosphofructokinase                                     174   3e-63   Hevea brasiliensis [jebe]
gb|KHG10318.1|  6-phosphofructokinase 5, chloroplastic -like protein    174   3e-63   Gossypium arboreum [tree cotton]
ref|XP_003573900.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   3e-63   Brachypodium distachyon [annual false brome]
gb|EYU39321.1|  hypothetical protein MIMGU_mgv1a004379mg                172   3e-63   Erythranthe guttata [common monkey flower]
ref|XP_010472236.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   3e-63   Camelina sativa [gold-of-pleasure]
gb|KDP29747.1|  hypothetical protein JCGZ_18682                         174   5e-63   Jatropha curcas
ref|XP_010429169.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007208470.1|  hypothetical protein PRUPE_ppa004086mg             171   6e-63   Prunus persica
ref|XP_007047816.1|  Phosphofructokinase 5 isoform 1                    173   6e-63   
ref|XP_010417006.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008235410.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   6e-63   Prunus mume [ume]
ref|XP_006293956.1|  hypothetical protein CARUB_v10022950mg             171   7e-63   Capsella rubella
ref|XP_002878619.1|  phosphofructokinase family protein                 171   8e-63   Arabidopsis lyrata subsp. lyrata
gb|KFK32811.1|  hypothetical protein AALP_AA6G290900                    170   1e-62   Arabis alpina [alpine rockcress]
emb|CDP01541.1|  unnamed protein product                                177   1e-62   Coffea canephora [robusta coffee]
ref|XP_010526665.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    169   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_002530702.1|  phosphofructokinase, putative                      171   2e-62   
ref|XP_002445557.1|  hypothetical protein SORBIDRAFT_07g021500          172   2e-62   Sorghum bicolor [broomcorn]
ref|XP_011097501.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    167   2e-62   Sesamum indicum [beniseed]
ref|XP_010107299.1|  6-phosphofructokinase 5                            170   3e-62   Morus notabilis
ref|XP_006659441.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    167   3e-62   Oryza brachyantha
ref|XP_004973537.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   3e-62   Setaria italica
dbj|BAK04400.1|  predicted protein                                      168   3e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006404705.1|  hypothetical protein EUTSA_v10000117mg             166   4e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006411816.1|  hypothetical protein EUTSA_v10024871mg             172   4e-62   Eutrema salsugineum [saltwater cress]
ref|NP_850025.1|  6-phosphofructokinase 5                               168   5e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90129.1|  predicted protein                                      168   5e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661761.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    171   6e-62   Oryza brachyantha
ref|XP_011100012.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   6e-62   Sesamum indicum [beniseed]
ref|NP_001063175.1|  Os09g0415800                                       169   7e-62   
ref|XP_008670187.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   7e-62   Zea mays [maize]
gb|ABD96050.1|  ATP-utilizing phosphofructokinase                       166   7e-62   Spinacia oleracea
ref|NP_001064560.1|  Os10g0405600                                       168   8e-62   
gb|EEC66915.1|  hypothetical protein OsI_33512                          168   8e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009109420.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    170   9e-62   Brassica rapa
ref|XP_004509678.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    172   9e-62   
dbj|BAD28914.1|  putative phosphofructokinase                           169   9e-62   Oryza sativa Japonica Group [Japonica rice]
emb|CDX90382.1|  BnaA08g16020D                                          170   9e-62   
gb|EEC84573.1|  hypothetical protein OsI_31367                          169   1e-61   Oryza sativa Indica Group [Indian rice]
gb|KFK30402.1|  hypothetical protein AALP_AA7G256400                    171   1e-61   Arabis alpina [alpine rockcress]
gb|AAK98672.1|AC021893_6  Putative pyrophosphate--fructose-6-phos...    167   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011021841.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   1e-61   Populus euphratica
ref|XP_009112523.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   2e-61   Brassica rapa
ref|XP_010916680.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    169   2e-61   Elaeis guineensis
gb|EEC83634.1|  hypothetical protein OsI_29365                          168   2e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_003628914.1|  6-phosphofructokinase                              172   2e-61   Medicago truncatula
gb|AGN30569.1|  phosphofructokinase PFK07                               168   2e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_002310313.2|  hypothetical protein POPTR_0007s14380g             172   2e-61   
ref|XP_010646328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   2e-61   Vitis vinifera
tpg|DAA48946.1|  TPA: hypothetical protein ZEAMMB73_793125              172   3e-61   
ref|XP_010646329.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   3e-61   Vitis vinifera
emb|CDY52512.1|  BnaC03g61050D                                          170   3e-61   Brassica napus [oilseed rape]
ref|XP_006660625.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    169   5e-61   Oryza brachyantha
ref|XP_009112522.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    172   5e-61   Brassica rapa
gb|AHE93343.1|  phosphofructokinase                                     169   5e-61   Camellia sinensis [black tea]
ref|XP_008795218.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    167   5e-61   Phoenix dactylifera
ref|NP_001145725.1|  hypothetical protein                               171   5e-61   Zea mays [maize]
ref|XP_003574548.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    167   9e-61   Brachypodium distachyon [annual false brome]
ref|XP_003552046.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    167   1e-60   Glycine max [soybeans]
gb|KHN20613.1|  6-phosphofructokinase 5, chloroplastic                  167   1e-60   Glycine soja [wild soybean]
ref|XP_010681044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    165   2e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|AAD22353.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    167   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767506.1|  predicted protein                                  172   3e-60   
ref|XP_004489766.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    163   5e-60   Cicer arietinum [garbanzo]
ref|XP_003517707.2|  PREDICTED: 6-phosphofructokinase 5, chloropl...    167   7e-60   Glycine max [soybeans]
ref|XP_003530616.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    166   9e-60   Glycine max [soybeans]
ref|XP_007158384.1|  hypothetical protein PHAVU_002G148700g             164   1e-59   Phaseolus vulgaris [French bean]
ref|XP_001769358.1|  predicted protein                                  169   1e-59   
gb|KHN08327.1|  6-phosphofructokinase 5, chloroplastic                  166   1e-59   Glycine soja [wild soybean]
gb|KHN14523.1|  6-phosphofructokinase 5, chloroplastic                  167   1e-59   Glycine soja [wild soybean]
gb|EEE68761.1|  hypothetical protein OsJ_27460                          168   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613090.1|  6-phosphofructokinase                              164   1e-59   Medicago truncatula
ref|XP_007156482.1|  hypothetical protein PHAVU_003G289600g             167   3e-59   Phaseolus vulgaris [French bean]
ref|XP_002969111.1|  hypothetical protein SELMODRAFT_146031             173   5e-59   
ref|XP_002973951.1|  hypothetical protein SELMODRAFT_100675             173   6e-59   
gb|EMS54761.1|  6-phosphofructokinase 5, chloroplastic                  161   1e-56   Triticum urartu
gb|EMT20555.1|  6-phosphofructokinase 5, chloroplastic                  174   3e-56   
gb|AIE16183.1|  chloroplast 6-phosphofructokinase 5                     179   3e-56   Nicotiana tabacum [American tobacco]
emb|CAN69658.1|  hypothetical protein VITISV_013008                     161   1e-55   Vitis vinifera
ref|NP_001061896.2|  Os08g0439000                                       168   2e-50   
gb|ADE76905.1|  unknown                                                 177   4e-50   Picea sitchensis
ref|XP_009340976.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   7e-50   Pyrus x bretschneideri [bai li]
emb|CAN60905.1|  hypothetical protein VITISV_028449                     161   1e-49   Vitis vinifera
dbj|BAD09875.1|  putative diphosphate-fructose-6-phosphate 1-phos...    173   8e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002505771.1|  phosphofructokinase                                140   2e-47   Micromonas commoda
gb|KJB18251.1|  hypothetical protein B456_003G042800                    174   2e-47   Gossypium raimondii
ref|XP_007509844.1|  predicted protein                                  151   3e-47   Bathycoccus prasinos
emb|CBI18715.3|  unnamed protein product                                172   1e-46   Vitis vinifera
ref|XP_001694148.1|  phosphofructokinase family protein                 124   1e-45   Chlamydomonas reinhardtii
dbj|BAJ92720.1|  predicted protein                                      168   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002949213.1|  phosphofructokinase family protein                 125   7e-44   Volvox carteri f. nagariensis
ref|XP_003083008.1|  putative pyrophosphate-fructose-6-phosphate ...    144   1e-43   Ostreococcus tauri
ref|XP_001776018.1|  predicted protein                                  140   2e-43   
ref|XP_003063812.1|  phosphofructokinase                                135   4e-43   Micromonas pusilla CCMP1545
ref|XP_001422557.1|  predicted protein                                  140   3e-42   Ostreococcus lucimarinus CCE9901
ref|XP_003064765.1|  predicted protein                                  134   3e-42   Micromonas pusilla CCMP1545
ref|XP_005651055.1|  phosphofructokinase family protein                 127   3e-42   Coccomyxa subellipsoidea C-169
ref|XP_002994206.1|  hypothetical protein SELMODRAFT_138352             149   6e-42   
ref|XP_002993249.1|  hypothetical protein SELMODRAFT_187341             148   1e-41   
ref|XP_001417416.1|  predicted protein                                  131   9e-41   Ostreococcus lucimarinus CCE9901
ref|XP_003078563.1|  putative phosphofructokinase (ISS)                 132   9e-41   Ostreococcus tauri
ref|XP_002504425.1|  predicted protein                                  130   1e-40   Micromonas commoda
ref|XP_002946149.1|  phosphofructokinase family protein                 128   1e-39   Volvox carteri f. nagariensis
ref|XP_001778081.1|  predicted protein                                  139   1e-39   
ref|XP_001696305.1|  phosphofructokinase family protein                 128   2e-39   Chlamydomonas reinhardtii
ref|XP_001696306.1|  phosphofructokinase family protein                 127   7e-39   Chlamydomonas reinhardtii
gb|EWM26350.1|  pyrophosphate-dependent phosphofructose kinase          109   5e-37   Nannochloropsis gaditana
ref|XP_005853474.1|  6-phosphofructo-2-kinase / fructose-2,6-bisp...    109   5e-37   Nannochloropsis gaditana CCMP526
gb|AIN35079.1|  phosphofructokinase                                     125   2e-36   Dunaliella tertiolecta
ref|XP_005652308.1|  phosphofructokinase family protein                 123   2e-36   Coccomyxa subellipsoidea C-169
ref|XP_006413209.1|  hypothetical protein EUTSA_v10025029mg             108   4e-36   Eutrema salsugineum [saltwater cress]
emb|CAB38956.1|  pyrophosphate-dependent phosphofructo-1-kinase         108   5e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94352.1|  BnaC01g18320D                                          108   5e-36   
gb|EMS49605.1|  6-phosphofructokinase 5, chloroplastic                77.4    5e-36   Triticum urartu
ref|XP_009142127.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    108   6e-36   Brassica rapa
ref|NP_567742.1|  6-phosphofructokinase 3                               108   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ06381.1|  hypothetical protein MNEG_1568                          119   7e-36   Monoraphidium neglectum
emb|CDY69051.1|  BnaAnng29210D                                          108   7e-36   Brassica napus [oilseed rape]
gb|KDD73612.1|  phosphofructokinase                                     116   1e-35   Helicosporidium sp. ATCC 50920
ref|XP_006285534.1|  hypothetical protein CARUB_v10006975mg             108   2e-35   Capsella rubella
ref|XP_011076434.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    113   3e-35   Sesamum indicum [beniseed]
ref|XP_010483140.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010443317.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010668815.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    115   3e-35   
ref|XP_010668810.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    115   3e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK27231.1|  hypothetical protein AALP_AA8G354500                    107   5e-35   Arabis alpina [alpine rockcress]
ref|XP_002286176.1|  6-phosphofructokinase                              107   5e-35   Thalassiosira pseudonana CCMP1335
ref|XP_006280374.1|  hypothetical protein CARUB_v10026301mg             105   7e-35   Capsella rubella
ref|XP_010433524.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008447679.1|  PREDICTED: 6-phosphofructokinase 6-like            100   9e-35   Cucumis melo [Oriental melon]
ref|XP_006451353.1|  hypothetical protein CICLE_v10007886mg             108   1e-34   
emb|CDY32769.1|  BnaA10g10800D                                          104   1e-34   Brassica napus [oilseed rape]
ref|XP_001766110.1|  predicted protein                                  112   1e-34   
ref|XP_005702907.1|  6-phosphofructokinase                              114   2e-34   Galdieria sulphuraria
ref|XP_006475360.1|  PREDICTED: 6-phosphofructokinase 3-like            107   2e-34   Citrus sinensis [apfelsine]
ref|XP_010438777.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010451175.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006451354.1|  hypothetical protein CICLE_v10007886mg             107   2e-34   Citrus clementina [clementine]
ref|XP_011401573.1|  6-phosphofructokinase 5, chloroplastic             104   2e-34   Auxenochlorella protothecoides
ref|XP_006357682.1|  PREDICTED: 6-phosphofructokinase 3-like            105   2e-34   Solanum tuberosum [potatoes]
ref|XP_001770890.1|  predicted protein                                  108   2e-34   
ref|XP_004243602.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   2e-34   Solanum lycopersicum
emb|CDY32873.1|  BnaC09g33200D                                          103   2e-34   Brassica napus [oilseed rape]
ref|XP_005709060.1|  6-phosphofructokinase                              114   3e-34   Galdieria sulphuraria
ref|XP_006451355.1|  hypothetical protein CICLE_v10007886mg             107   3e-34   
gb|EPS60907.1|  hypothetical protein M569_13894                       72.0    3e-34   Genlisea aurea
ref|XP_004243600.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   3e-34   Solanum lycopersicum
ref|XP_009120176.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   3e-34   Brassica rapa
ref|XP_010536840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    107   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_002864472.1|  phosphofructokinase family protein                 105   4e-34   
ref|XP_010539385.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    107   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_008447566.1|  PREDICTED: 6-phosphofructokinase 6-like            100   6e-34   Cucumis melo [Oriental melon]
ref|XP_010545328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   7e-34   Tarenaya hassleriana [spider flower]
gb|EYU20177.1|  hypothetical protein MIMGU_mgv1a004503mg                111   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_004149188.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    100   9e-34   
ref|XP_001780597.1|  predicted protein                                  105   1e-33   
ref|XP_004158491.1|  PREDICTED: 6-phosphofructokinase 3-like          99.8    1e-33   
ref|XP_006293955.1|  hypothetical protein CARUB_v10022950mg           73.6    1e-33   
gb|KGN58020.1|  hypothetical protein Csa_3G435010                     99.8    1e-33   Cucumis sativus [cucumbers]
ref|XP_009395732.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    106   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO55889.1|  hypothetical protein CISIN_1g0098041mg                  108   2e-33   Citrus sinensis [apfelsine]
dbj|BAB09881.1|  pyrophosphate-dependent phosphofructo-1-kinase-l...    103   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568842.1|  6-phosphofructokinase 7                               103   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011401490.1|  6-phosphofructokinase 5, chloroplastic             116   2e-33   Auxenochlorella protothecoides
ref|XP_007152950.1|  hypothetical protein PHAVU_004G173900g             105   2e-33   Phaseolus vulgaris [French bean]
ref|XP_002511010.1|  phosphofructokinase, putative                      109   2e-33   Ricinus communis
ref|XP_010546132.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    109   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_002182086.1|  pyrophosphate-dependent phosphofructose kinase     107   3e-33   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010049141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    106   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010049142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    106   3e-33   Eucalyptus grandis [rose gum]
gb|KDP33769.1|  hypothetical protein JCGZ_07340                         103   3e-33   Jatropha curcas
ref|XP_009362710.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    109   3e-33   Pyrus x bretschneideri [bai li]
gb|KDP22466.1|  hypothetical protein JCGZ_26297                         107   3e-33   Jatropha curcas
gb|AIE47276.1|  phosphofructokinase                                     102   4e-33   Hevea brasiliensis [jebe]
ref|XP_009132191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   4e-33   Brassica rapa
ref|XP_003522720.1|  PREDICTED: 6-phosphofructokinase 3-like            105   4e-33   Glycine max [soybeans]
emb|CDY11911.1|  BnaC03g13370D                                          101   5e-33   Brassica napus [oilseed rape]
ref|XP_009387228.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526507.1|  PREDICTED: 6-phosphofructokinase 3-like            103   6e-33   Glycine max [soybeans]
gb|EYU30678.1|  hypothetical protein MIMGU_mgv1a005513mg                107   6e-33   Erythranthe guttata [common monkey flower]
ref|XP_010690141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    107   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002514189.1|  phosphofructokinase, putative                      103   7e-33   
ref|XP_005536329.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    110   7e-33   Cyanidioschyzon merolae strain 10D
ref|XP_010526423.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_011458966.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   8e-33   Fragaria vesca subsp. vesca
gb|AIE47275.1|  phosphofructokinase                                     100   9e-33   Hevea brasiliensis [jebe]
ref|XP_007137260.1|  hypothetical protein PHAVU_009G112500g             102   9e-33   Phaseolus vulgaris [French bean]
ref|XP_008354543.1|  PREDICTED: 6-phosphofructokinase 3-like            106   1e-32   
ref|XP_010244403.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   1e-32   Nelumbo nucifera [Indian lotus]
emb|CCA20233.1|  unnamed protein product                              95.5    1e-32   Albugo laibachii Nc14
ref|WP_002706063.1|  diphosphate--fructose-6-phosphate 1-phosphot...  95.5    1e-32   Treponema saccharophilum
ref|XP_009395050.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395051.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002309528.2|  hypothetical protein POPTR_0006s25170g           99.8    1e-32   
ref|XP_006583562.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    103   1e-32   
gb|KJB83095.1|  hypothetical protein B456_013G229200                    107   1e-32   Gossypium raimondii
ref|XP_008387449.1|  PREDICTED: 6-phosphofructokinase 3-like            106   1e-32   
gb|KEH36099.1|  6-phosphofructokinase                                   102   1e-32   Medicago truncatula
gb|EAY99719.1|  hypothetical protein OsI_21704                          103   1e-32   Oryza sativa Indica Group [Indian rice]
dbj|BAD69330.1|  putative pyrophosphate-dependent phosphofructo-1...    103   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003529065.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    103   2e-32   Glycine max [soybeans]
ref|XP_008375682.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    110   2e-32   Malus domestica [apple tree]
ref|XP_005707027.1|  6-phosphofructokinase isoform 1                    105   2e-32   Galdieria sulphuraria
ref|XP_002283274.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   2e-32   Vitis vinifera
ref|XP_006412866.1|  hypothetical protein EUTSA_v10024824mg             103   2e-32   
emb|CBI27972.3|  unnamed protein product                                102   2e-32   Vitis vinifera
ref|WP_016522806.1|  hypothetical protein                             94.4    2e-32   Treponema medium
gb|KJB54321.1|  hypothetical protein B456_009G029100                    103   2e-32   Gossypium raimondii
ref|XP_003516323.2|  PREDICTED: 6-phosphofructokinase 3-like            103   2e-32   
ref|XP_006412865.1|  hypothetical protein EUTSA_v10024824mg             103   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006412864.1|  hypothetical protein EUTSA_v10024824mg             103   2e-32   
gb|KHN03217.1|  6-phosphofructokinase 3                                 103   2e-32   Glycine soja [wild soybean]
gb|ADE19117.1|  phosphofructokinase                                     125   2e-32   Dunaliella salina
ref|WP_044014565.1|  diphosphate--fructose-6-phosphate 1-phosphot...  94.4    2e-32   Treponema sp. OMZ 838
ref|XP_008242459.1|  PREDICTED: 6-phosphofructokinase 6-like            104   2e-32   
ref|XP_008799762.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   2e-32   Phoenix dactylifera
ref|XP_006490011.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    106   2e-32   Citrus sinensis [apfelsine]
gb|KHG01593.1|  6-phosphofructokinase 3 -like protein                   101   2e-32   Gossypium arboreum [tree cotton]
ref|XP_010483840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    109   2e-32   Camelina sativa [gold-of-pleasure]
gb|KJB07889.1|  hypothetical protein B456_001G051000                    106   2e-32   Gossypium raimondii
ref|XP_005707028.1|  6-phosphofructokinase isoform 2                    104   3e-32   Galdieria sulphuraria
ref|XP_007047817.1|  Phosphofructokinase 5 isoform 2                  71.6    3e-32   
ref|XP_010924465.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   3e-32   
gb|AIE47270.1|  phosphofructokinase                                     100   3e-32   Hevea brasiliensis [jebe]
ref|WP_006188253.1|  diphosphate--fructose-6-phosphate 1-phosphot...  94.0    3e-32   Treponema vincentii
ref|XP_006643863.1|  PREDICTED: 6-phosphofructokinase 3-like          96.7    3e-32   Oryza brachyantha
ref|XP_010086908.1|  6-phosphofructokinase 3                            102   3e-32   
gb|KFK27910.1|  hypothetical protein AALP_AA8G446100                    108   3e-32   
gb|KJB65623.1|  hypothetical protein B456_010G103900                    101   3e-32   
ref|WP_016518838.1|  hypothetical protein                             94.0    3e-32   
ref|WP_024752427.1|  diphosphate--fructose-6-phosphate 1-phosphot...  95.5    3e-32   
ref|XP_007160266.1|  hypothetical protein PHAVU_002G306800g             105   3e-32   
ref|XP_006421534.1|  hypothetical protein CICLE_v10004702mg             105   4e-32   
gb|KHN40360.1|  6-phosphofructokinase 3                                 102   4e-32   
emb|CDX88580.1|  BnaA03g10690D                                        98.6    4e-32   
ref|WP_002697949.1|  diphosphate--fructose-6-phosphate 1-phosphot...  95.1    4e-32   
ref|XP_009409366.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  97.8    5e-32   
emb|CBI18713.3|  unnamed protein product                              73.9    5e-32   
ref|XP_011019558.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    5e-32   
ref|XP_010924464.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.4    5e-32   
ref|XP_010050463.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.9    6e-32   
ref|XP_006385829.1|  hypothetical protein POPTR_0003s15090g             106   6e-32   
gb|AIE47272.1|  phosphofructokinase                                     104   6e-32   
ref|XP_009367416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.0    6e-32   
ref|XP_011093663.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.0    6e-32   
ref|XP_008337072.1|  PREDICTED: 6-phosphofructokinase 3-like          98.2    7e-32   
ref|XP_009337911.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   7e-32   
gb|AFW75541.1|  hypothetical protein ZEAMMB73_660971                    102   7e-32   
ref|XP_010526087.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    106   7e-32   
ref|XP_005710269.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    103   7e-32   
gb|KHG19950.1|  6-phosphofructokinase 4, chloroplastic -like protein    106   7e-32   
ref|XP_006342512.1|  PREDICTED: 6-phosphofructokinase 3-like          99.8    7e-32   
ref|XP_003568068.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.5    7e-32   
ref|XP_002282309.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    104   7e-32   
ref|XP_010457508.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    108   8e-32   
gb|EAZ10866.1|  hypothetical protein OsJ_00706                        94.7    8e-32   
ref|XP_008648820.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   8e-32   
ref|XP_008795493.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    8e-32   
ref|XP_009757482.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   8e-32   
ref|XP_009337915.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   8e-32   
gb|KCW79592.1|  hypothetical protein EUGRSUZ_C00952                   95.5    8e-32   
ref|XP_008234443.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    108   9e-32   
ref|XP_004253102.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.8    9e-32   
ref|NP_001042273.1|  Os01g0191700                                     94.7    9e-32   
emb|CAN74837.1|  hypothetical protein VITISV_023326                     102   9e-32   
ref|XP_009136495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    106   9e-32   
ref|XP_004513074.1|  PREDICTED: 6-phosphofructokinase 3-like            101   9e-32   
ref|XP_007012201.1|  Phosphofructokinase 3 isoform 3                    101   9e-32   
ref|XP_006654672.1|  PREDICTED: 6-phosphofructokinase 3-like          94.4    9e-32   
ref|XP_008795494.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    9e-32   
ref|XP_009337914.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   9e-32   
ref|XP_006394490.1|  hypothetical protein EUTSA_v10003971mg             107   1e-31   
ref|XP_002275308.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    102   1e-31   
ref|XP_011081730.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   1e-31   
ref|XP_007219544.1|  hypothetical protein PRUPE_ppa003986mg             107   1e-31   
gb|KHM99825.1|  6-phosphofructokinase 3                                 103   1e-31   
ref|XP_003532467.1|  PREDICTED: 6-phosphofructokinase 3-like            103   1e-31   
ref|XP_009337913.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   1e-31   
gb|EYU29302.1|  hypothetical protein MIMGU_mgv1a005820mg              99.4    1e-31   
ref|XP_003536274.2|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    104   1e-31   
ref|NP_200966.2|  6-phosphofructokinase 4                               108   1e-31   
ref|XP_009337916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   1e-31   
ref|XP_011091507.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.8    1e-31   
ref|XP_010546134.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    103   1e-31   
gb|KHN16662.1|  6-phosphofructokinase 3                                 103   1e-31   
gb|KGN58018.1|  hypothetical protein Csa_3G434990                     97.1    1e-31   
ref|XP_006656646.1|  PREDICTED: 6-phosphofructokinase 3-like            100   1e-31   
ref|XP_002437847.1|  hypothetical protein SORBIDRAFT_10g003650          101   1e-31   
ref|XP_007012199.1|  Phosphofructokinase 3 isoform 1                    101   1e-31   
gb|EPS62819.1|  hypothetical protein M569_11969                         104   1e-31   
ref|XP_005537083.1|  pyrophosphate--fructose-6-phosphate 1-phosph...  99.4    1e-31   
ref|XP_010275416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   1e-31   
ref|XP_004149187.1|  PREDICTED: 6-phosphofructokinase 3-like          97.1    1e-31   
ref|XP_008375837.1|  PREDICTED: 6-phosphofructokinase 6-like            100   1e-31   
ref|XP_010267094.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   1e-31   
ref|XP_002457198.1|  hypothetical protein SORBIDRAFT_03g003140        94.4    1e-31   
emb|CDY02131.1|  BnaA03g40360D                                          106   1e-31   
ref|XP_004496088.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    102   1e-31   
ref|XP_010275417.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    105   1e-31   
gb|KDO79934.1|  hypothetical protein CISIN_1g012056mg                   101   1e-31   
ref|XP_006355296.1|  PREDICTED: 6-phosphofructokinase 3-like            100   2e-31   
ref|XP_004496087.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    102   2e-31   
gb|KDO79936.1|  hypothetical protein CISIN_1g012056mg                   101   2e-31   
gb|ACL53548.1|  unknown                                                 101   2e-31   
ref|WP_014456449.1|  diphosphate--fructose-6-phosphate 1-phosphot...  99.0    2e-31   
ref|XP_009588737.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    109   2e-31   
ref|NP_001151911.1|  6-phosphofructokinase                              101   2e-31   
ref|XP_008453872.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    106   2e-31   
gb|KHN37911.1|  6-phosphofructokinase 4, chloroplastic                  103   2e-31   
gb|KCW79599.1|  hypothetical protein EUGRSUZ_C00956                   94.7    2e-31   
ref|XP_004146902.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    106   2e-31   
ref|XP_008453875.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    106   2e-31   
ref|XP_002864742.1|  phosphofructokinase family protein                 106   2e-31   
ref|XP_003524412.1|  PREDICTED: 6-phosphofructokinase 7-like            102   2e-31   
ref|XP_008654297.1|  PREDICTED: uncharacterized protein LOC100192...  94.4    2e-31   
ref|XP_007223382.1|  hypothetical protein PRUPE_ppa004610mg           97.4    2e-31   
gb|AFW80261.1|  hypothetical protein ZEAMMB73_064922                  94.7    2e-31   
ref|XP_010925503.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   2e-31   
ref|XP_003564709.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.1    2e-31   
ref|NP_001056090.1|  Os05g0524400                                     93.2    2e-31   
ref|NP_001266546.1|  6-phosphofructokinase 2                          94.4    2e-31   
emb|CCI46577.1|  unnamed protein product                              94.7    2e-31   
ref|XP_010925504.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.8    2e-31   
gb|EMS48156.1|  6-phosphofructokinase 3                               94.4    2e-31   
emb|CDY23054.1|  BnaC07g31330D                                          105   3e-31   
gb|EEC79555.1|  hypothetical protein OsI_20679                        93.2    3e-31   
ref|XP_004964832.1|  PREDICTED: 6-phosphofructokinase 7-like            100   3e-31   
ref|XP_004968501.1|  PREDICTED: 6-phosphofructokinase 3-like          92.8    3e-31   
gb|KDD75377.1|  phosphofructokinase                                   95.1    3e-31   
ref|XP_011399405.1|  6-phosphofructokinase 5, chloroplastic             107   3e-31   
ref|XP_007038279.1|  Phosphofructokinase 4                              106   3e-31   
ref|XP_009603443.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    3e-31   
ref|XP_008375836.1|  PREDICTED: 6-phosphofructokinase 3-like            100   3e-31   
ref|XP_009758764.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    3e-31   
ref|XP_009337906.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   3e-31   
ref|XP_010047648.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  94.4    3e-31   
ref|XP_010914787.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.4    3e-31   
gb|EMS54289.1|  6-phosphofructokinase 3                               93.2    3e-31   
gb|EAZ13474.1|  hypothetical protein OsJ_03390                        93.2    3e-31   
ref|XP_004245136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   4e-31   
gb|EMT10635.1|  6-phosphofructokinase 3                               93.2    4e-31   
ref|XP_009602786.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    101   4e-31   
ref|XP_004235183.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    110   4e-31   
ref|XP_004961440.1|  PREDICTED: 6-phosphofructokinase 7-like          93.2    4e-31   
ref|XP_009804348.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    108   4e-31   
ref|XP_001764541.1|  predicted protein                                  102   5e-31   
gb|KJB65625.1|  hypothetical protein B456_010G103900                  97.4    5e-31   
tpg|DAA57730.1|  TPA: hypothetical protein ZEAMMB73_790705            95.9    5e-31   
ref|XP_006644676.1|  PREDICTED: 6-phosphofructokinase 7-like          94.7    5e-31   
ref|XP_009344489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  99.8    5e-31   
dbj|BAJ85701.1|  predicted protein                                    93.6    6e-31   
ref|XP_010443983.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    108   6e-31   
ref|XP_006856644.1|  hypothetical protein AMTR_s01089p00001250        99.0    6e-31   
dbj|BAJ85856.1|  predicted protein                                    93.6    6e-31   
gb|EMS52572.1|  6-phosphofructokinase 3                               93.6    6e-31   
gb|EMT19126.1|  6-phosphofructokinase 3                               93.6    6e-31   
emb|CDM81680.1|  unnamed protein product                              93.6    6e-31   
dbj|BAD86939.1|  putative pyrophosphate-dependent phosphofructo-1...  94.4    7e-31   
ref|XP_003637099.1|  6-phosphofructokinase                              101   7e-31   
ref|XP_003591658.1|  6-phosphofructokinase                              101   7e-31   
ref|XP_008672828.1|  PREDICTED: 6-phosphofructokinase isoform X1      94.4    8e-31   
ref|XP_008672829.1|  PREDICTED: 6-phosphofructokinase isoform X2      94.4    8e-31   
ref|XP_004969889.1|  PREDICTED: 6-phosphofructokinase 3-like          95.9    9e-31   
gb|KDP34145.1|  hypothetical protein JCGZ_07716                         100   9e-31   
ref|XP_006450746.1|  hypothetical protein CICLE_v10008181mg           99.0    1e-30   
ref|XP_008348488.1|  PREDICTED: 6-phosphofructokinase 6-like            100   1e-30   
ref|XP_003597663.1|  6-phosphofructokinase                            97.4    1e-30   
ref|XP_008798601.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    100   1e-30   
ref|XP_006358222.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    108   1e-30   
ref|XP_006853746.1|  hypothetical protein AMTR_s00056p00183670        98.2    1e-30   
gb|EPF31724.1|  hypothetical protein HMPREF9194_02075                 99.0    1e-30   
ref|XP_004302844.2|  PREDICTED: ATP-dependent 6-phosphofructokina...  96.7    1e-30   
ref|NP_001147854.1|  6-phosphofructokinase                            95.1    1e-30   
gb|ACR36601.1|  unknown                                               95.1    1e-30   
ref|XP_006426847.1|  hypothetical protein CICLE_v10025255mg           99.0    2e-30   
ref|XP_010915352.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  98.6    2e-30   
ref|XP_010095449.1|  6-phosphofructokinase 3                            100   2e-30   
ref|WP_040846937.1|  diphosphate--fructose-6-phosphate 1-phosphot...  99.0    2e-30   
ref|XP_002906655.1|  6-phosphofructokinase, putative                  92.8    2e-30   
ref|NP_001147976.1|  6-phosphofructokinase 2                          91.7    2e-30   
ref|XP_006465714.1|  PREDICTED: 6-phosphofructokinase 3-like          98.6    2e-30   
ref|XP_002458460.1|  hypothetical protein SORBIDRAFT_03g034060        95.1    2e-30   
gb|KDO51846.1|  hypothetical protein CISIN_1g009394mg                 98.6    2e-30   
ref|XP_009515718.1|  hypothetical protein PHYSODRAFT_343844           93.2    2e-30   
ref|WP_020966536.1|  diphosphate--fructose-6-phosphate 1-phosphot...  94.7    3e-30   
ref|XP_004503509.1|  PREDICTED: 6-phosphofructokinase 3-like          98.6    3e-30   
gb|AFK48605.1|  unknown                                                 104   3e-30   
ref|WP_027727952.1|  diphosphate--fructose-6-phosphate 1-phosphot...  95.5    3e-30   
ref|XP_009337910.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.1    4e-30   
gb|KIZ06337.1|  hypothetical protein MNEG_1619                          100   4e-30   
ref|XP_005850730.1|  hypothetical protein CHLNCDRAFT_29926              105   4e-30   
ref|NP_001032120.1|  6-phosphofructokinase 4                            102   4e-30   
ref|XP_007144193.1|  hypothetical protein PHAVU_007G136000g             102   4e-30   
ref|XP_008450803.1|  PREDICTED: 6-phosphofructokinase 7-like            100   5e-30   
ref|NP_001241814.1|  6-phosphofructokinase 2                          89.4    5e-30   
dbj|BAK02245.1|  predicted protein                                    92.8    5e-30   
ref|XP_003569758.2|  PREDICTED: ATP-dependent 6-phosphofructokina...  92.0    5e-30   
ref|XP_009349890.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  94.4    6e-30   
gb|KDP40841.1|  hypothetical protein JCGZ_24840                       97.8    6e-30   
ref|XP_003630682.1|  6-phosphofructokinase                            97.8    6e-30   
ref|XP_004135681.1|  PREDICTED: 6-phosphofructokinase 7-like            100   6e-30   
gb|AIU64848.1|  6-phosphofructokinase                                 98.2    6e-30   
ref|XP_008864895.1|  hypothetical protein H310_02965                  92.8    7e-30   
gb|AEB15073.1|  6-phosphofructokinase                                 92.4    7e-30   
gb|AAB88875.1|  pyrophosphate-dependent phosphofructo-1-kinase        91.7    8e-30   
gb|KHG00436.1|  6-phosphofructokinase 3 -like protein                 94.4    8e-30   
ref|WP_023378966.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...  93.2    9e-30   
ref|XP_003630681.1|  6-phosphofructokinase                            96.7    9e-30   
ref|XP_008228400.1|  PREDICTED: 6-phosphofructokinase 6-like          97.8    9e-30   
ref|WP_041612421.1|  diphosphate--fructose-6-phosphate 1-phosphot...  92.0    9e-30   
ref|XP_011096141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  94.4    1e-29   
ref|XP_009834847.1|  hypothetical protein H257_10097                  92.4    1e-29   
ref|XP_007135617.1|  hypothetical protein PHAVU_010G143900g           98.6    1e-29   
ref|XP_007213751.1|  hypothetical protein PRUPE_ppa004167m1g          93.2    1e-29   
ref|XP_008794084.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  97.1    1e-29   
ref|XP_002867573.1|  phosphofructokinase family protein                 108   1e-29   
ref|XP_008907368.1|  hypothetical protein PPTG_13439                  92.8    1e-29   
emb|CDP08198.1|  unnamed protein product                                100   1e-29   
ref|XP_008375840.1|  PREDICTED: 6-phosphofructokinase 3-like isof...  95.5    1e-29   
ref|XP_004517277.1|  PREDICTED: 6-phosphofructokinase 3-like          96.7    1e-29   
ref|XP_004037415.1|  phosphofructokinase family protein, putative       108   1e-29   
ref|XP_004499341.1|  PREDICTED: 6-phosphofructokinase 2-like          95.9    1e-29   
ref|XP_008794086.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  96.7    1e-29   
ref|XP_008375838.1|  PREDICTED: 6-phosphofructokinase 6-like isof...  95.1    1e-29   
ref|XP_004287498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  94.0    2e-29   
ref|XP_006584114.1|  PREDICTED: 6-phosphofructokinase 2-like          95.9    2e-29   
ref|XP_008375839.1|  PREDICTED: 6-phosphofructokinase 6-like isof...  95.1    2e-29   
ref|XP_004039656.1|  phosphofructokinase, putative                      105   2e-29   
emb|CBJ30811.1|  pyrophosphate-dependent phosphofructose kinase       95.9    2e-29   
gb|EKD27946.1|  hypothetical protein ACD_79C00488G0002                90.1    2e-29   
ref|XP_007215486.1|  hypothetical protein PRUPE_ppa003635mg           97.8    2e-29   
ref|WP_002771889.1|  diphosphate--fructose-6-phosphate 1-phosphot...    103   2e-29   
ref|XP_010683074.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.1    2e-29   
ref|XP_010052498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  92.8    2e-29   
gb|AHN66811.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...  93.2    2e-29   
gb|ABD96051.1|  putative phosphofructokinase                          99.8    2e-29   
ref|XP_010928044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  95.1    3e-29   
ref|XP_006837361.1|  hypothetical protein AMTR_s00111p00106690        91.7    3e-29   
ref|XP_007024343.1|  6-phosphofructokinase 3                          92.4    4e-29   
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2               91.3    4e-29   
gb|EEE64418.1|  hypothetical protein OsJ_19262                        93.2    5e-29   
ref|WP_025267551.1|  diphosphate--fructose-6-phosphate 1-phosphot...  92.8    5e-29   
ref|XP_003543617.1|  PREDICTED: 6-phosphofructokinase 3-like isof...  93.2    5e-29   
ref|WP_010881557.1|  diphosphate--fructose-6-phosphate 1-phosphot...  92.8    5e-29   
gb|ERJ91678.1|  Phosphofructokinase                                   95.1    6e-29   
ref|WP_040847310.1|  diphosphate--fructose-6-phosphate 1-phosphot...  95.1    6e-29   
ref|XP_002975191.1|  hypothetical protein SELMODRAFT_150344             118   7e-29   



>ref|XP_010258379.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010258380.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=530

 Score =   176 bits (447),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVHIQ +IK+HFK++    DVKYIDPTY++R CR +ASDAI+C
Sbjct  409  EKSNATDASGNVVLGDIGVHIQQRIKRHFKEVGVPADVKYIDPTYMIRACRPNASDAILC  468

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVIA+ R VDPNSRMWHRCLTSTGQPD
Sbjct  469  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVIASPRTVDPNSRMWHRCLTSTGQPD  528

Query  195  F  193
            F
Sbjct  529  F  529


 Score = 81.3 bits (199),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPFKLDG  GVL+HLEH IETKGSAVVCVAEGAGQD++EKSN
Sbjct  369  PEVPFKLDGPYGVLQHLEHLIETKGSAVVCVAEGAGQDMLEKSN  412


 Score = 49.3 bits (116),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F+
Sbjct  347  RSSGFIAMHASLSSGQIDVCLIPEVPFK  374



>ref|XP_010258381.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=498

 Score =   176 bits (446),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVHIQ +IK+HFK++    DVKYIDPTY++R CR +ASDAI+C
Sbjct  377  EKSNATDASGNVVLGDIGVHIQQRIKRHFKEVGVPADVKYIDPTYMIRACRPNASDAILC  436

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVIA+ R VDPNSRMWHRCLTSTGQPD
Sbjct  437  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVIASPRTVDPNSRMWHRCLTSTGQPD  496

Query  195  F  193
            F
Sbjct  497  F  497


 Score = 81.3 bits (199),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPFKLDG  GVL+HLEH IETKGSAVVCVAEGAGQD++EKSN
Sbjct  337  PEVPFKLDGPYGVLQHLEHLIETKGSAVVCVAEGAGQDMLEKSN  380


 Score = 49.3 bits (116),  Expect(3) = 6e-68, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F+
Sbjct  315  RSSGFIAMHASLSSGQIDVCLIPEVPFK  342



>ref|XP_010257275.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010257284.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Nelumbo nucifera]
Length=529

 Score =   177 bits (449),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GV+IQ +IK+HFK+I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  408  EKSNATDASGNVVLGDIGVYIQQRIKRHFKEIGVPSDVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVIA+ R VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVIASPRTVDPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 79.3 bits (194),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE+PF LDG  GVL+HLEH I+TKGSAVVCVAEGAGQDL+EKSN
Sbjct  368  PEIPFNLDGPYGVLRHLEHLIQTKGSAVVCVAEGAGQDLLEKSN  411


 Score = 48.5 bits (114),  Expect(3) = 2e-67, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F 
Sbjct  346  RSSGFIAMHASLSSGQIDVCLIPEIPFN  373



>ref|XP_006827209.1| hypothetical protein AMTR_s00010p00259410 [Amborella trichopoda]
 gb|ERM94446.1| hypothetical protein AMTR_s00010p00259410 [Amborella trichopoda]
Length=528

 Score =   180 bits (456),  Expect(3) = 4e-67, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVH+Q QIKK+FK I+   DVKYIDPTY++R CRA+ASDAI+C
Sbjct  407  QKSNATDASGNIVLGDIGVHLQQQIKKYFKSIDVPADVKYIDPTYMIRACRANASDAILC  466

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG+CNTHY+Y PIPEVIA+ R VDPNSRMWHRCLTSTGQPD
Sbjct  467  TVLGQNAVHGAFAGFSGITVGVCNTHYVYFPIPEVIASPRQVDPNSRMWHRCLTSTGQPD  526

Query  195  F  193
            F
Sbjct  527  F  527


 Score = 74.3 bits (181),  Expect(3) = 4e-67, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPFK++G +GVL+HL+H I+ KG+AVVCVAEGAGQDL++KSN
Sbjct  367  PEVPFKVEGPSGVLRHLQHLIQIKGNAVVCVAEGAGQDLLQKSN  410


 Score = 49.7 bits (117),  Expect(3) = 4e-67, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQA  657
            RSSGFIAMHASL+SGQID CLIP   F+ 
Sbjct  345  RSSGFIAMHASLSSGQIDVCLIPEVPFKV  373



>ref|XP_008781839.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=529

 Score =   179 bits (454),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVHIQ QIK+HFK+I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  408  EKSNATDASGNVVLSDIGVHIQQQIKRHFKEIGVPADVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+YLPIPEVI +SR VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITTGICNTHYVYLPIPEVITSSRCVDPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 74.3 bits (181),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G NGVL+HLEH ++TKG+AV+C+AEGAGQ+L+EKSN
Sbjct  368  PEVPFTLEGPNGVLQHLEHLLKTKGNAVICIAEGAGQELLEKSN  411


 Score = 48.5 bits (114),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP   F
Sbjct  346  RSSGFIAMHASLSSGQIDVCLIPEVPF  372



>ref|XP_008781840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=528

 Score =   179 bits (454),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVHIQ QIK+HFK+I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  407  EKSNATDASGNVVLSDIGVHIQQQIKRHFKEIGVPADVKYIDPTYMIRACRANASDAILC  466

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+YLPIPEVI +SR VDPNSRMWHRCLTSTGQPD
Sbjct  467  TVLGQNAVHGAFAGFSGITTGICNTHYVYLPIPEVITSSRCVDPNSRMWHRCLTSTGQPD  526

Query  195  F  193
            F
Sbjct  527  F  527


 Score = 74.3 bits (181),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G NGVL+HLEH ++TKG+AV+C+AEGAGQ+L+EKSN
Sbjct  367  PEVPFTLEGPNGVLQHLEHLLKTKGNAVICIAEGAGQELLEKSN  410


 Score = 48.5 bits (114),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP   F
Sbjct  345  RSSGFIAMHASLSSGQIDVCLIPEVPF  371



>ref|XP_009404386.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404394.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   178 bits (452),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            KS T+ DASGN +LSD+GVHIQ QIK+HFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  409  KSNTT-DASGNVVLSDIGVHIQQQIKRHFKDIGVPADVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+Y PI +VI ++RHVDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITTGICNTHYVYFPITQVIESTRHVDPNSRMWHRCLTSTGQPD  527

Query  195  FS  190
            F+
Sbjct  528  FN  529


 Score = 74.7 bits (182),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G NGVL+HLEH I+TKG+AVVCVAEGAGQD + KSN
Sbjct  368  PEVPFNLEGPNGVLQHLEHLIKTKGNAVVCVAEGAGQDYLHKSN  411


 Score = 48.5 bits (114),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F 
Sbjct  346  RSSGFIAMHASLSSGQIDICLIPEVPFN  373



>ref|XP_002278018.2| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Vitis vinifera]
Length=531

 Score =   176 bits (447),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             S DASGN  L D+GV++Q QIKKHF++I    DVKYIDPTY++R CRA+ASDA++CTVL
Sbjct  413  NSTDASGNARLGDIGVYLQQQIKKHFRRIGVPADVKYIDPTYMIRACRANASDAVLCTVL  472

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            GQNAVHGAFAGF+GITVGICN+HY+YLPIPEVIA+ R VDP+SRMWHRCLTSTGQPDF+
Sbjct  473  GQNAVHGAFAGFSGITVGICNSHYVYLPIPEVIASPRVVDPDSRMWHRCLTSTGQPDFN  531


 Score = 74.3 bits (181),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF+++G  GVL+HLEH IETKGSAV+CVAEGAGQD +EK+N
Sbjct  370  PEVPFQIEGPYGVLRHLEHLIETKGSAVLCVAEGAGQDFVEKTN  413


 Score = 50.4 bits (119),  Expect(3) = 2e-66, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   FQ
Sbjct  348  RSSGFIAMHASLSSGQIDICLIPEVPFQ  375



>emb|CBI22198.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   176 bits (447),  Expect(3) = 4e-66, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   S DASGN  L D+GV++Q QIKKHF++I    DVKYIDPTY++R CRA+ASDA++C
Sbjct  359  EKTNSTDASGNARLGDIGVYLQQQIKKHFRRIGVPADVKYIDPTYMIRACRANASDAVLC  418

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVGICN+HY+YLPIPEVIA+ R VDP+SRMWHRCLTSTGQPD
Sbjct  419  TVLGQNAVHGAFAGFSGITVGICNSHYVYLPIPEVIASPRVVDPDSRMWHRCLTSTGQPD  478

Query  195  FS  190
            F+
Sbjct  479  FN  480


 Score = 74.3 bits (181),  Expect(3) = 4e-66, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF+++G  GVL+HLEH IETKGSAV+CVAEGAGQD +EK+N
Sbjct  319  PEVPFQIEGPYGVLRHLEHLIETKGSAVLCVAEGAGQDFVEKTN  362


 Score = 50.4 bits (119),  Expect(3) = 4e-66, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   FQ
Sbjct  297  RSSGFIAMHASLSSGQIDICLIPEVPFQ  324



>ref|XP_010917037.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=527

 Score =   176 bits (447),  Expect(3) = 8e-66, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVHIQ QIK+HFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  406  EKSNATDASGNVVLSDIGVHIQQQIKRHFKAIGIPADVKYIDPTYMIRACRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+YLPIPEVI + R VDPNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITTGICNTHYVYLPIPEVITSPRCVDPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 75.5 bits (184),  Expect(3) = 8e-66, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G NGVL+HLEH I+TKG+AV+CVAEGAGQ+L+EKSN
Sbjct  366  PEVPFTLEGPNGVLQHLEHLIKTKGNAVICVAEGAGQELLEKSN  409


 Score = 47.8 bits (112),  Expect(3) = 8e-66, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP   F
Sbjct  344  RSSGFIAMHASLSSGQIDICLIPEVPF  370



>ref|XP_004250136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Solanum lycopersicum]
Length=532

 Score =   177 bits (450),  Expect(3) = 2e-65, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D+GVHIQ QIKK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  411  EKTNAKDASGNAVLGDIGVHIQQQIKKYFKEIGVTTDVKYIDPTYMIRACRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVIAQPKVVDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 70.9 bits (172),  Expect(3) = 2e-65, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAV+CVAEGAGQD +EK+N
Sbjct  371  PEVPFNLHGPHGVLQHLKYLLETKGSAVICVAEGAGQDFLEKTN  414


 Score = 50.1 bits (118),  Expect(3) = 2e-65, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   F 
Sbjct  349  RSSGFIAMHASLASGQIDICLIPEVPFN  376



>ref|XP_004288505.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=537

 Score =   177 bits (449),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +  D+GVHIQ + KKHFK++   VDVKYIDPTY++R CRA+ASD I+C
Sbjct  416  QKTNAKDASGNVVFGDIGVHIQQETKKHFKELGVPVDVKYIDPTYMIRACRANASDGILC  475

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GIT+GICNTHY+YLPIPEVI+ SR VDPNSRMWHRCLTSTGQPD
Sbjct  476  AVLGQNAVHGAFAGYSGITIGICNTHYVYLPIPEVISHSRLVDPNSRMWHRCLTSTGQPD  535

Query  195  F  193
            F
Sbjct  536  F  536


 Score = 68.9 bits (167),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ IETKGSAVVCVAEGAGQ+L++K+N
Sbjct  376  PEVPFQIHGPHGILHHLKYLIETKGSAVVCVAEGAGQNLIQKTN  419


 Score = 51.2 bits (121),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   FQ
Sbjct  354  RSSGFIAMHASLASGQIDICLIPEVPFQ  381



>ref|XP_008455602.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic [Cucumis melo]
Length=533

 Score =   177 bits (449),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GV+IQ ++KK+FK++   VDVKYIDPTY++R CRA+ASD I+C
Sbjct  412  QKTNATDASGNIVLSDIGVYIQQEMKKYFKELSVPVDVKYIDPTYMIRACRANASDGILC  471

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  472  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVISYPRLLDPNSRMWHRCLTSTGQPD  531

Query  195  F  193
            F
Sbjct  532  F  532


 Score = 70.1 bits (170),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF+L G +GVL+H+++ I+TKGSAVVCVAEGAGQ+L++K+N
Sbjct  372  PEVPFQLHGPHGVLRHIKYLIDTKGSAVVCVAEGAGQNLLQKTN  415


 Score = 50.1 bits (118),  Expect(3) = 3e-65, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHA+LASGQID CL+P   FQ
Sbjct  350  RSSGFIAMHAALASGQIDVCLVPEVPFQ  377



>ref|XP_009409142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409143.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   174 bits (442),  Expect(3) = 4e-65, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN +L D+GVHIQ QIK+HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  414  DASGNVVLGDIGVHIQQQIKRHFKNIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  473

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT GICN HY+YLPIPEVI + R VDPNSRMWHRCLTSTGQPDF
Sbjct  474  AVHGAFAGFSGITTGICNIHYVYLPIPEVIRSPRRVDPNSRMWHRCLTSTGQPDF  528


 Score = 73.6 bits (179),  Expect(3) = 4e-65, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPFKL+G NG+L+HLEH I+TKG AVVCVAEGAGQ+L++KS
Sbjct  368  PEVPFKLEGPNGLLQHLEHLIKTKGKAVVCVAEGAGQELLQKS  410


 Score = 48.9 bits (115),  Expect(3) = 4e-65, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F+
Sbjct  346  RSSGFIAMHASLSSGQIDICLIPEVPFK  373



>ref|XP_009409144.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   175 bits (443),  Expect(3) = 5e-65, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN +L D+GVHIQ QIK+HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  296  DASGNVVLGDIGVHIQQQIKRHFKNIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  355

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT GICN HY+YLPIPEVI + R VDPNSRMWHRCLTSTGQPDF
Sbjct  356  AVHGAFAGFSGITTGICNIHYVYLPIPEVIRSPRRVDPNSRMWHRCLTSTGQPDF  410


 Score = 73.6 bits (179),  Expect(3) = 5e-65, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPFKL+G NG+L+HLEH I+TKG AVVCVAEGAGQ+L++KS
Sbjct  250  PEVPFKLEGPNGLLQHLEHLIKTKGKAVVCVAEGAGQELLQKS  292


 Score = 48.5 bits (114),  Expect(3) = 5e-65, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F+
Sbjct  228  RSSGFIAMHASLSSGQIDICLIPEVPFK  255



>gb|KCW54603.1| hypothetical protein EUGRSUZ_I005552, partial [Eucalyptus grandis]
 gb|KCW54604.1| hypothetical protein EUGRSUZ_I005552, partial [Eucalyptus grandis]
Length=199

 Score =   177 bits (449),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +LSD+GVHIQ + KK+F++I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  78   EKTNAKDASGNIVLSDIGVHIQQETKKYFREIGVPADVKYIDPTYMIRACRANASDGILC  137

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  138  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVIQYPRSVDPNSRMWHRCLTSTGQPD  197

Query  195  F  193
            F
Sbjct  198  F  198


 Score = 71.2 bits (173),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+ +EK+N
Sbjct  38   PEVPFHLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNFLEKTN  81


 Score = 48.5 bits (114),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSG+IAMHASLASGQID CLIP   F 
Sbjct  16   RSSGYIAMHASLASGQIDICLIPEVPFH  43



>ref|XP_009409133.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   178 bits (452),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            K   + DASGN +LSD+GVH+Q QIK+HFK +    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  408  KKSNTTDASGNVVLSDIGVHVQQQIKRHFKDVGIPADVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH++Y P+ EVIA++R+VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITTGICNTHFVYFPVTEVIASTRYVDPNSRMWHRCLTSTGQPD  527

Query  195  FS  190
            F 
Sbjct  528  FE  529


 Score = 68.6 bits (166),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PFKL+G NGVL HLE+ ++TKG+AV+CVAEGAGQ+ ++KSN
Sbjct  368  PEAPFKLEGPNGVLVHLEYLLKTKGNAVICVAEGAGQEYLKKSN  411


 Score = 50.1 bits (118),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   F+
Sbjct  346  RSSGFIAMHASLSSGQIDICLIPEAPFK  373



>ref|XP_006353187.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum 
tuberosum]
Length=532

 Score =   177 bits (450),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D+GVHIQ QIKK+FK+IE   DVKYIDPTY++R CRA+ASD I+C
Sbjct  411  EKTNAKDASGNAVLGDIGVHIQQQIKKYFKEIEVTTDVKYIDPTYMIRACRANASDRILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVIAQPKIVDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 68.9 bits (167),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +E KGSAV+CVAEGAGQD +EK+N
Sbjct  371  PEVPFNLHGPHGVLQHLKYLLEAKGSAVICVAEGAGQDFLEKTN  414


 Score = 49.7 bits (117),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   F 
Sbjct  349  RSSGFIAMHASLASGQIDICLIPEVPFN  376



>ref|XP_004137185.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53656.1| hypothetical protein Csa_4G097630 [Cucumis sativus]
Length=532

 Score =   177 bits (449),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GV+IQ ++KK+FK++   VDVKYIDPTY++R CRA+ASD I+C
Sbjct  411  QKTNATDASGNIVLSDIGVYIQQEMKKYFKELSVPVDVKYIDPTYMIRACRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVISYPRLLDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 68.6 bits (166),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF+L G +GVL+H+++ I+TKGSAVVCVAEG GQ+L++K+N
Sbjct  371  PEVPFQLHGPHGVLRHIKYLIDTKGSAVVCVAEGGGQNLLQKTN  414


 Score = 50.8 bits (120),  Expect(3) = 6e-65, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHA+LASGQID CLIP   FQ
Sbjct  349  RSSGFIAMHAALASGQIDVCLIPEVPFQ  376



>ref|XP_004154749.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cucumis 
sativus]
Length=532

 Score =   177 bits (449),  Expect(3) = 7e-65, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GV+IQ ++KK+FK++   VDVKYIDPTY++R CRA+ASD I+C
Sbjct  411  QKTNATDASGNIVLSDIGVYIQQEMKKYFKELSVPVDVKYIDPTYMIRACRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVISYPRLLDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 68.6 bits (166),  Expect(3) = 7e-65, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF+L G +GVL+H+++ I+TKGSAVVCVAEG GQ+L++K+N
Sbjct  371  PEVPFQLHGPHGVLRHIKYLIDTKGSAVVCVAEGGGQNLLQKTN  414


 Score = 50.8 bits (120),  Expect(3) = 7e-65, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHA+LASGQID CLIP   FQ
Sbjct  349  RSSGFIAMHAALASGQIDVCLIPEVPFQ  376



>ref|XP_008802617.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Phoenix dactylifera]
Length=529

 Score =   175 bits (444),  Expect(3) = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD GVHIQH+IKKHFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  408  QKSNATDASGNNVLSDFGVHIQHKIKKHFKDIGVPADVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+YLPIPEVI + R VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITTGICNTHYVYLPIPEVIRSPRCVDPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 73.9 bits (180),  Expect(3) = 9e-65, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G  GVL+HLEH I+TKG AVVCVAEGAGQD M+KSN
Sbjct  368  PEVPFGLEGPYGVLRHLEHLIQTKGHAVVCVAEGAGQDFMQKSN  411


 Score = 46.6 bits (109),  Expect(3) = 9e-65, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHASL+SGQID CLIP   F
Sbjct  346  RDSGFIAMHASLSSGQIDICLIPEVPF  372



>ref|XP_004236699.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=533

 Score =   179 bits (453),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q ++KK+FK++ Q  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  415  NAKDASGNAVLGDIGVYLQQEVKKYFKELGQTADVKYIDPTYMIRACRANASDGILCTVL  474

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  475  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  532


 Score = 70.1 bits (170),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAVVC AEGAGQD +EK+N
Sbjct  372  PEVPFNLHGPHGVLRHLKYLLETKGSAVVCAAEGAGQDFLEKTN  415


 Score = 46.6 bits (109),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  350  RSSGFIAMQASLASGQIDICLIPEVPFN  377



>ref|XP_006466285.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Citrus 
sinensis]
Length=532

 Score =   176 bits (447),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            K   + DASGN +L DVGV IQ + KK+FK+I   +DVKYIDPTY++R CRA+ASD I+C
Sbjct  411  KKTNATDASGNVVLGDVGVLIQQETKKYFKEIGVPIDVKYIDPTYMIRACRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG+CNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGFSGITVGLCNTHYAYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 69.7 bits (169),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PF L G NGVL+HL++ IETKGSAVVCVAEGAGQ L++K+N
Sbjct  371  PESPFNLHGPNGVLRHLKYLIETKGSAVVCVAEGAGQSLIKKTN  414


 Score = 49.3 bits (116),  Expect(3) = 1e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSG+IAMHASLASGQID CLIP   F 
Sbjct  349  RSSGYIAMHASLASGQIDICLIPESPFN  376



>ref|XP_009599322.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186} [Nicotiana tomentosiformis]
Length=536

 Score =   178 bits (452),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q +IKK+FK++ +  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  418  NAKDASGNAVLGDIGVYLQQEIKKYFKEMGETSDVKYIDPTYMIRACRANASDGILCTVL  477

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  478  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  535


 Score = 70.1 bits (170),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAVVC AEGAGQD +EK+N
Sbjct  375  PEVPFNLHGPHGVLRHLKYLLETKGSAVVCAAEGAGQDFLEKTN  418


 Score = 46.6 bits (109),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  353  RSSGFIAMQASLASGQIDICLIPEVPFN  380



>ref|XP_004956817.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Setaria 
italica]
Length=529

 Score =   176 bits (446),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I    D+KYIDPTY++R CRA+ASDAI+C
Sbjct  408  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVPADLKYIDPTYMVRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTHY+YLPIPEVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITSGVCNTHYVYLPIPEVITTPKHVNPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 70.1 bits (170),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GVL+HLEH + TKG  ++CVAEGAGQDL++KSN
Sbjct  368  PEVSFTLDGEHGVLQHLEHLLNTKGFCMICVAEGAGQDLLQKSN  411


 Score = 49.3 bits (116),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP  +F
Sbjct  346  RSSGFIAMHASLSSGQIDVCLIPEVSF  372



>ref|XP_006426295.1| hypothetical protein CICLE_v10025337mg [Citrus clementina]
 gb|ESR39535.1| hypothetical protein CICLE_v10025337mg [Citrus clementina]
 gb|KDO60625.1| hypothetical protein CISIN_1g009559mg [Citrus sinensis]
Length=532

 Score =   176 bits (446),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            K   + DASGN +L DVGV IQ + KK+FK+I   +DVKYIDPTY++R CRA+ASD I+C
Sbjct  411  KKTNATDASGNIVLGDVGVLIQQETKKYFKEIGVPIDVKYIDPTYMIRACRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG+CNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGFSGITVGLCNTHYAYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 69.7 bits (169),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PF L G NGVL+HL++ IETKGSAVVCVAEGAGQ L++K+N
Sbjct  371  PESPFNLHGPNGVLRHLKYLIETKGSAVVCVAEGAGQSLIKKTN  414


 Score = 49.3 bits (116),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSG+IAMHASLASGQID CLIP   F 
Sbjct  349  RSSGYIAMHASLASGQIDICLIPESPFN  376



>ref|XP_004983148.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Setaria 
italica]
Length=525

 Score =   173 bits (438),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVH+Q +IK HF  I    D+KYIDPTY+LR  RA+ASDAI+C
Sbjct  404  QKSNATDASGNMVLSDIGVHLQQKIKSHFSNIGVHSDIKYIDPTYMLRAVRANASDAILC  463

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  464  TVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSARFVDPNSRMWHRCLTSTGQPD  523

Query  195  F  193
            F
Sbjct  524  F  524


 Score = 75.1 bits (183),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A+VCVAEGAGQ+ ++KSN
Sbjct  364  PEVPFTLDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYLQKSN  407


 Score = 47.0 bits (110),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  342  RSSGFITMHASLSSGQVDVCLIPEVPF  368



>ref|XP_006346747.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum 
tuberosum]
Length=537

 Score =   178 bits (452),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q +IKK+FK++ Q  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  419  NAKDASGNAVLGDIGVYLQQEIKKYFKELGQTADVKYIDPTYMIRACRANASDGILCTVL  478

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  479  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  536


 Score = 70.1 bits (170),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAVVC AEGAGQD +EK+N
Sbjct  376  PEVPFNLHGPHGVLRHLKYLLETKGSAVVCAAEGAGQDFLEKTN  419


 Score = 46.6 bits (109),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  354  RSSGFIAMQASLASGQIDICLIPEVPFN  381



>ref|XP_010027951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Eucalyptus grandis]
Length=543

 Score =   176 bits (447),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +LSD+GVHIQ + KK+F++I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  422  EKTNAKDASGNIVLSDIGVHIQQETKKYFREIGVPADVKYIDPTYMIRACRANASDGILC  481

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  482  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVIQYPRSVDPNSRMWHRCLTSTGQPD  541

Query  195  F  193
            F
Sbjct  542  F  542


 Score = 70.1 bits (170),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+ +EK+N
Sbjct  382  PEVPFHLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNFLEKTN  425


 Score = 48.1 bits (113),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSG+IAMHASLASGQID CLIP   F 
Sbjct  360  RSSGYIAMHASLASGQIDICLIPEVPFH  387



>dbj|BAK00986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   174 bits (441),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD GVH+Q +IKKHFK I  L DVKYIDPTY++R CRA+ASDAI+C
Sbjct  409  QKSNATDASGNVVLSDFGVHMQQKIKKHFKDIGVLADVKYIDPTYMVRACRANASDAILC  468

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  469  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  528

Query  195  F  193
            F
Sbjct  529  F  529


 Score = 72.4 bits (176),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GVL HLEH +ETKG  VVCVAEGAGQDL++KSN
Sbjct  369  PEVSFTLDGEHGVLAHLEHLLETKGFCVVCVAEGAGQDLLQKSN  412


 Score = 48.5 bits (114),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RS+GFIAMHASL+SGQID CLIP  +F
Sbjct  347  RSTGFIAMHASLSSGQIDVCLIPEVSF  373



>ref|XP_009785216.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Nicotiana sylvestris]
Length=538

 Score =   178 bits (451),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q +IKK+FK++ +  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  420  NAKDASGNAVLGDIGVYLQQEIKKYFKEMGETSDVKYIDPTYMIRACRANASDGILCTVL  479

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  480  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  537


 Score = 70.1 bits (170),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAVVC AEGAGQD +EK+N
Sbjct  377  PEVPFNLHGPHGVLRHLKYLLETKGSAVVCAAEGAGQDFLEKTN  420


 Score = 46.6 bits (109),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  355  RSSGFIAMQASLASGQIDICLIPEVPFN  382



>tpg|DAA50031.1| TPA: hypothetical protein ZEAMMB73_945143 [Zea mays]
Length=266

 Score =   175 bits (444),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            ++   + DASGN +LSD+GVH+Q +IK HFK I    DVKYIDPTY+LR  RA+ASDAI+
Sbjct  144  FQKSNATDASGNMVLSDIGVHLQQKIKSHFKDIGVHSDVKYIDPTYMLRAVRANASDAIL  203

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CTVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R +DPNSRMWHRCLTSTGQP
Sbjct  204  CTVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRFIDPNSRMWHRCLTSTGQP  263

Query  198  DF  193
            DF
Sbjct  264  DF  265


 Score = 73.2 bits (178),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF +DG NGVL+HLEH IETKG A+VCVAEGAGQ+  +KSN
Sbjct  105  PEVPFTVDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSN  148


 Score = 46.6 bits (109),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  83   RSSGFITMHASLSSGQVDICLIPEVPF  109



>ref|XP_010238165.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=531

 Score =   176 bits (445),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I  L D+KYIDPTY++R CRA+ASDAI+C
Sbjct  410  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVLADIKYIDPTYMVRACRANASDAILC  469

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY YLPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  470  TVLGQNAVHGAFAGFSGITSGICNTHYAYLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  529

Query  195  F  193
            F
Sbjct  530  F  530


 Score = 70.5 bits (171),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE+ F LDGE GVL HLEH ++TKG  VVCVAEGAGQDL++KSN
Sbjct  370  PEISFTLDGERGVLAHLEHLLKTKGFCVVCVAEGAGQDLLQKSN  413


 Score = 48.1 bits (113),  Expect(3) = 2e-64, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RS+GFIAMHASL+SGQID CLIP  +F
Sbjct  348  RSTGFIAMHASLSSGQIDVCLIPEISF  374



>gb|EYU30954.1| hypothetical protein MIMGU_mgv1a004409mg [Erythranthe guttata]
Length=528

 Score =   181 bits (459),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D+GV+IQ + KK FK++    DVKYIDPTY++R CRA+ASD I+C
Sbjct  407  EKTNAKDASGNTVLGDIGVYIQQETKKFFKELGFPADVKYIDPTYMIRACRANASDGILC  466

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVIA SR VDPNSRMWHRCLTSTGQPD
Sbjct  467  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVIAQSRSVDPNSRMWHRCLTSTGQPD  526

Query  195  F  193
            F
Sbjct  527  F  527


 Score = 66.6 bits (161),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F L G +GVL HL++ +E KGSAVVCVAEGAGQDL+EK+N
Sbjct  367  PEVQFNLHGPHGVLSHLKYLLERKGSAVVCVAEGAGQDLLEKTN  410


 Score = 46.6 bits (109),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  345  RSSGFIAMQASLASGQIDICLIPEVQFN  372



>ref|XP_002462379.1| hypothetical protein SORBIDRAFT_02g024680 [Sorghum bicolor]
 gb|EER98900.1| hypothetical protein SORBIDRAFT_02g024680 [Sorghum bicolor]
Length=529

 Score =   173 bits (438),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I    D+KYIDPTY++R CRA+ASDAI+C
Sbjct  408  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVPADLKYIDPTYMVRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTHY+YLPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITSGVCNTHYVYLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 72.0 bits (175),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GVL+HLEH + TKG  VVCVAEGAGQDL++KSN
Sbjct  368  PEVSFTLDGEHGVLRHLEHLLNTKGFCVVCVAEGAGQDLLQKSN  411


 Score = 49.3 bits (116),  Expect(3) = 3e-64, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP  +F
Sbjct  346  RSSGFIAMHASLSSGQIDVCLIPEVSF  372



>ref|XP_008670192.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Zea mays]
 tpg|DAA40074.1| TPA: hypothetical protein ZEAMMB73_770546 [Zea mays]
 tpg|DAA40075.1| TPA: hypothetical protein ZEAMMB73_770546 [Zea mays]
Length=527

 Score =   172 bits (437),  Expect(3) = 4e-64, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I    D+KYIDPTY++R CRA+ASDAI+C
Sbjct  406  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVPADLKYIDPTYMVRACRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTHY+YLPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITSGVCNTHYVYLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 72.0 bits (175),  Expect(3) = 4e-64, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GVL+HLEH + TKG  VVCVAEGAGQDL++KSN
Sbjct  366  PEVSFTLDGEHGVLRHLEHLLNTKGFCVVCVAEGAGQDLLQKSN  409


 Score = 49.3 bits (116),  Expect(3) = 4e-64, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP  +F
Sbjct  344  RSSGFIAMHASLSSGQIDVCLIPEVSF  370



>ref|XP_010939502.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939505.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=529

 Score =   176 bits (446),  Expect(3) = 7e-64, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVHIQH+IKKHFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  408  QKSNATDASGNVVLSDIGVHIQHKIKKHFKGIGVPADVKYIDPTYMIRACRANASDAILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY+YLPIPEVI + R VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGFSGITTGICNTHYVYLPIPEVIRSPRCVDPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 70.1 bits (170),  Expect(3) = 7e-64, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L+G  GVL HLEH I+TKG AVVCVAEGAGQD ++KSN
Sbjct  368  PEVPFALEGPYGVLWHLEHLIQTKGHAVVCVAEGAGQDFLQKSN  411


 Score = 46.6 bits (109),  Expect(3) = 7e-64, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHASL+SGQID CLIP   F
Sbjct  346  RESGFIAMHASLSSGQIDICLIPEVPF  372



>ref|NP_001147085.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Zea 
mays]
 gb|ACG25393.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Zea 
mays]
Length=525

 Score =   173 bits (439),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            ++   + DASGN +LSD+GVH+Q +IK HFK I    DVKYIDPTY+LR  RA+ASDAI+
Sbjct  403  FQKSNATDASGNMVLSDIGVHLQQKIKSHFKDIGVHSDVKYIDPTYMLRAVRANASDAIL  462

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CTVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R +DPNSRMWHRCLTSTGQP
Sbjct  463  CTVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRFIDPNSRMWHRCLTSTGQP  522

Query  198  DF  193
            DF
Sbjct  523  DF  524


 Score = 72.8 bits (177),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF +DG NGVL+HLEH IETKG A+VCVAEGAGQ+  +KSN
Sbjct  364  PEVPFTVDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSN  407


 Score = 46.2 bits (108),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  342  RSSGFITMHASLSSGQVDICLIPEVPF  368



>gb|ACR35078.1| unknown [Zea mays]
 tpg|DAA50030.1| TPA: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
[Zea mays]
Length=525

 Score =   173 bits (439),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            ++   + DASGN +LSD+GVH+Q +IK HFK I    DVKYIDPTY+LR  RA+ASDAI+
Sbjct  403  FQKSNATDASGNMVLSDIGVHLQQKIKSHFKDIGVHSDVKYIDPTYMLRAVRANASDAIL  462

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CTVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R +DPNSRMWHRCLTSTGQP
Sbjct  463  CTVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRFIDPNSRMWHRCLTSTGQP  522

Query  198  DF  193
            DF
Sbjct  523  DF  524


 Score = 72.8 bits (177),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF +DG NGVL+HLEH IETKG A+VCVAEGAGQ+  +KSN
Sbjct  364  PEVPFTVDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSN  407


 Score = 46.2 bits (108),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  342  RSSGFITMHASLSSGQVDICLIPEVPF  368



>ref|XP_009348246.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=593

 Score =   171 bits (434),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  472  EKTNATDASGNMVFGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  531

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  532  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  591

Query  195  F  193
            F
Sbjct  592  F  592


 Score = 69.3 bits (168),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L+EK+N
Sbjct  432  PEVPFQIHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLIEKTN  475


 Score = 51.2 bits (121),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   FQ
Sbjct  410  RSSGFIAMHASLASGQIDICLIPEVPFQ  437



>gb|EMT10326.1| 6-phosphofructokinase 5, chloroplastic [Aegilops tauschii]
Length=543

 Score =   172 bits (436),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVH+Q +IK HF++I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  422  QKSNATDASGNMVLSDIGVHLQQKIKSHFREINVHSDVKYIDPTYMLRAVRANASDAILC  481

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  482  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPIPEVIKTPRLVDPNSRMWHRCLTSTGQPD  541

Query  195  F  193
            F
Sbjct  542  F  542


 Score = 73.9 bits (180),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ ++KSN
Sbjct  382  PEVPFTLDGPNGVLRHLEHLIETKGFALMCVAEGAGQEYLQKSN  425


 Score = 46.2 bits (108),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  360  RSSGFITMHASLSSGQVDICLIPEVPF  386



>gb|EMS54985.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=543

 Score =   172 bits (435),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+GVH+Q +IK HF++I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  422  QKSNATDASGNMVLSDIGVHLQQKIKSHFREINVHSDVKYIDPTYMLRAVRANASDAILC  481

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  482  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPIPEVIKTPRLVDPNSRMWHRCLTSTGQPD  541

Query  195  F  193
            F
Sbjct  542  F  542


 Score = 73.9 bits (180),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ ++KSN
Sbjct  382  PEVPFTLDGPNGVLRHLEHLIETKGFALMCVAEGAGQEYLQKSN  425


 Score = 46.2 bits (108),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  360  RSSGFITMHASLSSGQVDICLIPEVPF  386



>ref|XP_010266371.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Nelumbo nucifera]
Length=526

 Score =   171 bits (432),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + D SGN +L D+GVHIQ + KK+FK+I+   DVKYIDPTY++R CRA+ASD I+C
Sbjct  405  EKTNATDPSGNIVLGDIGVHIQQETKKYFKEIDVPADVKYIDPTYMIRACRANASDGILC  464

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG+ GITVGICNTHY+Y PIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  465  TVLGQNAVHGAFAGYGGITVGICNTHYVYFPIPEVISYPRQLDPNSRMWHRCLTSTGQPD  524

Query  195  FS  190
            F+
Sbjct  525  FT  526


 Score = 72.4 bits (176),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL + +ETKGSAVVCVAEGAGQ+ +EK+N
Sbjct  365  PEVPFHLHGPNGVLKHLRYLVETKGSAVVCVAEGAGQNFLEKTN  408


 Score = 48.9 bits (115),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQ+D CLIP   F 
Sbjct  343  RSSGFIAMHASLASGQVDICLIPEVPFH  370



>ref|XP_010693230.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=541

 Score =   173 bits (438),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -2

Query  540  KDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQ  361
            KDASGN +L D+GVH + QIK +FK+     D+KYIDPTY++R  RA+ASDAI+CTVLGQ
Sbjct  421  KDASGNAVLGDIGVHFKSQIKSYFKEKGIHADIKYIDPTYMVRSVRANASDAILCTVLGQ  480

Query  360  NAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            NAVHGAFAGF+GIT+GICNTHY+YLPI EVI A R V+PNSRMWHRCLTSTGQPDFS
Sbjct  481  NAVHGAFAGFSGITMGICNTHYVYLPITEVIHAPRTVNPNSRMWHRCLTSTGQPDFS  537


 Score = 70.1 bits (170),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFE  539
            PEVPF L+G NGVL HLEH I TKG+AV+CVAEGAGQ+L+  S+ +
Sbjct  376  PEVPFTLNGPNGVLSHLEHLIRTKGAAVMCVAEGAGQELLAASDLK  421


 Score = 49.3 bits (116),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASLASGQ+D CLIP   F
Sbjct  354  RSSGFIAMHASLASGQVDVCLIPEVPF  380



>emb|CDY13756.1| BnaA09g42580D [Brassica napus]
Length=539

 Score =   172 bits (436),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN IL D GVHIQ + KK+FK++   VDVKYIDPTY++R  RA+ASD I+C
Sbjct  418  EKTNAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILC  477

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  478  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  537

Query  195  F  193
            F
Sbjct  538  F  538


 Score = 74.3 bits (181),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF + G NGVLKHL++ IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  378  PEVPFNIHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTN  421


 Score = 45.4 bits (106),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPEVPFN  383



>emb|CDX76918.1| BnaC08g35040D [Brassica napus]
Length=539

 Score =   172 bits (436),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN IL D GVHIQ + KK+FK++   VDVKYIDPTY++R  RA+ASD I+C
Sbjct  418  EKTNAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILC  477

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  478  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  537

Query  195  F  193
            F
Sbjct  538  F  538


 Score = 74.3 bits (181),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF + G NGVLKHL++ IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  378  PEVPFNIHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTN  421


 Score = 45.4 bits (106),  Expect(3) = 1e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPEVPFN  383



>gb|AIE16182.1| chloroplast 6-phosphofructokinase 4 [Nicotiana tabacum]
Length=538

 Score =   178 bits (451),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q +IKK+FK++ +  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  420  NAKDASGNAVLGDIGVYLQQEIKKYFKEMGETSDVKYIDPTYMIRACRANASDGILCTVL  479

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  480  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  537


 Score = 67.4 bits (163),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G + VL+HL++ +ETKGSAVVC AEGAGQD +EK+N
Sbjct  377  PEVPFNLHGPHRVLRHLKYLLETKGSAVVCAAEGAGQDFLEKTN  420


 Score = 46.6 bits (109),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  355  RSSGFIAMQASLASGQIDICLIPEVPFN  382



>ref|XP_008385679.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic isoform X2 
[Malus domestica]
Length=497

 Score =   171 bits (433),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  376  EKTNATDASGNMVYGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  435

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  436  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  495

Query  195  F  193
            F
Sbjct  496  F  496


 Score = 69.3 bits (168),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L+EK+N
Sbjct  336  PEVPFQIHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLIEKTN  379


 Score = 51.6 bits (122),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   FQ
Sbjct  314  RSSGFIAMHASLASGQIDICLIPEVPFQ  341



>ref|XP_009340975.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=528

 Score =   171 bits (433),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  407  EKTNATDASGNMVFGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  466

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  467  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  526

Query  195  F  193
            F
Sbjct  527  F  527


 Score = 69.3 bits (168),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L+EK+N
Sbjct  367  PEVPFQIHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLIEKTN  410


 Score = 51.2 bits (121),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   FQ
Sbjct  345  RSSGFIAMHASLASGQIDICLIPEVPFQ  372



>gb|KJB18252.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=513

 Score =   174 bits (442),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN +L D+GV IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+CTVLGQN
Sbjct  398  DASGNIVLGDIGVRIQQETKKYFKEIGIPADVKYIDPTYMIRACRANASDGILCTVLGQN  457

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  458  AVHGAFAGYSGITVGICNTHYVYFPIPEVISHPREVDPNSRMWHRCLTSTGQPDF  512


 Score = 72.0 bits (175),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+L+EK+N
Sbjct  352  PEVPFNLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNLVEKTN  395


 Score = 45.1 bits (105),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQ+D CLIP   F 
Sbjct  330  RSSGFIAMQSSLASGQVDICLIPEVPFN  357



>ref|XP_002464639.1| hypothetical protein SORBIDRAFT_01g022370 [Sorghum bicolor]
 gb|EER91637.1| hypothetical protein SORBIDRAFT_01g022370 [Sorghum bicolor]
Length=524

 Score =   174 bits (440),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            ++   + DASGN +LSD+GVH+Q +IK HFK I    D+KYIDPTY+LR  RA+ASDAI+
Sbjct  402  FQKSNATDASGNMVLSDIGVHLQQKIKSHFKDIGVHSDIKYIDPTYMLRAVRANASDAIL  461

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CTVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R VDPNSRMWHRCLTSTGQP
Sbjct  462  CTVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRFVDPNSRMWHRCLTSTGQP  521

Query  198  DF  193
            DF
Sbjct  522  DF  523


 Score = 74.3 bits (181),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A+VCVAEGAGQ+  +KSN
Sbjct  363  PEVPFTLDGPNGVLRHLEHLIETKGFALVCVAEGAGQEYFQKSN  406


 Score = 43.5 bits (101),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI M ASL+SGQ+D CLIP   F
Sbjct  341  RSSGFITMQASLSSGQVDICLIPEVPF  367



>gb|KJB18249.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=538

 Score =   174 bits (442),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GV IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  417  EKTNATDASGNIVLGDIGVRIQQETKKYFKEIGIPADVKYIDPTYMIRACRANASDGILC  476

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  477  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISHPREVDPNSRMWHRCLTSTGQPD  536

Query  195  F  193
            F
Sbjct  537  F  537


 Score = 72.0 bits (175),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+L+EK+N
Sbjct  377  PEVPFNLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNLVEKTN  420


 Score = 45.1 bits (105),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQ+D CLIP   F 
Sbjct  355  RSSGFIAMQSSLASGQVDICLIPEVPFN  382



>ref|XP_008385677.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic isoform X1 
[Malus domestica]
Length=528

 Score =   171 bits (432),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  407  EKTNATDASGNMVYGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  466

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  467  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  526

Query  195  F  193
            F
Sbjct  527  F  527


 Score = 69.3 bits (168),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L+EK+N
Sbjct  367  PEVPFQIHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLIEKTN  410


 Score = 51.6 bits (122),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   FQ
Sbjct  345  RSSGFIAMHASLASGQIDICLIPEVPFQ  372



>gb|AIE47273.1| phosphofructokinase [Hevea brasiliensis]
Length=536

 Score =   174 bits (442),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVHIQ + KK+FK+I   VDVKYIDPTY++R CRA+ASD I+C
Sbjct  415  EKTNATDASGNIVLGDIGVHIQQETKKYFKEIGVHVDVKYIDPTYMIRACRANASDGILC  474

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  475  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISHPRAVDPNSRMWHRCLTSTGQPD  534

Query  195  F  193
            F
Sbjct  535  F  535


 Score = 70.5 bits (171),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+ +EK+N
Sbjct  375  PEVPFHLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNFLEKTN  418


 Score = 46.2 bits (108),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  740  SSGFIAMHASLASGQIDACLIPRGAFQ  660
            SSGFIAMHA+LASGQID CLIP   F 
Sbjct  354  SSGFIAMHAALASGQIDICLIPEVPFH  380



>gb|KHG10318.1| 6-phosphofructokinase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=186

 Score =   174 bits (441),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GV IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  65   EKTNATDASGNIVLGDIGVRIQQETKKYFKEIGIPADVKYIDPTYMIRACRANASDGILC  124

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  125  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISHPREVDPNSRMWHRCLTSTGQPD  184

Query  195  F  193
            F
Sbjct  185  F  185


 Score = 72.0 bits (175),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+L+EK+N
Sbjct  25   PEVPFNLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNLVEKTN  68


 Score = 45.1 bits (105),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQ+D CLIP   F 
Sbjct  3    RSSGFIAMQSSLASGQVDICLIPEVPFN  30



>ref|XP_003573900.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010234716.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=527

 Score =   171 bits (434),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +LSD+G H+Q +IK HF +I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  406  QKSNATDASGNMVLSDIGAHLQQKIKSHFNEIGVHSDVKYIDPTYMLRAVRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRFVDPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 73.2 bits (178),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH I+TKG A++C+AEGAGQ+ ++KSN
Sbjct  366  PEVPFTLDGPNGVLRHLEHLIDTKGFALICIAEGAGQEYLQKSN  409


 Score = 46.2 bits (108),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFITMHASLSSGQVDICLIPEVPF  370



>gb|EYU39321.1| hypothetical protein MIMGU_mgv1a004379mg [Erythranthe guttata]
Length=530

 Score =   172 bits (435),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN IL D+GVHIQ + KK FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  409  QKTNATDASGNIILGDIGVHIQQETKKFFKEIGFTADVKYIDPTYMIRACRANASDGILC  468

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG +GITVGICNTHY+Y PIP+VIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  469  TVLGQNAVHGAFAGHSGITVGICNTHYVYFPIPQVIAEPKVVDPNSRMWHRCLTSTGQPD  528

Query  195  F  193
            F
Sbjct  529  F  529


 Score = 72.4 bits (176),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF + G NGVL HL++ +ETKGSAVVCVAEGAGQDL++K+N
Sbjct  369  PEVPFNIHGPNGVLNHLKYLLETKGSAVVCVAEGAGQDLLQKTN  412


 Score = 46.6 bits (109),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  347  RSSGFIAMQASLASGQIDICLIPEVPFN  374



>ref|XP_010472236.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Camelina sativa]
Length=535

 Score =   171 bits (434),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN IL D GV+IQ + KK+FK+    +DVKYIDPTY++R  RA+ASD I+C
Sbjct  414  EKTNAKDASGNTILGDFGVYIQQETKKYFKESSIPIDVKYIDPTYMIRAVRANASDGILC  473

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  474  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  533

Query  195  F  193
            F
Sbjct  534  F  534


 Score = 73.6 bits (179),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  374  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  417


 Score = 45.4 bits (106),  Expect(3) = 3e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  352  RNSGFIAMQASLASGQVDICLIPEVPFN  379



>gb|KDP29747.1| hypothetical protein JCGZ_18682 [Jatropha curcas]
Length=536

 Score =   174 bits (442),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  415  RKTNATDASGNIVLGDIGVHIQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILC  474

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  475  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPD  534

Query  195  F  193
            F
Sbjct  535  F  535


 Score = 67.4 bits (163),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +ETKGSAVVCVAEGAGQ  + K+N
Sbjct  375  PEVPFHLHGPHGVLRHLKYLLETKGSAVVCVAEGAGQSFLRKTN  418


 Score = 48.1 bits (113),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHA+LASGQID CLIP   F 
Sbjct  353  RSSGFIAMHAALASGQIDICLIPEVPFH  380



>ref|XP_010429169.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Camelina sativa]
Length=536

 Score =   171 bits (433),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+    +DVKYIDPTY++R  RA+ASD I+C
Sbjct  415  EKTNAKDASGNTVLGDFGVYIQQETKKYFKESSIPIDVKYIDPTYMIRAVRANASDGILC  474

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  475  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  534

Query  195  F  193
            F
Sbjct  535  F  535


 Score = 73.6 bits (179),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  375  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  418


 Score = 45.4 bits (106),  Expect(3) = 5e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  353  RNSGFIAMQASLASGQVDICLIPEVPFN  380



>ref|XP_007208470.1| hypothetical protein PRUPE_ppa004086mg [Prunus persica]
 gb|EMJ09669.1| hypothetical protein PRUPE_ppa004086mg [Prunus persica]
Length=531

 Score =   171 bits (433),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  410  QKTNATDASGNVVFGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  469

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  470  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLIDPNSRMWHRCLTSTGQPD  529

Query  195  F  193
            F
Sbjct  530  F  530


 Score = 68.9 bits (167),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L++K+N
Sbjct  370  PEVPFQMHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLLQKTN  413


 Score = 50.4 bits (119),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   FQ
Sbjct  348  RSSGFIAMHASLSSGQIDICLIPEVPFQ  375



>ref|XP_007047816.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao]
 gb|EOX91973.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao]
Length=537

 Score =   173 bits (439),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN +L D GVHIQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+CTVLGQN
Sbjct  422  DASGNIVLGDFGVHIQQETKKYFKEIGIPADVKYIDPTYMIRACRANASDGILCTVLGQN  481

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  482  AVHGAFAGYSGITVGICNTHYVYFPIPEVISHPREVDPNSRMWHRCLTSTGQPDF  536


 Score = 71.6 bits (174),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVCVAEGAGQ+L+EK+N
Sbjct  376  PEVPFHLHGPHGVLRHLKYLIETKGSAVVCVAEGAGQNLVEKTN  419


 Score = 45.1 bits (105),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQ+D CLIP   F 
Sbjct  354  RSSGFIAMQSSLASGQVDICLIPEVPFH  381



>ref|XP_010417006.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Camelina sativa]
Length=537

 Score =   171 bits (432),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+    +DVKYIDPTY++R  RA+ASD I+C
Sbjct  416  EKTNAKDASGNTVLGDFGVYIQQETKKYFKESSIPIDVKYIDPTYMIRAVRANASDGILC  475

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  476  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  535

Query  195  F  193
            F
Sbjct  536  F  536


 Score = 73.6 bits (179),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  376  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  419


 Score = 45.4 bits (106),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  354  RNSGFIAMQASLASGQVDICLIPEVPFN  381



>ref|XP_008235410.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic [Prunus mume]
Length=531

 Score =   171 bits (432),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  410  QKTNATDASGNVVFGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  469

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R +DPNSRMWHRCLTSTGQPD
Sbjct  470  AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLIDPNSRMWHRCLTSTGQPD  529

Query  195  F  193
            F
Sbjct  530  F  530


 Score = 68.6 bits (166),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF++ G +G+L HL++ I+TKGSAVVCVAEGAGQ+L++K+N
Sbjct  370  PEVPFQMHGPHGILHHLKYLIQTKGSAVVCVAEGAGQNLLQKTN  413


 Score = 50.4 bits (119),  Expect(3) = 6e-63, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASL+SGQID CLIP   FQ
Sbjct  348  RSSGFIAMHASLSSGQIDICLIPEVPFQ  375



>ref|XP_006293956.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
 gb|EOA26854.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
Length=539

 Score =   171 bits (433),  Expect(3) = 7e-63, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+    +DVKYIDPTY++R  RA+ASD I+C
Sbjct  418  EKTNAKDASGNTVLGDFGVYIQQETKKYFKEKSIPIDVKYIDPTYMIRAVRANASDGILC  477

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  478  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  537

Query  195  F  193
            F
Sbjct  538  F  538


 Score = 73.6 bits (179),  Expect(3) = 7e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  378  PEVPFHLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  421


 Score = 45.4 bits (106),  Expect(3) = 7e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPEVPFH  383



>ref|XP_002878619.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54878.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   171 bits (432),  Expect(3) = 8e-63, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+I   +DVKYIDPTY++R  RA+ASD I+C
Sbjct  416  EKTNAKDASGNTVLGDFGVYIQQETKKYFKEISTPIDVKYIDPTYMIRAVRANASDGILC  475

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  476  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  535

Query  195  F  193
            F
Sbjct  536  F  536


 Score = 73.6 bits (179),  Expect(3) = 8e-63, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  376  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  419


 Score = 45.4 bits (106),  Expect(3) = 8e-63, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  354  RNSGFIAMQASLASGQVDICLIPEVPFN  381



>gb|KFK32811.1| hypothetical protein AALP_AA6G290900 [Arabis alpina]
Length=525

 Score =   170 bits (431),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+I   +DVKYIDPTY++R  RA+ASD I+C
Sbjct  404  EKTNAKDASGNTVLGDFGVYIQQETKKYFKEINVPLDVKYIDPTYMIRAVRANASDGILC  463

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  464  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  523

Query  195  F  193
            F
Sbjct  524  F  524


 Score = 73.2 bits (178),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL++ IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  364  PEVPFNLHGPHGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTN  407


 Score = 45.4 bits (106),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  342  RNSGFIAMQASLASGQVDICLIPEVPFN  369



>emb|CDP01541.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   177 bits (448),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D+GVHIQ +IKK+FK++    DVKYIDPTY++R CRA+ASD I+C
Sbjct  413  EKTNAKDASGNIVLGDIGVHIQQEIKKYFKEMGAPADVKYIDPTYMIRACRANASDGILC  472

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  473  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISQPRTVDPNSRMWHRCLTSTGQPD  532

Query  195  F  193
            F
Sbjct  533  F  533


 Score = 65.5 bits (158),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ + TKGSAVVCVAEGAGQ+ +EK+N
Sbjct  373  PEVPFNLHGPHGVLTHLKYLLATKGSAVVCVAEGAGQNHLEKTN  416


 Score = 46.6 bits (109),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  351  RSSGFIAMQASLASGQIDICLIPEVPFN  378



>ref|XP_010526665.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Tarenaya hassleriana]
Length=534

 Score =   169 bits (429),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D+GVHIQ + KK+FK++   VDVKYIDPTY++R  RA+ASD I+C
Sbjct  413  EKTNAKDASGNVVLGDIGVHIQQETKKYFKEVGIPVDVKYIDPTYMIRAVRANASDGILC  472

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG +GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  473  TVLGQNAVHGAFAGHSGITVGIINTHYAYLPIPEVIAYPKAVDPNSRMWHRCLTSTGQPD  532

Query  195  F  193
            F
Sbjct  533  F  533


 Score = 71.2 bits (173),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL++ IETKGSAVVCVAEGAGQ  +EK+N
Sbjct  373  PEVPFNLGGPHGVLKHLKYLIETKGSAVVCVAEGAGQSFLEKTN  416


 Score = 47.8 bits (112),  Expect(3) = 1e-62, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQAG  654
            RSSGFIAM ASLASGQ+D CLIP   F  G
Sbjct  351  RSSGFIAMQASLASGQVDICLIPEVPFNLG  380



>ref|XP_002530702.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF31697.1| phosphofructokinase, putative [Ricinus communis]
Length=431

 Score =   171 bits (433),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D GVH+Q + KK+FK+I    DVK+IDPTY++R CRA+ASD I+C
Sbjct  310  QKTNATDASGNIVLGDFGVHLQQETKKYFKEIGVHADVKFIDPTYMIRACRANASDGILC  369

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  370  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPD  429

Query  195  F  193
            F
Sbjct  430  F  430


 Score = 67.8 bits (164),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ IETKGSAVVCVAEGAGQ  ++K+N
Sbjct  270  PEVPFHLHGPHGVLNHLKYLIETKGSAVVCVAEGAGQSFLQKTN  313


 Score = 49.7 bits (117),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   F 
Sbjct  248  RSSGFIAMHASLASGQIDICLIPEVPFH  275



>ref|XP_002445557.1| hypothetical protein SORBIDRAFT_07g021500 [Sorghum bicolor]
 gb|EES15052.1| hypothetical protein SORBIDRAFT_07g021500 [Sorghum bicolor]
Length=527

 Score =   172 bits (435),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN I SD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  412  DASGNVIFSDIGVHMQQKIKTHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  471

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI AS+ V+PNSRMWHRCLTSTGQPDF
Sbjct  472  AVHGAFAGFSGITSCICNTHYVYLPITEVITASKRVNPNSRMWHRCLTSTGQPDF  526


 Score = 68.2 bits (165),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH +++KG  VVCVAE AGQDL++KS
Sbjct  366  PEVPFTLDGEFGVLQHLEHLLKSKGFCVVCVAEAAGQDLLQKS  408


 Score = 48.5 bits (114),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFIAMHASLSSGQVDVCLIPEVPF  370



>ref|XP_011097501.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Sesamum indicum]
Length=533

 Score =   167 bits (424),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN IL D+G +IQ + KK FK++    DVKYIDPTY++R  RA+ASD I+C
Sbjct  412  QKTNATDASGNVILGDIGAYIQQETKKFFKEVGVPADVKYIDPTYMIRAGRANASDGILC  471

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+Y PIPEVI   + VDPNSRMWHRCLTSTGQPD
Sbjct  472  TVLGQNAVHGAFAGYSGITVGICNTHYVYFPIPEVITEPKVVDPNSRMWHRCLTSTGQPD  531

Query  195  F  193
            F
Sbjct  532  F  532


 Score = 73.6 bits (179),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL HL+H +ETKGSAVVCVAEGAGQDL++K+N
Sbjct  372  PEVPFNLHGPQGVLSHLKHLLETKGSAVVCVAEGAGQDLLQKTN  415


 Score = 47.0 bits (110),  Expect(3) = 2e-62, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP   F 
Sbjct  350  RSSGFIAMQASLASGQIDICLIPEVPFN  377



>ref|XP_010107299.1| 6-phosphofructokinase 5 [Morus notabilis]
 gb|EXC14632.1| 6-phosphofructokinase 5 [Morus notabilis]
Length=523

 Score =   170 bits (430),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            K   + DASGN +L D+GV++Q + KK+F++I    DVK+IDPTY++R CRA+ASD I+C
Sbjct  402  KKTNATDASGNIVLGDIGVYLQQETKKYFREIGIPADVKFIDPTYMIRACRANASDGILC  461

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++G TVGICNTHY+YLPIPEVI+  R VD NSRMWHRCLTSTGQPD
Sbjct  462  TVLGQNAVHGAFAGYSGTTVGICNTHYVYLPIPEVISYPRLVDRNSRMWHRCLTSTGQPD  521

Query  195  FS  190
            F 
Sbjct  522  FE  523


 Score = 68.6 bits (166),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ IETKGSAVVC+AEGAGQ+ ++K+N
Sbjct  362  PEVPFHLHGPHGVLQHLKYLIETKGSAVVCIAEGAGQNFLKKTN  405


 Score = 49.7 bits (117),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   F 
Sbjct  340  RSSGFIAMHASLASGQIDICLIPEVPFH  367



>ref|XP_006659441.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=529

 Score =   167 bits (424),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN I SD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  414  DASGNVIFSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  473

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY YLPI EVI A + V+PNSRMWHRCLTSTGQPDF
Sbjct  474  AVHGAFAGFSGITSCICNTHYAYLPITEVITAPKRVNPNSRMWHRCLTSTGQPDF  528


 Score = 71.6 bits (174),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH +ETKG  VVCVAE AGQDL++KS
Sbjct  368  PEVPFTLDGEYGVLRHLEHLLETKGFCVVCVAEAAGQDLLQKS  410


 Score = 48.5 bits (114),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  346  RSSGFIAMHASLSSGQVDVCLIPEVPF  372



>ref|XP_004973537.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004973538.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004973539.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X3 [Setaria italica]
Length=527

 Score =   171 bits (434),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  412  DASGNVILSDIGVHMQQKIKTHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  471

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI A + V+PNSRMWHRCLTSTGQPDF
Sbjct  472  AVHGAFAGFSGITSCICNTHYVYLPITEVIKAPKRVNPNSRMWHRCLTSTGQPDF  526


 Score = 67.4 bits (163),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQDL++ S
Sbjct  366  PEVPFTLDGELGVLQHLEHLLKTKGFCVVCVAEAAGQDLLQNS  408


 Score = 48.5 bits (114),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFIAMHASLSSGQVDVCLIPEVPF  370



>dbj|BAK04400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   168 bits (426),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+G H+Q +IK HF++I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  406  QRSNATDASGNMVLGDIGAHLQQKIKSHFREINVHSDVKYIDPTYMLRAVRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPIPEVIKTPRLVDPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 72.8 bits (177),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ +++SN
Sbjct  366  PEVPFTLDGPNGVLRHLEHLIETKGFALMCVAEGAGQEYLQRSN  409


 Score = 46.2 bits (108),  Expect(3) = 3e-62, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFITMHASLSSGQVDICLIPEVPF  370



>ref|XP_006404705.1| hypothetical protein EUTSA_v10000117mg [Eutrema salsugineum]
 gb|ESQ46158.1| hypothetical protein EUTSA_v10000117mg [Eutrema salsugineum]
Length=538

 Score =   166 bits (421),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN IL D GVHIQ + KK+FK++   +DVKYIDPTY++R  RA+ASD I+CTVL
Sbjct  420  NAKDASGNTILGDFGVHIQQETKKYFKEVSIPIDVKYIDPTYMIRAVRANASDGILCTVL  479

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGI NTHY YLPI EVI   + VDPNSRMWHRCLTSTGQPDF
Sbjct  480  GQNAVHGAFAGYSGITVGIINTHYAYLPITEVIEYPKSVDPNSRMWHRCLTSTGQPDF  537


 Score = 75.5 bits (184),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  377  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTN  420


 Score = 45.4 bits (106),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  355  RNSGFIAMQASLASGQVDICLIPEVPFN  382



>ref|XP_006411816.1| hypothetical protein EUTSA_v10024871mg [Eutrema salsugineum]
 gb|ESQ53269.1| hypothetical protein EUTSA_v10024871mg [Eutrema salsugineum]
Length=537

 Score =   172 bits (436),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  416  ENTNAKDASGNKVLGDIGVHIQQETKKYFKEIGTSADVKYIDPTYMIRAVRANASDGILC  475

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA ++ VDPNSRMWHRCLTSTGQPD
Sbjct  476  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYAKSVDPNSRMWHRCLTSTGQPD  535

Query  195  F  193
            F
Sbjct  536  F  536


 Score = 68.9 bits (167),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL++ IETKGSAV+CVAEGAGQ  +E +N
Sbjct  376  PEVPFNLHGPHGVLKHLKYLIETKGSAVICVAEGAGQSFLENTN  419


 Score = 46.2 bits (108),  Expect(3) = 4e-62, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQ+D CLIP   F 
Sbjct  354  RSSGFIAMQASLASGQVDICLIPEVPFN  381



>ref|NP_850025.1| 6-phosphofructokinase 5 [Arabidopsis thaliana]
 sp|Q8VYN6.1|PFKA5_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 5, chloroplastic; 
Short=ATP-PFK 5; Short=Phosphofructokinase 5; AltName: 
Full=Phosphohexokinase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49898.1| putative pyrophosphate-fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAM20228.1| putative pyrophosphate-fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEC07312.1| 6-phosphofructokinase 5 [Arabidopsis thaliana]
Length=537

 Score =   168 bits (425),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+I   +DVKYIDPTY++R  RA+ASD I+C
Sbjct  416  EKTNAKDASGNAVLGDFGVYIQQETKKYFKEISTPIDVKYIDPTYMIRAVRANASDGILC  475

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPI EVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  476  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPITEVIAYPKSVDPNSRMWHRCLTSTGQPD  535

Query  195  F  193
            F
Sbjct  536  F  536


 Score = 73.9 bits (180),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  376  PEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  419


 Score = 45.4 bits (106),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  354  RNSGFIAMQASLASGQVDICLIPEVPFN  381



>dbj|BAJ90129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   168 bits (426),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+G H+Q +IK HF++I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  406  QRSNATDASGNMVLGDIGAHLQQKIKSHFREINVHSDVKYIDPTYMLRAVRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPIPEVIKTPRLVDPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 72.8 bits (177),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ +++SN
Sbjct  366  PEVPFTLDGPNGVLRHLEHLIETKGFALMCVAEGAGQEYLQRSN  409


 Score = 45.8 bits (107),  Expect(3) = 5e-62, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CL+P   F
Sbjct  344  RSSGFITMHASLSSGQVDICLVPEVPF  370



>ref|XP_006661761.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=525

 Score =   171 bits (434),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD+GVH+Q +IK HFK+I    DVKYIDPTY++R  RA+ASDAI+C
Sbjct  404  QQSNATDASGNMILSDIGVHLQQKIKSHFKEIGVHSDVKYIDPTYMVRAVRANASDAILC  463

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTH +YLPIPEVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  464  TVLGQNAVHGAFAGFSGITTGVCNTHNVYLPIPEVIKSTRVVDPNSRMWHRCLTSTGQPD  523

Query  195  F  193
            F
Sbjct  524  F  524


 Score = 68.6 bits (166),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG +GVL+HLEH IET+G A++CVAEGAGQ+ +++SN
Sbjct  364  PEVPFTLDGPHGVLQHLEHLIETQGFALICVAEGAGQEHLQQSN  407


 Score = 46.2 bits (108),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  342  RSSGFITMHASLSSGQVDICLIPEVPF  368



>ref|XP_011100012.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Sesamum indicum]
Length=529

 Score =   171 bits (433),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             + DASGN +L D+GVHIQ + KK FK I   VDVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  411  NATDASGNIVLGDIGVHIQQETKKFFKGIGFPVDVKYIDPTYMIRACRANASDGILCTVL  470

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY Y PIPEVI+  + VDPNSRMWHRCLTSTGQPDF
Sbjct  471  GQNAVHGAFAGYSGITVGICNTHYAYFPIPEVISQPKVVDPNSRMWHRCLTSTGQPDF  528


 Score = 67.4 bits (163),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ +E KGSAVVCVAEGAGQDL+ K+N
Sbjct  368  PEVPFNLHGPHGVLSHLKYLLERKGSAVVCVAEGAGQDLLVKTN  411


 Score = 48.1 bits (113),  Expect(3) = 6e-62, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHA+LASGQID CLIP   F 
Sbjct  346  RSSGFIAMHAALASGQIDICLIPEVPFN  373



>ref|NP_001063175.1| Os09g0415800 [Oryza sativa Japonica Group]
 dbj|BAF25089.1| Os09g0415800 [Oryza sativa Japonica Group]
Length=527

 Score =   169 bits (428),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  406  QKSNATDASGNVILSDFGVHMQQKIKSHFKDIGVPADVKYIDPTYMVRACRANASDAILC  465

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   + V+PNSRMWHRCLTSTGQPD
Sbjct  466  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITKPKRVNPNSRMWHRCLTSTGQPD  525

Query  195  F  193
            F
Sbjct  526  F  526


 Score = 70.9 bits (172),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GV++HLEH +E KG  VVCVAEGAGQDL++KSN
Sbjct  366  PEVSFTLDGEHGVMRHLEHLLEKKGFCVVCVAEGAGQDLLQKSN  409


 Score = 46.2 bits (108),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAM ASL+SGQID CLIP  +F
Sbjct  344  RSSGFIAMQASLSSGQIDVCLIPEVSF  370



>ref|XP_008670187.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670189.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670190.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
Length=536

 Score =   172 bits (437),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I    D+KYIDPTY++R CRA+ASDAI+C
Sbjct  415  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVPADLKYIDPTYMVRACRANASDAILC  474

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT G+CNTHY+YLPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  475  TVLGQNAVHGAFAGFSGITSGVCNTHYVYLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  534

Query  195  F  193
            F
Sbjct  535  F  535


 Score = 64.3 bits (155),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 9/53 (17%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAG---------QDLMEKSN  545
            PEV F LDGE+GVL+HLEH + TKG  VVCVAEGAG         QDL++KSN
Sbjct  366  PEVSFTLDGEHGVLRHLEHLLNTKGFCVVCVAEGAGQKCIFVLLAQDLLQKSN  418


 Score = 49.3 bits (116),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQID CLIP  +F
Sbjct  344  RSSGFIAMHASLSSGQIDVCLIPEVSF  370



>gb|ABD96050.1| ATP-utilizing phosphofructokinase [Spinacia oleracea]
Length=503

 Score =   166 bits (421),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  540  KDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQ  361
            KD SGN +L D+GVH ++QIK +F +     DVKYIDPTY++R  RA+ASDAI+CTVLGQ
Sbjct  383  KDLSGNAVLGDIGVHFKNQIKSYFNEKGIHADVKYIDPTYMVRSVRANASDAILCTVLGQ  442

Query  360  NAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            NAVHGAFAG++GIT+GICNTHY++LPI EVI   R V+PNSRMWHRCLTSTGQPDFS
Sbjct  443  NAVHGAFAGYSGITMGICNTHYVFLPITEVIHTPRAVNPNSRMWHRCLTSTGQPDFS  499


 Score = 70.9 bits (172),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFE  539
            PEVPF LDG NGVL HLEH I TKG+AVVCVAEGAGQ+L+   + +
Sbjct  338  PEVPFTLDGPNGVLSHLEHLIRTKGAAVVCVAEGAGQELLAAPDLK  383


 Score = 48.9 bits (115),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASLASGQ+D CLIP   F
Sbjct  316  RSSGFIAMHASLASGQVDICLIPEVPF  342



>ref|NP_001064560.1| Os10g0405600 [Oryza sativa Japonica Group]
 gb|ABB47570.1| Phosphofructokinase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26474.1| Os10g0405600 [Oryza sativa Japonica Group]
 gb|EEE50929.1| hypothetical protein OsJ_31463 [Oryza sativa Japonica Group]
Length=524

 Score =   168 bits (425),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN IL D+GVH+  +IK HFK+I    DVKYIDPTY++R  RA+ASDAI+C
Sbjct  403  QQSNATDASGNMILGDIGVHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILC  462

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPI EVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  463  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPD  522

Query  195  F  193
            F
Sbjct  523  F  523


 Score = 72.0 bits (175),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ +++SN
Sbjct  363  PEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSN  406


 Score = 46.2 bits (108),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  341  RSSGFITMHASLSSGQVDICLIPEVPF  367



>gb|EEC66915.1| hypothetical protein OsI_33512 [Oryza sativa Indica Group]
Length=524

 Score =   168 bits (425),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN IL D+GVH+  +IK HFK+I    DVKYIDPTY++R  RA+ASDAI+C
Sbjct  403  QQSNATDASGNMILGDIGVHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILC  462

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPI EVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  463  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPD  522

Query  195  F  193
            F
Sbjct  523  F  523


 Score = 72.0 bits (175),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ +++SN
Sbjct  363  PEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSN  406


 Score = 46.2 bits (108),  Expect(3) = 8e-62, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  341  RSSGFITMHASLSSGQVDICLIPEVPF  367



>ref|XP_009109420.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brassica rapa]
Length=512

 Score =   170 bits (430),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  391  ENTNAKDASGNKVLGDIGVHIQQETKKYFKEIGVAADVKYIDPTYMIRAVRANASDGILC  450

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI N HY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  451  TVLGQNAVHGAFAGYSGITVGIINNHYAYLPIPEVIAYDKSVDPNSRMWHRCLTSTGQPD  510

Query  195  F  193
            F
Sbjct  511  F  511


 Score = 69.7 bits (169),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL + IETKGSAVVCVAEGAGQ  +E +N
Sbjct  351  PEVPFNLHGPDGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTN  394


 Score = 46.6 bits (109),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQ+D CLIP   F 
Sbjct  329  RSSGFIAMQASLASGQVDICLIPEVPFN  356



>ref|XP_004509678.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer 
arietinum]
Length=429

 Score =   172 bits (436),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  308  QNTNAKDASGNVVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILC  367

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GI+VG+CNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  368  TVLGQNAVHGAFAGYSGISVGLCNTHYAYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  427

Query  195  F  193
            F
Sbjct  428  F  428


 Score = 68.6 bits (166),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL+H +E KGSAV+CVAEGAGQ+L++ +N
Sbjct  268  PEVPFNLHGPHGVLRHLQHLLEMKGSAVICVAEGAGQNLLQNTN  311


 Score = 45.4 bits (106),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  246  RSSGFIAMQASLSSGQVDVCLIPEVPFN  273



>dbj|BAD28914.1| putative phosphofructokinase [Oryza sativa Japonica Group]
 dbj|BAD29254.1| putative phosphofructokinase [Oryza sativa Japonica Group]
 gb|EEE69704.1| hypothetical protein OsJ_29365 [Oryza sativa Japonica Group]
Length=480

 Score =   169 bits (428),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  359  QKSNATDASGNVILSDFGVHMQQKIKSHFKDIGVPADVKYIDPTYMVRACRANASDAILC  418

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   + V+PNSRMWHRCLTSTGQPD
Sbjct  419  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITKPKRVNPNSRMWHRCLTSTGQPD  478

Query  195  F  193
            F
Sbjct  479  F  479


 Score = 70.9 bits (172),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GV++HLEH +E KG  VVCVAEGAGQDL++KSN
Sbjct  319  PEVSFTLDGEHGVMRHLEHLLEKKGFCVVCVAEGAGQDLLQKSN  362


 Score = 46.2 bits (108),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAM ASL+SGQID CLIP  +F
Sbjct  297  RSSGFIAMQASLSSGQIDVCLIPEVSF  323



>emb|CDX90382.1| BnaA08g16020D [Brassica napus]
Length=512

 Score =   170 bits (431),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  391  ENTNAKDASGNKVLGDIGVHIQQETKKYFKEIGVAADVKYIDPTYMIRAVRANASDGILC  450

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI N HY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  451  TVLGQNAVHGAFAGYSGITVGIINNHYAYLPIPEVIAYDKSVDPNSRMWHRCLTSTGQPD  510

Query  195  F  193
            F
Sbjct  511  F  511


 Score = 69.3 bits (168),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL + IETKGSAVVCVAEGAGQ  +E +N
Sbjct  351  PEVPFNLHGPDGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTN  394


 Score = 46.6 bits (109),  Expect(3) = 9e-62, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQ+D CLIP   F 
Sbjct  329  RSSGFIAMQASLASGQVDICLIPEVPFN  356



>gb|EEC84573.1| hypothetical protein OsI_31367 [Oryza sativa Indica Group]
Length=547

 Score =   169 bits (427),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  426  QKSNATDASGNVILSDFGVHMQQKIKSHFKDIGVPADVKYIDPTYMVRACRANASDAILC  485

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   + V+PNSRMWHRCLTSTGQPD
Sbjct  486  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITKPKRVNPNSRMWHRCLTSTGQPD  545

Query  195  F  193
            F
Sbjct  546  F  546


 Score = 70.9 bits (172),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GV++HLEH +E KG  VVCVAEGAGQDL++KSN
Sbjct  386  PEVSFTLDGEHGVMRHLEHLLEKKGFCVVCVAEGAGQDLLQKSN  429


 Score = 46.2 bits (108),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAM ASL+SGQID CLIP  +F
Sbjct  364  RSSGFIAMQASLSSGQIDVCLIPEVSF  390



>gb|KFK30402.1| hypothetical protein AALP_AA7G256400 [Arabis alpina]
Length=525

 Score =   171 bits (432),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  404  ENTNAKDASGNKVLGDIGVHIQQETKKYFKEIGISADVKYIDPTYMIRAVRANASDGILC  463

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG +GITVGI NTHY YLPIPEVIA ++ VDPNSRMWHRCLTSTGQPD
Sbjct  464  TVLGQNAVHGAFAGHSGITVGIINTHYAYLPIPEVIAYAKSVDPNSRMWHRCLTSTGQPD  523

Query  195  F  193
            F
Sbjct  524  F  524


 Score = 68.9 bits (167),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVLKHL++ IETKGSAV+CVAEGAGQ  +E +N
Sbjct  364  PEVPFNLHGPHGVLKHLKYLIETKGSAVICVAEGAGQSFLENTN  407


 Score = 46.2 bits (108),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQ+D CLIP   F 
Sbjct  342  RSSGFIAMQASLASGQVDICLIPEVPFN  369



>gb|AAK98672.1|AC021893_6 Putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
Length=490

 Score =   167 bits (424),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN IL D+GVH+  +IK HFK+I    DVKYIDPTY++R  RA+ASDAI+C
Sbjct  369  QQSNATDASGNMILGDIGVHLHQKIKAHFKEIGVHSDVKYIDPTYMVRAVRANASDAILC  428

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPI EVI ++R VDPNSRMWHRCLTSTGQPD
Sbjct  429  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPISEVIKSTRFVDPNSRMWHRCLTSTGQPD  488

Query  195  F  193
            F
Sbjct  489  F  489


 Score = 71.6 bits (174),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ+ +++SN
Sbjct  329  PEVPFTLDGPNGVLQHLEHLIETKGFALICVAEGAGQEHLQQSN  372


 Score = 46.2 bits (108),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  307  RSSGFITMHASLSSGQVDICLIPEVPF  333



>ref|XP_011021841.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Populus euphratica]
Length=532

 Score =   172 bits (436),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             + DASGN +L D GVHIQ + +K+FK+I    DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  414  NATDASGNTVLGDFGVHIQQETRKYFKEIGVHADVKYIDPTYMIRACRANASDGILCTVL  473

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  474  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPDF  531


 Score = 64.7 bits (156),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL+HL+  IETKGSAVVCVAEGAGQ+ + ++N
Sbjct  371  PEVPFHLHGPLGVLRHLKFLIETKGSAVVCVAEGAGQNFLGRTN  414


 Score = 48.5 bits (114),  Expect(3) = 1e-61, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAMHASLASGQID CLIP   F 
Sbjct  349  RNSGFIAMHASLASGQIDICLIPEVPFH  376



>ref|XP_009112523.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
isoform X2 [Brassica rapa]
Length=541

 Score =   172 bits (436),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN IL D GVHIQ + KK+FK++   VDVKYIDPTY++R  RA+ASD I+C
Sbjct  420  EKTNAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILC  479

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  480  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  539

Query  195  F  193
            F
Sbjct  540  F  540


 Score = 69.3 bits (168),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  670  VPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            VPF + G NGVLKH+++ IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  382  VPFNIHGPNGVLKHMKYLIETKGSAVICVAEGAGQNLLEKTN  423


 Score = 43.9 bits (102),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R+SGFIAM ASLASGQ+D CLIP 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPE  379



>ref|XP_010916680.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=530

 Score =   169 bits (428),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            K+R ++DA+GN IL D+GVHIQ + KK FK++    DVKYIDPTY++R  RA+ASD I+C
Sbjct  410  KTR-ARDANGNIILGDIGVHIQQETKKFFKEVGVPADVKYIDPTYMIRAVRANASDGILC  468

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVGICNTH++Y PI EVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  469  TVLGQNAVHGAFAGFSGITVGICNTHFVYFPISEVISYPRQVDPNSRMWHRCLTSTGQPD  528

Query  195  F  193
            F
Sbjct  529  F  529


 Score = 67.0 bits (162),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF L G NGVL HL++ IETK SAVVCVAEGAGQ+L++K+
Sbjct  369  PEVPFNLHGPNGVLSHLKYLIETKRSAVVCVAEGAGQNLLQKT  411


 Score = 48.9 bits (115),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQ+D CLIP   F 
Sbjct  347  RSSGFIAMHASLASGQVDICLIPEVPFN  374



>gb|EEC83634.1| hypothetical protein OsI_29365 [Oryza sativa Indica Group]
Length=529

 Score =   168 bits (426),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  414  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  473

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI   + V+PNSRMWHRCLTSTGQPDF
Sbjct  474  AVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPNSRMWHRCLTSTGQPDF  528


 Score = 68.2 bits (165),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQ+L++KS
Sbjct  368  PEVPFTLDGEYGVLRHLEHLLKTKGFCVVCVAEAAGQELLQKS  410


 Score = 48.5 bits (114),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  346  RSSGFIAMHASLSSGQVDVCLIPEVPF  372



>ref|XP_003628914.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET03390.1| 6-phosphofructokinase [Medicago truncatula]
Length=529

 Score =   172 bits (437),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  408  QNTNAKDASGNIVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILC  467

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GI+VGICNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  468  TVLGQNAVHGAFAGYSGISVGICNTHYAYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  527

Query  195  F  193
            F
Sbjct  528  F  528


 Score = 67.0 bits (162),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL+HL++ +E KGSAVVCVAEGAGQ+L++ +N
Sbjct  368  PEVPFNLHGPHGVLRHLQYLLEMKGSAVVCVAEGAGQNLLQNTN  411


 Score = 45.1 bits (105),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  346  RSSGFIAMQASLSSGQVDICLIPEVPFN  373



>gb|AGN30569.1| phosphofructokinase PFK07 [Oryza sativa Indica Group]
Length=529

 Score =   168 bits (426),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  414  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  473

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI   + V+PNSRMWHRCLTSTGQPDF
Sbjct  474  AVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPNSRMWHRCLTSTGQPDF  528


 Score = 68.2 bits (165),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQ+L++KS
Sbjct  368  PEVPFTLDGEYGVLRHLEHLLKTKGFCVVCVAEAAGQELLQKS  410


 Score = 48.5 bits (114),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  346  RSSGFIAMHASLSSGQVDVCLIPEVPF  372



>ref|XP_002310313.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa]
 gb|EEE90763.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa]
Length=532

 Score =   172 bits (437),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             + DASGN +L D GVHIQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  414  NATDASGNTVLGDFGVHIQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILCTVL  473

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  474  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISYPRAVDPNSRMWHRCLTSTGQPDF  531


 Score = 63.5 bits (153),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL+HL+  IETKGSAV+CVAEGAGQ+ + ++N
Sbjct  371  PEVPFHLHGPLGVLRHLKFLIETKGSAVLCVAEGAGQNFLGRTN  414


 Score = 48.5 bits (114),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAMHASLASGQID CLIP   F 
Sbjct  349  RNSGFIAMHASLASGQIDICLIPEVPFH  376



>ref|XP_010646328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Vitis vinifera]
Length=526

 Score =   172 bits (437),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK      DVKYIDPTY++R CRA+ASD I+C
Sbjct  405  EKTNATDASGNIVFGDIGVHIQQETKKYFKATGNPADVKYIDPTYMIRACRANASDGILC  464

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEV++  R VDPNSRMWHRCLTSTGQPD
Sbjct  465  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVVSYPRVVDPNSRMWHRCLTSTGQPD  524

Query  195  F  193
            F
Sbjct  525  F  525


 Score = 66.6 bits (161),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ +E KGSAVVCVAEGAGQ+ +EK+N
Sbjct  365  PEVPFHLHGPHGVLSHLKYLLEKKGSAVVCVAEGAGQNFLEKTN  408


 Score = 45.4 bits (106),  Expect(3) = 2e-61, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFI M ASLASGQID CLIP   F 
Sbjct  343  RSSGFITMQASLASGQIDICLIPEVPFH  370



>tpg|DAA48946.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
 tpg|DAA48947.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
Length=345

 Score =   172 bits (435),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  230  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  289

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI A + V+PNSRMWHRCLTSTGQPDF
Sbjct  290  AVHGAFAGFSGITSCICNTHYVYLPITEVITAPKRVNPNSRMWHRCLTSTGQPDF  344


 Score = 64.3 bits (155),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+ LEH +++KG  VVCVAE AGQDL+++S
Sbjct  184  PEVPFTLDGEFGVLRQLEHLLKSKGFCVVCVAEAAGQDLLQES  226


 Score = 48.5 bits (114),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  162  RSSGFIAMHASLSSGQVDVCLIPEVPF  188



>ref|XP_010646329.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Vitis vinifera]
Length=526

 Score =   172 bits (437),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK      DVKYIDPTY++R CRA+ASD I+C
Sbjct  405  EKTNATDASGNIVFGDIGVHIQQETKKYFKATGNPADVKYIDPTYMIRACRANASDGILC  464

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEV++  R VDPNSRMWHRCLTSTGQPD
Sbjct  465  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVVSYPRVVDPNSRMWHRCLTSTGQPD  524

Query  195  F  193
            F
Sbjct  525  F  525


 Score = 66.6 bits (161),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ +E KGSAVVCVAEGAGQ+ +EK+N
Sbjct  365  PEVPFHLHGPHGVLSHLKYLLEKKGSAVVCVAEGAGQNFLEKTN  408


 Score = 45.4 bits (106),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFI M ASLASGQID CLIP   F 
Sbjct  343  RSSGFITMQASLASGQIDICLIPEVPFH  370



>emb|CDY52512.1| BnaC03g61050D [Brassica napus]
Length=503

 Score =   170 bits (430),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++  +KDASGN +L D+GVHIQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  382  ENTNAKDASGNKVLGDIGVHIQQETKKYFKEIGVAADVKYIDPTYMIRAVRANASDGILC  441

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI N HY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  442  TVLGQNAVHGAFAGYSGITVGIINNHYAYLPIPEVIAYDKSVDPNSRMWHRCLTSTGQPD  501

Query  195  F  193
            F
Sbjct  502  F  502


 Score = 67.8 bits (164),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF   G +GVLKHL + IETKGSAVVCVAEGAGQ  +E +N
Sbjct  342  PEVPFNFHGPDGVLKHLNYLIETKGSAVVCVAEGAGQSFLENTN  385


 Score = 46.2 bits (108),  Expect(3) = 3e-61, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQ+D CLIP   F 
Sbjct  320  RSSGFIAMQASLASGQVDICLIPEVPFN  347



>ref|XP_006660625.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=522

 Score =   169 bits (428),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I    DVKYIDPTY++R CRA+ASDAI+C
Sbjct  401  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVPADVKYIDPTYMVRACRANASDAILC  460

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   + V+PNSRMWHRCLTSTGQPD
Sbjct  461  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITTPKRVNPNSRMWHRCLTSTGQPD  520

Query  195  F  193
            F
Sbjct  521  F  521


 Score = 68.2 bits (165),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GV++HLEH +  KG  VVCVAEGAGQDL++KSN
Sbjct  361  PEVSFTLDGEHGVMRHLEHLLVKKGFCVVCVAEGAGQDLLQKSN  404


 Score = 46.2 bits (108),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAM ASL+SGQID CLIP  +F
Sbjct  339  RSSGFIAMQASLSSGQIDVCLIPEVSF  365



>ref|XP_009112522.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
isoform X1 [Brassica rapa]
Length=536

 Score =   172 bits (436),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN IL D GVHIQ + KK+FK++   VDVKYIDPTY++R  RA+ASD I+C
Sbjct  415  EKTNAKDASGNTILGDFGVHIQQETKKYFKEVSMPVDVKYIDPTYMIRAVRANASDGILC  474

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPIPEVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  475  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPIPEVIAYPKSVDPNSRMWHRCLTSTGQPD  534

Query  195  F  193
            F
Sbjct  535  F  535


 Score = 65.9 bits (159),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF + G NGVLK+L   IETKGSAV+CVAEGAGQ+L+EK+N
Sbjct  378  PEVPFNIHGPNGVLKYL---IETKGSAVICVAEGAGQNLLEKTN  418


 Score = 45.4 bits (106),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPEVPFN  383



>gb|AHE93343.1| phosphofructokinase [Camellia sinensis]
Length=522

 Score =   169 bits (427),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +  D+GVH+QH+ KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  401  QKTNAKDASGNIVFGDIGVHLQHETKKYFKEIGIPADVKYIDPTYMIRAVRANASDGILC  460

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEVI+  R VDPNSRMWHRCLTST QPD
Sbjct  461  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVISYPRVVDPNSRMWHRCLTSTRQPD  520

Query  195  F  193
            F
Sbjct  521  F  521


 Score = 67.4 bits (163),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F L G +GVL+HL++ +ETKGSAVVCVAEGAGQD ++K+N
Sbjct  361  PEVSFNLHGPHGVLRHLKYLLETKGSAVVCVAEGAGQDFLQKTN  404


 Score = 47.4 bits (111),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASLASGQID CLIP  +F 
Sbjct  339  RSSGFIAMQASLASGQIDICLIPEVSFN  366



>ref|XP_008795218.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Phoenix dactylifera]
Length=529

 Score =   167 bits (423),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            +++A+GN IL D+GVHIQ + KK F++I    DVKYIDPTY++R  RA+ASD I+CTVLG
Sbjct  412  ARNANGNIILGDIGVHIQQETKKFFQEISVPADVKYIDPTYMIRAVRANASDGILCTVLG  471

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            QNAVHGAFAGF+GITVGICNTHY+Y PI EVI+  + VDPNSRMWHRCLTSTGQPDF
Sbjct  472  QNAVHGAFAGFSGITVGICNTHYVYFPIAEVISYPKQVDPNSRMWHRCLTSTGQPDF  528


 Score = 67.4 bits (163),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVL HL++ IETK SAVVCVAEGAGQ+L++K++
Sbjct  368  PEVPFNLHGPNGVLSHLKYLIETKRSAVVCVAEGAGQNLLQKTH  411


 Score = 48.9 bits (115),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQ+D CLIP   F 
Sbjct  346  RSSGFIAMHASLASGQVDICLIPEVPFN  373



>ref|NP_001145725.1| hypothetical protein [Zea mays]
 ref|XP_008672494.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672500.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACL52464.1| unknown [Zea mays]
 tpg|DAA48942.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
Length=527

 Score =   171 bits (433),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  412  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  471

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI A + V+PNSRMWHRCLTSTGQPDF
Sbjct  472  AVHGAFAGFSGITSCICNTHYVYLPITEVITAPKRVNPNSRMWHRCLTSTGQPDF  526


 Score = 63.9 bits (154),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+ LEH +++KG  VVCVAE AGQDL+++S
Sbjct  366  PEVPFTLDGEFGVLRQLEHLLKSKGFCVVCVAEAAGQDLLQES  408


 Score = 48.5 bits (114),  Expect(3) = 5e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFIAMHASLSSGQVDVCLIPEVPF  370



>ref|XP_003574548.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010235169.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=530

 Score =   167 bits (423),  Expect(3) = 9e-61, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  415  DASGNVILSDIGVHMQQKIKMHFKGIGVHADVKYIDPTYMVRACRANASDAILCTVLGQN  474

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVH AFAGF+GIT  ICNTHY+YLPI EVI + + V+PNSRMWHRCLTSTGQPDF
Sbjct  475  AVHAAFAGFSGITSCICNTHYVYLPITEVITSPKRVNPNSRMWHRCLTSTGQPDF  529


 Score = 67.4 bits (163),  Expect(3) = 9e-61, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF LDGE GVL+HLEH +E KG  VVCVAE AGQ+L++KS
Sbjct  369  PEVPFTLDGEYGVLQHLEHLLENKGFCVVCVAEAAGQELLQKS  411


 Score = 48.1 bits (113),  Expect(3) = 9e-61, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  347  RSSGFIAMHASLSSGQVDICLIPEVPF  373



>ref|XP_003552046.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=534

 Score =   167 bits (423),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  413  QKTNATDASGNVVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRAIRANASDGILC  472

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVG+CNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  473  TVLGQNAVHGAFAGYSGITVGLCNTHYVYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  532

Query  195  F  193
            F
Sbjct  533  F  533


 Score = 69.3 bits (168),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ +ETKGSAVVCVAEGAGQ+L++K+N
Sbjct  373  PEVPFNLHGPHGVLSHLKYLLETKGSAVVCVAEGAGQNLLQKTN  416


 Score = 45.1 bits (105),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  351  RSSGFIAMQASLSSGQVDICLIPEVPFN  378



>gb|KHN20613.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=534

 Score =   167 bits (424),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  413  QKTNATDASGNVVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRAIRANASDGILC  472

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVG+CNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  473  TVLGQNAVHGAFAGYSGITVGLCNTHYVYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  532

Query  195  F  193
            F
Sbjct  533  F  533


 Score = 69.3 bits (168),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ +ETKGSAVVCVAEGAGQ+L++K+N
Sbjct  373  PEVPFNLHGPHGVLSHLKYLLETKGSAVVCVAEGAGQNLLQKTN  416


 Score = 45.1 bits (105),  Expect(3) = 1e-60, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  351  RSSGFIAMQASLSSGQVDICLIPEVPFN  378



>ref|XP_010681044.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=533

 Score =   165 bits (417),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+GVHIQ +IKK+FK++    DVKYIDPTY++R  RA+ASD I+C
Sbjct  412  QKTNATDASGNTVLGDIGVHIQQEIKKYFKELGTSADVKYIDPTYMIRAIRANASDGILC  471

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG+CNTHY Y PI EVI   R +DPNSRMWHRCLTSTGQPD
Sbjct  472  TVLGQNAVHGAFAGFSGITVGLCNTHYAYFPILEVIKYPRLLDPNSRMWHRCLTSTGQPD  531

Query  195  F  193
            F
Sbjct  532  F  532


 Score = 67.8 bits (164),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF + G +G+L+HLE+ +ETKGSAV+CVAEGA Q+L++K+N
Sbjct  372  PEVPFHIHGPHGILRHLEYLLETKGSAVICVAEGAAQNLLQKTN  415


 Score = 49.3 bits (116),  Expect(3) = 2e-60, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQ+D CLIP   F 
Sbjct  350  RSSGFIAMHASLASGQVDICLIPEVPFH  377



>gb|AAD22353.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
Length=463

 Score =   167 bits (424),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   +KDASGN +L D GV+IQ + KK+FK+I   +DVKYIDPTY++R  RA+ASD I+C
Sbjct  342  EKTNAKDASGNAVLGDFGVYIQQETKKYFKEISTPIDVKYIDPTYMIRAVRANASDGILC  401

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGI NTHY YLPI EVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  402  TVLGQNAVHGAFAGYSGITVGIINTHYAYLPITEVIAYPKSVDPNSRMWHRCLTSTGQPD  461

Query  195  F  193
            F
Sbjct  462  F  462


 Score = 69.3 bits (168),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  673  EVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            +VPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  303  KVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  345


 Score = 43.9 bits (102),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R+SGFIAM ASLASGQ+D CLIP 
Sbjct  255  RNSGFIAMQASLASGQVDICLIPE  278



>ref|XP_001767506.1| predicted protein [Physcomitrella patens]
 gb|EDQ67641.1| predicted protein [Physcomitrella patens]
Length=543

 Score =   172 bits (436),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             S DASGNP+L D+GVH+  ++K HFK I    DVKYIDPTY++R CRA+ASD I+C VL
Sbjct  425  NSTDASGNPVLGDIGVHLTKEVKNHFKNIGVAADVKYIDPTYMIRACRANASDRILCAVL  484

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVH  FAGFTG+TVGI N HY+ LPIPEVIA +R+VDPNSRMWHRCLTSTGQPDF
Sbjct  485  GQNAVHAGFAGFTGVTVGIANNHYVLLPIPEVIAYARNVDPNSRMWHRCLTSTGQPDF  542


 Score = 60.8 bits (146),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PEV F +DG  G+L+H+++ +ETKG A++CVAEGAGQDLM
Sbjct  381  PEVKFTVDGPEGMLQHVQYLLETKGRAIICVAEGAGQDLM  420


 Score = 47.8 bits (112),  Expect(3) = 3e-60, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHASLASGQ+D CLIP   F
Sbjct  359  RQSGFIAMHASLASGQVDVCLIPEVKF  385



>ref|XP_004489766.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer 
arietinum]
Length=524

 Score =   163 bits (413),  Expect(3) = 5e-60, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN I  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  403  QKTNATDASGNIIFGDIGVYIQQETKKYFKEIGIHADVKYIDPTYMIRAGRANASDGILC  462

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG CNTHY Y PI EVIA  + VDPNSRMWHRCLTSTGQPD
Sbjct  463  TVLGQNAVHGAFAGFSGITVGTCNTHYAYFPITEVIAHPKLVDPNSRMWHRCLTSTGQPD  522

Query  195  F  193
            F
Sbjct  523  F  523


 Score = 70.9 bits (172),  Expect(3) = 5e-60, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ IETKGSAVVCVAEGAGQ+L++K+N
Sbjct  363  PEVPFNLHGSHGVLSHLKYLIETKGSAVVCVAEGAGQNLLQKTN  406


 Score = 45.8 bits (107),  Expect(3) = 5e-60, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQID CLIP   F 
Sbjct  341  RSSGFIAMQSSLASGQIDICLIPEVPFN  368



>ref|XP_003517707.2| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=554

 Score =   167 bits (422),  Expect(3) = 7e-60, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + D SGN +  D+GV+ Q + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  433  QKTNATDNSGNTVFRDIGVYTQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILC  492

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG CNTHY Y PIPEVI+  + VDPNSRMWHRCLTSTGQPD
Sbjct  493  TVLGQNAVHGAFAGFSGITVGSCNTHYAYFPIPEVISHPKLVDPNSRMWHRCLTSTGQPD  552

Query  195  F  193
            F
Sbjct  553  F  553


 Score = 65.1 bits (157),  Expect(3) = 7e-60, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL +L++ IETKGSAVVCVAE AGQ+L++K+N
Sbjct  393  PEVPFNLHGPRGVLSYLKYLIETKGSAVVCVAERAGQNLLQKTN  436


 Score = 47.8 bits (112),  Expect(3) = 7e-60, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAMHA+LASGQID CLIP   F 
Sbjct  371  RDSGFIAMHATLASGQIDICLIPEVPFN  398



>ref|XP_003530616.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=532

 Score =   166 bits (421),  Expect(3) = 9e-60, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  411  QKTNATDASGNVVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRAIRANASDGILC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVG+CNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGLCNTHYAYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 67.8 bits (164),  Expect(3) = 9e-60, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL HL++ +ETKGSAVVC AEGAGQ+L++K+N
Sbjct  371  PEVPFNLHGPQGVLSHLKYLLETKGSAVVCAAEGAGQNLLQKTN  414


 Score = 45.1 bits (105),  Expect(3) = 9e-60, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  349  RSSGFIAMQASLSSGQVDICLIPEVPFN  376



>ref|XP_007158384.1| hypothetical protein PHAVU_002G148700g [Phaseolus vulgaris]
 gb|ESW30378.1| hypothetical protein PHAVU_002G148700g [Phaseolus vulgaris]
Length=532

 Score =   164 bits (415),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN    D+GV+IQ + KK+FK+I  L DVKYIDPTY++R CRA+ASD I C
Sbjct  411  QKTNTTDASGNTAFRDIGVYIQQETKKYFKEIGVLADVKYIDPTYMIRACRANASDGIFC  470

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVG CNTHY Y PIPEVI+  + VD NSRMWHRCLT+TGQPD
Sbjct  471  TVLGQNAVHGAFAGYSGITVGACNTHYAYFPIPEVISHPKLVDSNSRMWHRCLTATGQPD  530

Query  195  F  193
            F
Sbjct  531  F  531


 Score = 66.6 bits (161),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL +L+  IETKGSAVVCVAEGAGQ+L++K+N
Sbjct  371  PEVPFNLHGPRGVLSYLKFLIETKGSAVVCVAEGAGQNLLQKTN  414


 Score = 48.1 bits (113),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAMHASLASGQID CLIP   F 
Sbjct  349  RDSGFIAMHASLASGQIDICLIPEVPFN  376



>ref|XP_001769358.1| predicted protein [Physcomitrella patens]
 gb|EDQ65727.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   169 bits (428),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCT  373
            S  + D SGNPIL D+GVH+  ++K+HFK I    DVKYIDPTY++R CRA+ASD I+C 
Sbjct  293  SNGATDPSGNPILGDIGVHLTKEVKRHFKDIGVPADVKYIDPTYMIRACRANASDRILCA  352

Query  372  VLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            VLGQNAVH  FAGFTGITVGI N HY+ LPIPEVI+ +R+VDPNSRMWHRCLTSTGQPDF
Sbjct  353  VLGQNAVHAGFAGFTGITVGIANNHYVVLPIPEVISHARNVDPNSRMWHRCLTSTGQPDF  412

Query  192  S  190
            +
Sbjct  413  A  413


 Score = 62.4 bits (150),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PEV F LDG  G+L+H+++ +ETKG AV+CVAEGAGQDLM
Sbjct  250  PEVKFTLDGPEGMLQHIQYLLETKGRAVICVAEGAGQDLM  289


 Score = 47.8 bits (112),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHASLASGQ+D CLIP   F
Sbjct  228  RQSGFIAMHASLASGQVDVCLIPEVKF  254



>gb|KHN08327.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=525

 Score =   166 bits (420),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+C
Sbjct  404  QKTNATDASGNVVFGDIGVYIQQETKKYFKEIGVHADVKYIDPTYMIRAIRANASDGILC  463

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVG+CNTHY Y PIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  464  TVLGQNAVHGAFAGYSGITVGLCNTHYAYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  523

Query  195  F  193
            F
Sbjct  524  F  524


 Score = 67.8 bits (164),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL HL++ +ETKGSAVVC AEGAGQ+L++K+N
Sbjct  364  PEVPFNLHGPQGVLSHLKYLLETKGSAVVCAAEGAGQNLLQKTN  407


 Score = 45.1 bits (105),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM ASL+SGQ+D CLIP   F 
Sbjct  342  RSSGFIAMQASLSSGQVDICLIPEVPFN  369



>gb|KHN14523.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=439

 Score =   167 bits (422),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + D SGN +  D+GV+ Q + KK+FK+I    DVKYIDPTY++R CRA+ASD I+C
Sbjct  318  QKTNATDNSGNTVFRDIGVYTQQETKKYFKEIGVHADVKYIDPTYMIRACRANASDGILC  377

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GITVG CNTHY Y PIPEVI+  + VDPNSRMWHRCLTSTGQPD
Sbjct  378  TVLGQNAVHGAFAGFSGITVGSCNTHYAYFPIPEVISHPKLVDPNSRMWHRCLTSTGQPD  437

Query  195  F  193
            F
Sbjct  438  F  438


 Score = 64.7 bits (156),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G  GVL +L++ IETKGSAVVCVAE AGQ+L++K+N
Sbjct  278  PEVPFNLHGPRGVLSYLKYLIETKGSAVVCVAERAGQNLLQKTN  321


 Score = 47.8 bits (112),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAMHA+LASGQID CLIP   F 
Sbjct  256  RDSGFIAMHATLASGQIDICLIPEVPFN  283



>gb|EEE68761.1| hypothetical protein OsJ_27460 [Oryza sativa Japonica Group]
Length=566

 Score =   168 bits (426),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  451  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  510

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI   + V+PNSRMWHRCLTSTGQPDF
Sbjct  511  AVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPNSRMWHRCLTSTGQPDF  565


 Score = 62.0 bits (149),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PEVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQ  +E
Sbjct  406  PEVPFTLDGEYGVLRHLEHLLKTKGFCVVCVAEAAGQIQLE  446


 Score = 48.5 bits (114),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  384  RSSGFIAMHASLSSGQVDVCLIPEVPF  410



>ref|XP_003613090.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES96048.1| 6-phosphofructokinase [Medicago truncatula]
Length=533

 Score =   164 bits (414),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            D SGN  L D+GV+IQ + K +FK+ +   DVKYIDPTY++R CRA+ASD I+CTVLGQN
Sbjct  418  DPSGNAKLGDIGVYIQQETKNYFKENDIHADVKYIDPTYMIRACRANASDGILCTVLGQN  477

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAG++GITVGICNTHY Y PI EVI+  + VDPNSRMWHRCLTSTGQPDF
Sbjct  478  AVHGAFAGYSGITVGICNTHYAYFPITEVISHPQLVDPNSRMWHRCLTSTGQPDF  532


 Score = 68.9 bits (167),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL++ IE+KGSAVVCVAEGAGQ+L++K+N
Sbjct  372  PEVPFDLHGPHGVLSHLKYLIESKGSAVVCVAEGAGQNLLQKTN  415


 Score = 46.2 bits (108),  Expect(3) = 1e-59, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM +SLASGQID CLIP   F 
Sbjct  350  RSSGFIAMQSSLASGQIDVCLIPEVPFD  377



>ref|XP_007156482.1| hypothetical protein PHAVU_003G289600g [Phaseolus vulgaris]
 gb|ESW28476.1| hypothetical protein PHAVU_003G289600g [Phaseolus vulgaris]
Length=534

 Score =   167 bits (422),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            + DASGN +  D+GV+IQ + KK+FK+I    DVKYIDPTY++R  RA+ASD I+CTVLG
Sbjct  417  ATDASGNVVFGDIGVYIQQETKKYFKEIGIHADVKYIDPTYMIRAIRANASDGILCTVLG  476

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            QNAVHGAFAG++GITVG+CNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  477  QNAVHGAFAGYSGITVGLCNTHYVYFPIPEVISHPRLVDPNSRMWHRCLTSTGQPDF  533


 Score = 65.5 bits (158),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G +GVL HL+  +ETKGSAVVCVAEGAGQ+L++K++
Sbjct  373  PEVPFNLHGPSGVLDHLKLLLETKGSAVVCVAEGAGQNLLQKTH  416


 Score = 44.7 bits (104),  Expect(3) = 3e-59, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAM A+L+SGQ+D CLIP   F 
Sbjct  351  RSSGFIAMQATLSSGQVDVCLIPEVPFN  378



>ref|XP_002969111.1| hypothetical protein SELMODRAFT_146031 [Selaginella moellendorffii]
 gb|EFJ30227.1| hypothetical protein SELMODRAFT_146031 [Selaginella moellendorffii]
Length=404

 Score =   173 bits (439),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
            + SKDASGNP+LSD GV++Q QIK HF       DVKYIDPTY++R C+A++SD+I+CTV
Sbjct  282  KGSKDASGNPVLSDTGVYLQQQIKNHFIAAGTPADVKYIDPTYMIRACQANSSDSILCTV  341

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            LGQNAVHGAFAGF+GITVG+CNTHY Y PIP+VI   R VDP+SRMWHRC+TSTGQPDF+
Sbjct  342  LGQNAVHGAFAGFSGITVGLCNTHYAYFPIPQVIDHPRRVDPSSRMWHRCITSTGQPDFT  401


 Score = 63.2 bits (152),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PEVPF L G NG+L +LEH I T+GSAVVC+AEGAGQ+L+
Sbjct  240  PEVPFTLHGPNGLLVYLEHLIHTQGSAVVCIAEGAGQELL  279


 Score = 40.4 bits (93),  Expect(3) = 5e-59, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIA +ASLASG ++ACLIP   F
Sbjct  218  RQSGFIAQYASLASGHVNACLIPEVPF  244



>ref|XP_002973951.1| hypothetical protein SELMODRAFT_100675 [Selaginella moellendorffii]
 gb|EFJ24906.1| hypothetical protein SELMODRAFT_100675 [Selaginella moellendorffii]
Length=520

 Score =   173 bits (439),  Expect(3) = 6e-59, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
            + SKDASGNP+LSD GV++Q QIK HF       DVKYIDPTY++R C+A++SD+I+CTV
Sbjct  398  KGSKDASGNPVLSDTGVYLQQQIKNHFIAAGTPADVKYIDPTYMIRACQANSSDSILCTV  457

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            LGQNAVHGAFAGF+GITVG+CNTHY Y PIP+VI   R VDP+SRMWHRC+TSTGQPDF+
Sbjct  458  LGQNAVHGAFAGFSGITVGLCNTHYAYFPIPQVIDHPRRVDPSSRMWHRCITSTGQPDFT  517


 Score = 62.8 bits (151),  Expect(3) = 6e-59, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PEVPF L G NG+L +LEH I T+GSAVVC+AEGAGQ+L+
Sbjct  356  PEVPFTLHGPNGLLVYLEHLIHTQGSAVVCIAEGAGQELL  395


 Score = 40.4 bits (93),  Expect(3) = 6e-59, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIA +ASLASG ++ACLIP   F
Sbjct  334  RQSGFIAQYASLASGHVNACLIPEVPF  360



>gb|EMS54761.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=452

 Score =   161 bits (408),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    D+KYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  337  DASGNTILSDIGVHMQQKIKMHFKGIGVHADIKYIDPTYMVRACRANASDAILCTVLGQN  396

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLP+ +VI A + V+   RMWHRCLTSTGQPDF
Sbjct  397  AVHGAFAGFSGITSCICNTHYVYLPVTQVITAPKRVNHKGRMWHRCLTSTGQPDF  451


 Score = 58.9 bits (141),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEV F LDGE GVL+HLE  I+ KG  VVCVAE AGQ+L++ S
Sbjct  291  PEVSFALDGEYGVLQHLEQLIKNKGFCVVCVAEAAGQELLQNS  333


 Score = 48.9 bits (115),  Expect(3) = 1e-56, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP  +F
Sbjct  269  RSSGFIAMHASLSSGQVDVCLIPEVSF  295



>gb|EMT20555.1| 6-phosphofructokinase 5, chloroplastic [Aegilops tauschii]
Length=518

 Score =   174 bits (442),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN ILSD GVH+Q +IKKHFK I  L DVKYIDPTY++R CRA+ASDAI+C
Sbjct  397  QKSNATDASGNVILSDFGVHMQQKIKKHFKDIGVLADVKYIDPTYMVRACRANASDAILC  456

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTHY +LPI EVI   +HV+PNSRMWHRCLTSTGQPD
Sbjct  457  TVLGQNAVHGAFAGFSGITSGICNTHYAFLPITEVITTPKHVNPNSRMWHRCLTSTGQPD  516

Query  195  F  193
            F
Sbjct  517  F  517


 Score = 46.6 bits (109),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQA  657
            RS+GFIAMHASL+SGQID CLIP    + 
Sbjct  351  RSTGFIAMHASLSSGQIDVCLIPEHLLET  379


 Score = 46.2 bits (108),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -1

Query  625  EHXIETKGSAVVCVAEGAGQDLMEKSN  545
            EH +ETKG  VVCVAEGAGQDL++KSN
Sbjct  374  EHLLETKGFCVVCVAEGAGQDLLQKSN  400



>gb|AIE16183.1| chloroplast 6-phosphofructokinase 5 [Nicotiana tabacum]
Length=504

 Score =   179 bits (453),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D+GV++Q +IKK+FK++ +  DVKYIDPTY++R CRA+ASD I+CTVL
Sbjct  386  NAKDASGNAVLGDIGVYLQQEIKKYFKEMGETSDVKYIDPTYMIRACRANASDGILCTVL  445

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            GQNAVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  446  GQNAVHGAFAGYSGITVGICNTHYVYFPIPEVISKPRVVDPNSRMWHRCLTSTGQPDF  503


 Score = 45.4 bits (106),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RSSGFIAM ASLASGQID CLIP 
Sbjct  341  RSSGFIAMQASLASGQIDICLIPE  364


 Score = 43.5 bits (101),  Expect(3) = 3e-56, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  613  ETKGSAVVCVAEGAGQDLMEKSN  545
            ETKGSAVVC AEGAGQD +EK+N
Sbjct  364  ETKGSAVVCAAEGAGQDFLEKTN  386



>emb|CAN69658.1| hypothetical protein VITISV_013008 [Vitis vinifera]
Length=516

 Score =   161 bits (408),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = -2

Query  447  DVKYIDPTYILRGCRASASDAIMCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVI  268
            DVKYIDPTY++R CRA+ASD I+CTVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEV+
Sbjct  431  DVKYIDPTYMIRACRANASDGILCTVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVV  490

Query  267  AASRHVDPNSRMWHRCLTSTGQPDF  193
            +  R VDPNSRMWHRCLTSTGQPDF
Sbjct  491  SYPRVVDPNSRMWHRCLTSTGQPDF  515


 Score = 58.5 bits (140),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQ  566
            PEVPF L G +GVL HL++ +E KGSAVVCVAEGAGQ
Sbjct  382  PEVPFHLHGPHGVLSHLKYLLEKKGSAVVCVAEGAGQ  418


 Score = 45.4 bits (106),  Expect(3) = 1e-55, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFI M ASLASGQID CLIP   F 
Sbjct  360  RSSGFITMQASLASGQIDICLIPEVPFH  387



>ref|NP_001061896.2| Os08g0439000 [Oryza sativa Japonica Group]
 dbj|BAF23810.2| Os08g0439000 [Oryza sativa Japonica Group]
Length=489

 Score =   168 bits (426),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  374  DASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRANASDAILCTVLGQN  433

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAGF+GIT  ICNTHY+YLPI EVI   + V+PNSRMWHRCLTSTGQPDF
Sbjct  434  AVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPNSRMWHRCLTSTGQPDF  488


 Score = 58.9 bits (141),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  673  EVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            EVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQ  +E
Sbjct  330  EVPFTLDGEYGVLRHLEHLLKTKGFCVVCVAEAAGQIQLE  369



>gb|ADE76905.1| unknown [Picea sitchensis]
Length=411

 Score =   177 bits (450),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 5/127 (4%)
 Frame = -2

Query  573  LDKI*WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASA  394
            L+KI      + DASGN +L D+GV++QHQIKK+FK I    DVKYIDPTY++R CRA+A
Sbjct  289  LEKI-----NATDASGNVVLGDIGVYLQHQIKKYFKGINITADVKYIDPTYMIRACRANA  343

Query  393  SDAIMCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLT  214
            SD I+CTVLGQNAVHGAFAGF+GITVGICNTHY+YLPIPEVI+ +R VDPNSRMWHRCLT
Sbjct  344  SDGILCTVLGQNAVHGAFAGFSGITVGICNTHYVYLPIPEVISYARSVDPNSRMWHRCLT  403

Query  213  STGQPDF  193
            STGQPDF
Sbjct  404  STGQPDF  410


 Score = 48.1 bits (113),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHASLASGQID CLIP   F
Sbjct  228  RHSGFIAMHASLASGQIDVCLIPEVPF  254


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG +G+L+HL++ +E+K SAV+CVAEGAGQDL+EK N
Sbjct  250  PEVPFTLDGPDGILRHLQNLMESKTSAVICVAEGAGQDLLEKIN  293



>ref|XP_009340976.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=131

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK+    VDVKYIDPTY++R CRA+ASD I+C
Sbjct  10   EKTNATDASGNMVFGDIGVHIQQETKKYFKEAGVPVDVKYIDPTYMIRACRANASDGILC  69

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
             VLGQNAVHGAFAG++GITVG CNTHY+YLPIPEVI+  R VDPNSRMWHRCLTSTGQPD
Sbjct  70   AVLGQNAVHGAFAGYSGITVGTCNTHYVYLPIPEVISHPRLVDPNSRMWHRCLTSTGQPD  129

Query  195  F  193
            F
Sbjct  130  F  130



>emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera]
Length=1609

 Score =   161 bits (407),  Expect(2) = 1e-49, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            S DASGN  L D+GV++Q QIKKHF++I    DVKYIDPTY++R CRA+ASDA++CTVLG
Sbjct  402  STDASGNARLGDIGVYLQQQIKKHFRRIGVPADVKYIDPTYMIRACRANASDAVLCTVLG  461

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHR  223
            QNAVHGAFAGF+GITVGICN+HY+YLPIPEVIA+ R VDP+SRMWHR
Sbjct  462  QNAVHGAFAGFSGITVGICNSHYVYLPIPEVIASPRVVDPDSRMWHR  508


 Score = 63.9 bits (154),  Expect(2) = 1e-49, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  664  FKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            FKL    GVL+HLEH IETKGSAV+CVAEGAGQD +EK+N
Sbjct  362  FKLRDLIGVLRHLEHLIETKGSAVLCVAEGAGQDFVEKTN  401



>dbj|BAD09875.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
 dbj|BAD10161.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
Length=535

 Score =   173 bits (439),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 108/136 (79%), Gaps = 5/136 (4%)
 Frame = -2

Query  600  QLWYV*LKELDKI*WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTY  421
            QL+YV  + L K       + DASGN ILSD+GVH+Q +IK HFK I    DVKYIDPTY
Sbjct  404  QLFYVHYRSLQK-----SGATDASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTY  458

Query  420  ILRGCRASASDAIMCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPN  241
            ++R CRA+ASDAI+CTVLGQNAVHGAFAGF+GIT  ICNTHY+YLPI EVI   + V+PN
Sbjct  459  MVRACRANASDAILCTVLGQNAVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPN  518

Query  240  SRMWHRCLTSTGQPDF  193
            SRMWHRCLTSTGQPDF
Sbjct  519  SRMWHRCLTSTGQPDF  534


 Score = 48.5 bits (114),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFIAMHASL+SGQ+D CLIP   F
Sbjct  346  RSSGFIAMHASLSSGQVDVCLIPEVPF  372


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQ  566
            PEVPF LDGE GVL+HLEH ++TKG  VVCVAE AGQ
Sbjct  368  PEVPFTLDGEYGVLRHLEHLLKTKGFCVVCVAEAAGQ  404



>ref|XP_002505771.1| phosphofructokinase [Micromonas sp. RCC299]
 gb|ACO67029.1| phosphofructokinase [Micromonas sp. RCC299]
Length=575

 Score =   140 bits (352),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 5/123 (4%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            +   T  DA GNP L D+G     ++K+         DVKYIDPTY++RG  A+A D+I 
Sbjct  455  YVQETGTDAGGNPKLGDIGPWFCKRLKREMS-----CDVKYIDPTYMVRGVTANAHDSIY  509

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+LGQNAVHGAFAG+TGI++G+ NTH ++LPI  +I   R VDP+ RMWHR LTSTGQP
Sbjct  510  CTILGQNAVHGAFAGYTGISIGMVNTHAVFLPIERLIEKERLVDPDGRMWHRLLTSTGQP  569

Query  198  DFS  190
            DF+
Sbjct  570  DFA  572


 Score = 54.3 bits (129),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFE  539
            PEVPF ++G NGV++H++  + T+G A++C+AEGAGQ+ ++++  +
Sbjct  417  PEVPFAMEGPNGVVEHIKSLLATQGHAIICLAEGAGQEYVQETGTD  462


 Score = 43.9 bits (102),  Expect(3) = 2e-47, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LASG +D CLIP   F
Sbjct  395  RQSGFIAMHAALASGSVDVCLIPEVPF  421



>gb|KJB18251.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=464

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN +L D+GV IQ + KK+FK+I    DVKYIDPTY++R CRA+ASD I+CTVLGQN
Sbjct  349  DASGNIVLGDIGVRIQQETKKYFKEIGIPADVKYIDPTYMIRACRANASDGILCTVLGQN  408

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGAFAG++GITVGICNTHY+Y PIPEVI+  R VDPNSRMWHRCLTSTGQPDF
Sbjct  409  AVHGAFAGYSGITVGICNTHYVYFPIPEVISHPREVDPNSRMWHRCLTSTGQPDF  463



>ref|XP_007509844.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18959.1| predicted protein [Bathycoccus prasinos]
Length=621

 Score =   151 bits (382),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DA GNP+L D+G  +  +IKK  K      DVKYIDPTY++RGC A+A DAIMC VLGQN
Sbjct  485  DAGGNPLLGDIGPWLCKEIKKETK-----CDVKYIDPTYMVRGCVANAHDAIMCNVLGQN  539

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAGFTGIT+G  NTH +YLPIP +I   R VDP  RMWHR LTSTGQPDF 
Sbjct  540  AVHGAFAGFTGITIGYVNTHCVYLPIPMIIEKERLVDPKGRMWHRMLTSTGQPDFK  595


 Score = 44.7 bits (104),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFE  539
            PEV F + GENGV++H++  ++ +G  V+ +AEGAGQ+ ++ S  +
Sbjct  440  PEVDFDVHGENGVIEHVKDLLDEQGHCVLVIAEGAGQEFVKVSGTD  485


 Score = 40.8 bits (94),  Expect(3) = 3e-47, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQA  657
            R SGFI+M+A+LASG +D CLIP   F  
Sbjct  418  RQSGFISMYATLASGDVDICLIPEVDFDV  446



>emb|CBI18715.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +  D+GVHIQ + KK+FK      DVKYIDPTY++R CRA+ASD I+C
Sbjct  350  EKTNATDASGNIVFGDIGVHIQQETKKYFKATGNPADVKYIDPTYMIRACRANASDGILC  409

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAG++GITVGICNTHY+YLPIPEV++  R VDPNSRMWHRCLTSTGQPD
Sbjct  410  TVLGQNAVHGAFAGYSGITVGICNTHYVYLPIPEVVSYPRVVDPNSRMWHRCLTSTGQPD  469

Query  195  F  193
            F
Sbjct  470  F  470



>ref|XP_001694148.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
 gb|EDP03084.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
Length=512

 Score =   124 bits (312),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D+G  ++ + K +FK      D+KYIDP+Y++R    + +D I C +L  N
Sbjct  401  DASGNPILKDIGAFLKDKFKAYFKD----ADIKYIDPSYMIRSVSTTTNDRIYCKILAHN  456

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAGFTGITVG+ NTHY+YLPIP +I A R VDP  + W+R   + GQP F 
Sbjct  457  AVHAAFAGFTGITVGLVNTHYVYLPIPVIIQAPRKVDPRGKAWNRLRAAIGQPSFQ  512


 Score = 64.3 bits (155),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PEV FKLDG+NG+LK+L+  I+ KG AVVCVAEGAGQD++E
Sbjct  353  PEVNFKLDGDNGLLKYLDGVIKAKGHAVVCVAEGAGQDILE  393


 Score = 42.7 bits (99),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM AS+ASG +DACLIP   F+
Sbjct  331  RQSGFIAMQASMASGVVDACLIPEVNFK  358



>dbj|BAJ92720.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +   + DASGN +L D+G H+Q +IK HF++I    DVKYIDPTY+LR  RA+ASDAI+C
Sbjct  432  QRSNATDASGNMVLGDIGAHLQQKIKSHFREINVHSDVKYIDPTYMLRAVRANASDAILC  491

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            TVLGQNAVHGAFAGF+GIT GICNTH +YLPIPEVI   R VDPNSRMWHRCLTSTGQPD
Sbjct  492  TVLGQNAVHGAFAGFSGITTGICNTHNVYLPIPEVIKTPRLVDPNSRMWHRCLTSTGQPD  551

Query  195  F  193
            F
Sbjct  552  F  552


 Score = 67.0 bits (162),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFERCIWESN-SFRCWC  500
            PEVPF LDG NGVL+HLEH IETKG A++CVAEGAGQ  +         W  N     W 
Sbjct  366  PEVPFTLDGPNGVLRHLEHLIETKGFALMCVAEGAGQVRLP----SHARWGLNCQHEEWF  421

Query  499  PYPASDQEALQEDRAT  452
                 +QE LQ   AT
Sbjct  422  TKDLLNQEYLQRSNAT  437


 Score = 46.2 bits (108),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RSSGFI MHASL+SGQ+D CLIP   F
Sbjct  344  RSSGFITMHASLSSGQVDICLIPEVPF  370



>ref|XP_002949213.1| phosphofructokinase family protein [Volvox carteri f. nagariensis]
 gb|EFJ49706.1| phosphofructokinase family protein [Volvox carteri f. nagariensis]
Length=513

 Score =   125 bits (315),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 4/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D+G  ++ + K +FK      D+KYIDP+Y++R    + +D I C +L  N
Sbjct  402  DASGNPILKDIGAFLKEKFKAYFKD----ADIKYIDPSYMIRSVSTTTNDRIYCKILAHN  457

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAGFTGITVG+ NTHY+YLPIP +I A R VDP  + W+R   + GQP F+
Sbjct  458  AVHAAFAGFTGITVGLVNTHYVYLPIPVIIQAPRKVDPRGKAWNRLRAAIGQPSFT  513


 Score = 57.4 bits (137),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PE+ FKL+G+ G+L++LE  I+ KG  VVCVAEGAGQDL+E
Sbjct  354  PELNFKLNGDQGLLRYLEGVIKNKGHCVVCVAEGAGQDLLE  394


 Score = 42.7 bits (99),  Expect(3) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM AS+ASG +DACLIP   F+
Sbjct  332  RQSGFIAMQASMASGVVDACLIPELNFK  359



>ref|XP_003083008.1| putative pyrophosphate-fructose-6-phosphate 1-p (ISS) [Ostreococcus 
tauri]
 emb|CAL56963.1| Pyrophosphate-dependent phosphofructokinase TP0108 [Ostreococcus 
tauri]
Length=505

 Score =   144 bits (364),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 85/120 (71%), Gaps = 5/120 (4%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCT  373
            + T  DA GNP L D+G     Q      K E   D+KYIDPTY++RGC+A+A D+IMCT
Sbjct  390  TSTGVDAGGNPKLGDIG-----QWFCKQLKSELKCDIKYIDPTYMVRGCQANAHDSIMCT  444

Query  372  VLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            VLGQNAVHGAFAGFTGI+VG  + H  YLPIP +I   R VDP+ RMWHR L STGQPDF
Sbjct  445  VLGQNAVHGAFAGFTGISVGTVSAHTAYLPIPRMIEHERLVDPDGRMWHRTLESTGQPDF  504


 Score = 41.2 bits (95),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFE  539
            PE  +   G NGV+ ++ + ++T+G AVV +AEGAGQ+ +  +  +
Sbjct  350  PETTWAAHGPNGVINYVRNLLDTQGHAVVVLAEGAGQEFVTSTGVD  395


 Score = 39.7 bits (91),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SGFI M A+LA+GQ+D CLIP 
Sbjct  328  RQSGFITMFATLANGQVDCCLIPE  351



>ref|XP_001776018.1| predicted protein [Physcomitrella patens]
 gb|EDQ59210.1| predicted protein, partial [Physcomitrella patens]
Length=436

 Score =   140 bits (354),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D G     ++K+ F   +  +D KYIDPTY++R    ++ D I C++LGQN
Sbjct  286  DASGNPILGDFGKWFTGKVKEFFATQKIPIDAKYIDPTYMIRARVCNSGDHIFCSILGQN  345

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAG+T IT+G+ NTHY +LPIP VI   R VDPNS M+HRC+TSTGQPDF+
Sbjct  346  AVHGAFAGYTNITIGVVNTHYCFLPIPIVIKKPRMVDPNSVMYHRCVTSTGQPDFN  401


 Score = 47.4 bits (111),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -1

Query  694  LMPAS-SPEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            L+PAS    V F + G++GVL++++  IE  G  VV VAEGAGQDL+E
Sbjct  233  LLPASFEMLVTFTMGGKHGVLEYMKQKIELNGICVVVVAEGAGQDLLE  280


 Score = 36.6 bits (83),  Expect(3) = 2e-43, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SG+I M+A++ASGQ+D  LIP 
Sbjct  194  RQSGYITMYATIASGQVDIVLIPE  217



>ref|XP_003063812.1| phosphofructokinase [Micromonas pusilla CCMP1545]
 gb|EEH52185.1| phosphofructokinase [Micromonas pusilla CCMP1545]
Length=567

 Score =   135 bits (339),  Expect(3) = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DA GNP L D+G     ++K+         DVKYIDPTY++RGC A+A D+I C +LGQN
Sbjct  457  DAGGNPKLGDIGPWFCKRLKQEMS-----ADVKYIDPTYMVRGCAANAHDSIYCAILGQN  511

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVHGA AG+TGI++G+ NTH ++LPI  +I   R VDP+ RMW R LTSTGQPDF
Sbjct  512  AVHGAMAGYTGISIGMVNTHAVFLPIERLIEKERLVDPDGRMWQRLLTSTGQPDF  566


 Score = 45.4 bits (106),  Expect(3) = 4e-43, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PE+PF ++G  GV+ H++  ++ +G A++ +AEGAGQ+ ++
Sbjct  411  PELPFAMEGPTGVVAHVKRLLDNQGHAIIVLAEGAGQEYVQ  451


 Score = 42.7 bits (99),  Expect(3) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIA+HASLA+G +D CLIP   F
Sbjct  389  RQSGFIALHASLANGNVDVCLIPELPF  415



>ref|XP_001422557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00874.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=416

 Score =   140 bits (354),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCT  373
            S    DA GNP L D+G     Q      K E   DVKYIDPTY++RGC A+A D+IMCT
Sbjct  301  SAGGTDAGGNPKLGDIG-----QWFCKQLKAEIKCDVKYIDPTYMVRGCVANAHDSIMCT  355

Query  372  VLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            VLGQNAVHGAFAGFTGI+VG  + H  +LPIP +I   R VDP+ RMWHR L STGQPDF
Sbjct  356  VLGQNAVHGAFAGFTGISVGSVSAHTAFLPIPRMIERERLVDPDGRMWHRTLASTGQPDF  415


 Score = 40.8 bits (94),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SGFIAM A+LA+GQ+D CLIP 
Sbjct  239  RQSGFIAMFATLANGQVDCCLIPE  262


 Score = 38.9 bits (89),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PE+ +   G NGV++++ + ++ +G AVV +AEGAGQ+ + 
Sbjct  261  PEISWAAHGPNGVVEYVRNMLDAQGHAVVVLAEGAGQEFVS  301



>ref|XP_003064765.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51099.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=403

 Score =   134 bits (336),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNP+L +    +Q++I    K     VDVKYIDPTY++R C  +ASDAI C++LGQN
Sbjct  272  DASGNPVLQNFAKFLQNEINADMKADLS-VDVKYIDPTYMVRACPTNASDAIYCSILGQN  330

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAG++G TVG+CN HY+YLPIP VI ++R VDP+ RMW R   +  QP FS
Sbjct  331  AVHAAFAGYSGATVGLCNGHYVYLPIPPVIKSAREVDPDGRMWERLKLAINQPVFS  386


 Score = 44.7 bits (104),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RSSGFIAM+ASLASG++D CLIP 
Sbjct  204  RSSGFIAMNASLASGEVDVCLIPE  227


 Score = 42.0 bits (97),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE+   L+G  GVL H+   +  K   VV VAEGAGQD++ K
Sbjct  226  PEINTPLEGPGGVLAHIRRVLNRKQHCVVVVAEGAGQDILGK  267



>ref|XP_005651055.1| phosphofructokinase family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26511.1| phosphofructokinase family protein [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score =   127 bits (320),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 4/122 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL DVGV ++ ++K H K+     D+KYI+P+Y++R     +SD I C VL  N
Sbjct  368  DASGNPILQDVGVWMKQELKNHHKEA----DIKYIEPSYMIRSTPTISSDRIYCKVLAHN  423

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*YRQ  178
            AVH AFAG+TG+TVG+ NTHY+YLPIP VI A R VDP  + W+R   S GQP+F    Q
Sbjct  424  AVHAAFAGYTGVTVGLVNTHYVYLPIPVVIQAPRKVDPRGKTWNRLRASIGQPNFVEEGQ  483

Query  177  SQ  172
            SQ
Sbjct  484  SQ  485


 Score = 50.8 bits (120),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQ  566
            PEVPF L G+NG+  +L+  +E++G AVVC+AEGAGQ
Sbjct  326  PEVPFVLHGQNGLCAYLDKVLESRGHAVVCLAEGAGQ  362


 Score = 41.2 bits (95),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM AS+ASG +D CLIP   F
Sbjct  304  RQSGFIAMQASMASGVVDVCLIPEVPF  330



>ref|XP_002994206.1| hypothetical protein SELMODRAFT_138352, partial [Selaginella 
moellendorffii]
 gb|EFJ04711.1| hypothetical protein SELMODRAFT_138352, partial [Selaginella 
moellendorffii]
Length=430

 Score =   149 bits (376),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D G  +  Q+K HFK++   VDVKYIDPTY++R    ++SD I C+VLGQN
Sbjct  258  DASGNPILGDAGKSVNLQVKSHFKELNIPVDVKYIDPTYMIRARACNSSDHIYCSVLGQN  317

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAG+T  ++G+ NTHY+ LPIPE+I  +R VDPNS MWHRCL STGQPDF+
Sbjct  318  AVHGAFAGYTNFSIGLVNTHYVLLPIPEIIKTARAVDPNSNMWHRCLGSTGQPDFA  373


 Score = 49.3 bits (116),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = -1

Query  706  QVDKLMPASSPEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            QVD ++    PEVPF++DG+NGVL  ++  ++  G+ VV +AEGA Q+ +E +
Sbjct  205  QVDLVL---IPEVPFEMDGKNGVLAFMKKRLDKNGNCVVVIAEGAAQNYLEGT  254



>ref|XP_002993249.1| hypothetical protein SELMODRAFT_187341 [Selaginella moellendorffii]
 gb|EFJ05670.1| hypothetical protein SELMODRAFT_187341 [Selaginella moellendorffii]
Length=441

 Score =   148 bits (373),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D G  + + +K HFK++   VDVKYIDPTY++R    ++SD I C+VLGQN
Sbjct  269  DASGNPILGDAGKWLYNLVKSHFKELNIPVDVKYIDPTYMIRARACNSSDHIYCSVLGQN  328

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAG+T  ++G+ NTHY+ LPIPE+I  +R VDPNS MWHRCL STGQPDF+
Sbjct  329  AVHGAFAGYTNFSIGLVNTHYVLLPIPEIIKTARAVDPNSNMWHRCLGSTGQPDFA  384


 Score = 49.3 bits (116),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = -1

Query  706  QVDKLMPASSPEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            QVD ++    PEVPF++DG+NGVL  ++  ++  G+ VV +AEGA Q+ +E +
Sbjct  216  QVDLVL---IPEVPFEMDGKNGVLAFMKKRLDKNGNCVVVIAEGAAQNYLEGT  265



>ref|XP_001417416.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95709.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=433

 Score =   131 bits (329),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 4/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL +   ++Q ++K    +     D+KYIDPTY++R CR +ASDA+ C++LGQN
Sbjct  320  DASGNPILQNFAKYLQQKLKDAKPE----CDIKYIDPTYMVRACRTNASDAVYCSILGQN  375

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAG + +TVG+C+ HY+YLPIP VI+A+R VDP  RM+ R   + GQP FS
Sbjct  376  AVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAARTVDPEGRMFERLRFAIGQPTFS  431


 Score = 42.4 bits (98),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SGFIAMHA+LASG  D CLIP 
Sbjct  252  RQSGFIAMHAALASGNTDVCLIPE  275


 Score = 42.0 bits (97),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+   L+G+ GVL H++  +E +  AVV VAEGAGQ+ +
Sbjct  274  PEIDCPLEGDGGVLAHIKRVVERQNHAVVVVAEGAGQEQL  313



>ref|XP_003078563.1| putative phosphofructokinase (ISS) [Ostreococcus tauri]
 emb|CAL51443.1| Pyrophosphate-dependent phosphofructokinase TP0108 [Ostreococcus 
tauri]
Length=493

 Score =   132 bits (332),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 4/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNP+L +   ++Q ++K+        VD+KYIDPTY++R CR +ASDA+ C++LGQN
Sbjct  380  DASGNPVLQNFAKYLQQKLKEAKPN----VDIKYIDPTYMVRACRTNASDAVYCSILGQN  435

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAG + +TVG+C+ HY+YLPIP VI+A R VDP  RM+ R   + GQP FS
Sbjct  436  AVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAPRTVDPEGRMFERLRFAIGQPTFS  491


 Score = 42.4 bits (98),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SGFIAMHA+LASG  D CLIP 
Sbjct  312  RQSGFIAMHAALASGNTDVCLIPE  335


 Score = 40.4 bits (93),  Expect(3) = 9e-41, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+   L+G  GVL H+   IE +  AV+ VAEGAGQ+ +
Sbjct  334  PEIDCPLEGSGGVLAHIVRVIERQNHAVIVVAEGAGQEQL  373



>ref|XP_002504425.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65683.1| predicted protein [Micromonas sp. RCC299]
Length=377

 Score =   130 bits (327),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNP+L +    +Q ++K+         D+KYIDPTY++R C  + SDA+ C++LGQN
Sbjct  261  DASGNPVLQNFAKFLQKEMKEKLADCSP--DIKYIDPTYMVRACPTNGSDAVYCSLLGQN  318

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVH AFAG +G+TVG+CN HY+YLPIP +I+ +R VDPN RMW R   +  QP FS
Sbjct  319  AVHAAFAGLSGVTVGLCNGHYVYLPIPPLISRAREVDPNGRMWERLKLAIQQPVFS  374


 Score = 44.3 bits (103),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SGFIAMHA+LASG++D CLIP 
Sbjct  193  RQSGFIAMHAALASGEVDVCLIPE  216


 Score = 40.4 bits (93),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE+   L+G+ GVL H+   +  K   V+ VAEGAGQ+++ K
Sbjct  215  PEIDTTLEGQGGVLAHVRRVLTRKEHCVIVVAEGAGQEILGK  256



>ref|XP_002946149.1| phosphofructokinase family protein [Volvox carteri f. nagariensis]
 gb|EFJ53144.1| phosphofructokinase family protein [Volvox carteri f. nagariensis]
Length=523

 Score =   128 bits (321),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL+D+G+ +++++KKHFK      D+KYIDP+Y++R    +++D I C VLGQ 
Sbjct  411  DASGNPILADIGIFLRNELKKHFKGD---ADIKYIDPSYMIRSVPTTSNDRIYCKVLGQG  467

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAG+T ITVG+ NTHY+YLPIP +I A R V+P  R W+R + +  QPDFS
Sbjct  468  AVHGAFAGYTDITVGLVNTHYVYLPIPMIIQAPRKVNPKGRRWNRLIAAIRQPDFS  523


 Score = 44.7 bits (104),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 3/40 (8%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+PF++D    ++ H+    E +G  VVCVAEGAGQDL+
Sbjct  367  PEIPFRMDK---LIAHIASVFEKQGHCVVCVAEGAGQDLL  403


 Score = 38.9 bits (89),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM AS+ASG  D CLIP   F+
Sbjct  345  RQSGFIAMQASMASGVADVCLIPEIPFR  372



>ref|XP_001778081.1| predicted protein [Physcomitrella patens]
 gb|EDQ57087.1| predicted protein [Physcomitrella patens]
Length=549

 Score =   139 bits (351),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 9/130 (7%)
 Frame = -2

Query  531  SGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQNAV  352
            SGNPIL D+G     ++K HF   +  VDVKYIDPTY++R    ++SD I C++LGQNAV
Sbjct  314  SGNPILGDIGKFFYDKVKSHFGAKKFPVDVKYIDPTYMIRARACNSSDHIFCSILGQNAV  373

Query  351  HGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*YRQSQ  172
            HGAFAG+T ITVG+ NTHY +LPIPEVI   R VDP S M+ RC+TSTGQP+F       
Sbjct  374  HGAFAGYTNITVGVVNTHYCFLPIPEVIKKPRVVDPRSNMYQRCVTSTGQPEF-------  426

Query  171  CYKTKNCYNK  142
              + +NC  K
Sbjct  427  --QERNCDKK  434


 Score = 38.1 bits (87),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            R SG+I+M+A++ASGQ+DA LIP 
Sbjct  231  RQSGYISMYATIASGQVDAVLIPE  254


 Score = 33.9 bits (76),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -1

Query  670  VPFKLDGENGVLKHLEHXIETKGSAVVCVAE  578
            VPF+L+GE GVL+ +   ++  G AVV +AE
Sbjct  268  VPFQLEGEYGVLEFMHKRLKKNGIAVVVIAE  298



>ref|XP_001696305.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
 gb|EDP08282.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
Length=529

 Score =   128 bits (322),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL+D+G+ ++++ KKHFK      D+KYIDP+Y++R    +++D I C VLGQ 
Sbjct  417  DASGNPILADIGIFMRNEFKKHFKGE---ADIKYIDPSYMIRSVPTTSNDRIYCKVLGQG  473

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAGFT +TVG+ NTHY+YLPIP +I A+R V+P  R W+R +T+  QPD +
Sbjct  474  AVHGAFAGFTDVTVGLVNTHYVYLPIPTIIQAARKVNPKGRRWNRLITAIRQPDMA  529


 Score = 44.7 bits (104),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+PF++D    + +H+E   E +G  VVCVAEGAGQDL+
Sbjct  372  PEIPFRMDK---LCEHVESIFEKQGHCVVCVAEGAGQDLL  408


 Score = 37.7 bits (86),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM A++ASG  D CLIP   F+
Sbjct  350  RQSGFIAMQAAMASGVADVCLIPEIPFR  377



>ref|XP_001696306.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
 gb|EDP08283.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
Length=404

 Score =   127 bits (318),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQ--LVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            DASGNPIL+D+G+ ++++ KKHFK  +     D+KYIDP+Y++R    +++D I C VLG
Sbjct  287  DASGNPILADIGIFMRNEFKKHFKVGDAHGEADIKYIDPSYMIRSVPTTSNDRIYCKVLG  346

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            Q AVHGAFAGFT +TVG+ NTHY+YLPIP +I A+R V+P  R W+R +T+  QPD +
Sbjct  347  QGAVHGAFAGFTDVTVGLVNTHYVYLPIPTIIQAARKVNPKGRRWNRLITAIRQPDMA  404


 Score = 44.3 bits (103),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+PF++D    + +H+E   E +G  VVCVAEGAGQDL+
Sbjct  242  PEIPFRMDK---LCEHVESIFEKQGHCVVCVAEGAGQDLL  278


 Score = 37.7 bits (86),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM A++ASG  D CLIP   F+
Sbjct  220  RQSGFIAMQAAMASGVADVCLIPEIPFR  247



>gb|EWM26350.1| pyrophosphate-dependent phosphofructose kinase [Nannochloropsis 
gaditana]
Length=541

 Score =   109 bits (273),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
             KDASGN  L  +G  ++ +I  +FK   Q   VKYIDP+Y++R   A+A+D+I C++L 
Sbjct  408  EKDASGNKKLPAIGQFLKEKIGIYFKSQGQPSTVKYIDPSYMVRSVPANAADSIYCSLLA  467

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAAS-RHVDPNSRMWHRCLTSTGQPD  196
            QNAVHGA AGFT  TVG+CN   +YLPIP V+A S R +DP  R W R L+ T QP+
Sbjct  468  QNAVHGAMAGFTQFTVGLCNNRLVYLPIPLVVATSPRVMDPVGRTWERVLSVTRQPN  524


 Score = 51.2 bits (121),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVP  L+GE G L HL   ++ KG AVV VAEGAG++L+ +S
Sbjct  364  PEVPIVLEGERGCLPHLAQRVQQKGHAVVVVAEGAGEELLGQS  406


 Score = 42.0 bits (97),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RS+GFIA+HA+LASG +D CLIP 
Sbjct  342  RSAGFIAVHATLASGDVDLCLIPE  365



>ref|XP_005853474.1| 6-phosphofructo-2-kinase / fructose-2,6-bisphosphatase, partial 
[Nannochloropsis gaditana CCMP526]
 gb|EKU22888.1| 6-phosphofructo-2-kinase / fructose-2,6-bisphosphatase, partial 
[Nannochloropsis gaditana CCMP526]
Length=529

 Score =   109 bits (273),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
             KDASGN  L  +G  ++ +I  +FK   Q   VKYIDP+Y++R   A+A+D+I C++L 
Sbjct  408  EKDASGNKKLPAIGQFLKEKIGIYFKSQGQPSTVKYIDPSYMVRSVPANAADSIYCSLLA  467

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAAS-RHVDPNSRMWHRCLTSTGQPD  196
            QNAVHGA AGFT  TVG+CN   +YLPIP V+A S R +DP  R W R L+ T QP+
Sbjct  468  QNAVHGAMAGFTQFTVGLCNNRLVYLPIPLVVATSPRVMDPVGRTWERVLSVTRQPN  524


 Score = 51.2 bits (121),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVP  L+GE G L HL   ++ KG AVV VAEGAG++L+ +S
Sbjct  364  PEVPIVLEGERGCLPHLAQRVQQKGHAVVVVAEGAGEELLGQS  406


 Score = 42.0 bits (97),  Expect(3) = 5e-37, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RS+GFIA+HA+LASG +D CLIP 
Sbjct  342  RSAGFIAVHATLASGDVDLCLIPE  365



>gb|AIN35079.1| phosphofructokinase [Dunaliella tertiolecta]
Length=544

 Score =   125 bits (314),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCT  373
            S+   DASGNPIL+D+G  ++  +K + K      D+KYIDPTY++R    + +D + C 
Sbjct  427  SKGGTDASGNPILADIGPIVKDSLKDYLKGN---CDIKYIDPTYMIRAIPTTTNDRVYCK  483

Query  372  VLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            VLGQ AVHGAFAG+T ITVG+ NTHY+Y+PI  +I A R V+P  R W+R +++ GQP+F
Sbjct  484  VLGQGAVHGAFAGYTDITVGLVNTHYVYMPIQTIIQAPRRVNPTGRRWNRLVSAIGQPNF  543

Query  192  S  190
            S
Sbjct  544  S  544


 Score = 40.8 bits (94),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIAM AS+ASG +D CLIP   F 
Sbjct  365  RQSGFIAMQASMASGVVDVCLIPEIQFD  392


 Score = 34.7 bits (78),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 3/44 (7%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE+ F L   N   +++   IE KG  VVC+AEGAGQ++++ ++
Sbjct  387  PEIQFDLQKLN---EYVAKVIERKGHCVVCLAEGAGQNVVKGAS  427



>ref|XP_005652308.1| phosphofructokinase family protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27764.1| phosphofructokinase family protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=441

 Score =   123 bits (309),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            + DASGNPIL+D+G+ ++ +IK   K      DVK IDP+Y++R    + +D I C +LG
Sbjct  328  ATDASGNPILADIGIFLRDRIKALIKG----ADVKLIDPSYLIRAVPTNPNDRIYCKILG  383

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            Q AVHGAFAGFTG TVG+ NTHY+YLPIP +I A+R VDP  R W+R  T+  Q D  
Sbjct  384  QGAVHGAFAGFTGFTVGLVNTHYVYLPIPVIIQAARTVDPKGRNWNRLKTAINQQDLE  441


 Score = 40.4 bits (93),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM AS+ASG +D CLIP   F
Sbjct  264  RQSGFIAMQASMASGVVDICLIPEIEF  290


 Score = 36.6 bits (83),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 3/41 (7%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PE+ F    E  ++  ++  I  KG AVVCVAEGAGQ L+E
Sbjct  286  PEIEFC---EEKLMASIQAIINRKGHAVVCVAEGAGQTLLE  323



>ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
 gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
Length=489

 Score =   108 bits (271),  Expect(3) = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK +F + + ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLKDVGLWLSQSIKDYFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 50.8 bits (120),  Expect(3) = 4e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 4e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>emb|CAB38956.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
 emb|CAB79482.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
Length=500

 Score =   108 bits (270),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF + + ++++KYIDPTY++R   ++ASD + C
Sbjct  342  ESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  401

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  402  TLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  461

Query  195  F  193
            F
Sbjct  462  F  462


 Score = 50.8 bits (120),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  298  PESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS  340


 Score = 40.0 bits (92),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  276  RYSGFIAMYATLASRDVDCCLIPESPF  302



>emb|CDX94352.1| BnaC01g18320D [Brassica napus]
 emb|CDX89351.1| BnaA01g15420D [Brassica napus]
Length=489

 Score =   108 bits (271),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L+DVG+ +   IK HF + + ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 50.8 bits (120),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS  329


 Score = 39.7 bits (91),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RFSGFIAMYATLASRDVDCCLIPESPF  291



>gb|EMS49605.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=534

 Score = 77.4 bits (189),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN ILSD GVH+Q +IKKHFK I  L DVKYIDPTY++R CRA+ASDAI+CTVLGQN
Sbjct  410  DASGNVILSDFGVHMQQKIKKHFKDIGVLADVKYIDPTYMVRACRANASDAILCTVLGQN  469

Query  357  AVH  349
            A++
Sbjct  470  ALN  472


 Score = 73.2 bits (178),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEV F LDGE+GVL HLEH +ETKG  VVCVAEGAGQDL++KSN
Sbjct  364  PEVSFTLDGEHGVLSHLEHLLETKGFCVVCVAEGAGQDLLQKSN  407


 Score = 48.9 bits (115),  Expect(3) = 5e-36, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            RS+GFIAMHASL+SGQID CLIP  +F
Sbjct  342  RSTGFIAMHASLSSGQIDVCLIPEVSF  368



>ref|XP_009142127.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Brassica rapa]
Length=490

 Score =   108 bits (271),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L+DVG+ +   IK HF + + ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 50.4 bits (119),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+  ++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFAYIEKRLKESGHMVLVIAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|NP_567742.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
 sp|Q94AA4.1|PFKA3_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 3; Short=ATP-PFK 
3; Short=Phosphofructokinase 3; AltName: Full=Phosphohexokinase 
3 [Arabidopsis thaliana]
 gb|AAK83587.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AAL90928.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AEE85178.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
Length=489

 Score =   108 bits (270),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF + + ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 50.8 bits (120),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 6e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>gb|KIZ06381.1| hypothetical protein MNEG_1568 [Monoraphidium neglectum]
Length=454

 Score =   119 bits (298),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = -2

Query  570  DKI*WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASAS  391
            D +  + +   DASGN IL D+GV ++  +K HFK      D+KYIDP+Y++R    +++
Sbjct  331  DLVNQEGKGGTDASGNAILKDIGVFLRDTLKGHFKDQ---ADIKYIDPSYLIRSIPTTSN  387

Query  390  DAIMCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTS  211
            D I C VLGQ AVHGAF+G+TG T G+ NTHY+YLPI  +I A R V+P  R W+R  T+
Sbjct  388  DRIYCKVLGQGAVHGAFSGYTGFTAGLVNTHYVYLPIETIIQAPRKVNPTGRRWNRLKTA  447

Query  210  TGQPDF  193
              QPD 
Sbjct  448  INQPDL  453


 Score = 41.6 bits (96),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM AS+ASG +D CLIP   F 
Sbjct  275  RNSGFIAMEASMASGVVDVCLIPEIKFD  302


 Score = 38.1 bits (87),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE+ F    +  +L H+   ++ KG  V+CVAEGAGQDL+ +
Sbjct  297  PEIKFD---QKKLLAHVGSILDRKGHCVICVAEGAGQDLVNQ  335



>emb|CDY69051.1| BnaAnng29210D, partial [Brassica napus]
Length=477

 Score =   108 bits (270),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L+DVG+ +   IK HF + + ++++KYIDPTY++R   ++ASD + C
Sbjct  316  ESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  375

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  376  TLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  435

Query  195  F  193
            F
Sbjct  436  F  436


 Score = 50.4 bits (119),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+  ++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  272  PESPFYLEGEGGLFAYIEKRLKESGHMVLVIAEGAGQDLMSKS  314


 Score = 39.7 bits (91),  Expect(3) = 7e-36, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  250  RYSGFIAMYATLASRDVDCCLIPESPF  276



>gb|KDD73612.1| phosphofructokinase [Helicosporidium sp. ATCC 50920]
Length=482

 Score =   116 bits (291),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGNPIL D+G +++ ++ KHF       DV+YIDP+Y++R      +D I+C VLGQ 
Sbjct  371  DASGNPILKDIGTYLRDELAKHFTGR----DVRYIDPSYMIRSIPTITTDRILCKVLGQG  426

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHGAFAGFT  TVG  NTHY+YLP   +I + R VDP  R W+R  T+  QPD +
Sbjct  427  AVHGAFAGFTDFTVGSINTHYVYLPTTTIIQSPRTVDPQGRTWNRLCTAINQPDLA  482


 Score = 45.1 bits (105),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFI+MHAS+ASG +D CLIP  +F+
Sbjct  305  RSSGFISMHASMASGVVDVCLIPEISFR  332


 Score = 36.2 bits (82),  Expect(3) = 1e-35, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 3/40 (8%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE+ F++D    ++ +++  +  K  AV+CVAEGAGQD++
Sbjct  327  PEISFRMDK---LIAYVDTVLARKDYAVLCVAEGAGQDVV  363



>ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
 gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
Length=489

 Score =   108 bits (270),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HFK+ + ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLKDVGLWLSQSIKDHFKQKKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 48.9 bits (115),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQD M KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGAGQDQMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 2e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_011076434.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Sesamum indicum]
Length=536

 Score =   113 bits (283),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAI  382
            W +   KDASGN +L DVG+ +  +IK HF  + ++ +++KYIDPTY++R   ++ASD I
Sbjct  388  WHAAAEKDASGNRLLLDVGLWLTQKIKDHFTNVRKMAINMKYIDPTYMIRAIPSNASDNI  447

Query  381  MCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQ  202
             CT+L QNAVHGA AG+TG TVG  N+ + Y+PI  V      V    RMW R LTST Q
Sbjct  448  YCTLLAQNAVHGAMAGYTGFTVGPVNSRHAYIPINRVTETQNTVKLTDRMWARLLTSTNQ  507

Query  201  PDF  193
            P F
Sbjct  508  PSF  510


 Score = 42.4 bits (98),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LAS  +D CLIP   F
Sbjct  323  RYSGFIAMHATLASRDVDCCLIPESPF  349


 Score = 40.8 bits (94),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQ+ + +S
Sbjct  345  PESPFYLEGQGGLFEFVEERLKENGHMVIVLAEGAGQEYVAQS  387



>ref|XP_010483140.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
 ref|XP_010483141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
Length=485

 Score =   105 bits (263),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T KDASGN +L DVG+ +   IK +FKKI+ ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  333  TLKDASGNKLLKDVGLWLAQSIKDYFKKIKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  392

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  393  AQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450


 Score = 50.8 bits (120),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+L+ +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLLEFIEKRLKEHGHMVIVLAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010443317.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Camelina 
sativa]
Length=485

 Score =   105 bits (263),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T KDASGN +L DVG+ +   IK +FKKI+ ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  333  TLKDASGNKLLKDVGLWLAQSIKDYFKKIKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  392

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  393  AQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450


 Score = 50.8 bits (120),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+L+ +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLLEFIEKRLKEHGHMVIVLAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010668815.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   115 bits (287),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++R  KDASGN +L DVG+ + H+IK+HF +   ++++KYIDPTY++R   ++ASD + C
Sbjct  337  ENRNEKDASGNKLLKDVGLWMSHKIKEHFARKSMIINLKYIDPTYMIRAIPSNASDNVYC  396

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AGFTG TVG+ N  + Y+P   +      V    RMW R L+ST QP 
Sbjct  397  TLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQNQVCITDRMWARLLSSTNQPS  456

Query  195  F  193
            F
Sbjct  457  F  457


 Score = 41.6 bits (96),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFER  536
            PE PF L+G+ G+ +++   ++  G  V+ +AEGAGQ+L+ ++  E+
Sbjct  296  PESPFYLEGKGGLFEYIGKRLKENGHMVIVMAEGAGQELLSENRNEK  342


 Score = 40.0 bits (92),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  274  RYSGFIAMYATLASRDVDCCLIPESPF  300



>ref|XP_010668810.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=514

 Score =   115 bits (287),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++R  KDASGN +L DVG+ + H+IK+HF +   ++++KYIDPTY++R   ++ASD + C
Sbjct  364  ENRNEKDASGNKLLKDVGLWMSHKIKEHFARKSMIINLKYIDPTYMIRAIPSNASDNVYC  423

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AGFTG TVG+ N  + Y+P   +      V    RMW R L+ST QP 
Sbjct  424  TLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQNQVCITDRMWARLLSSTNQPS  483

Query  195  F  193
            F
Sbjct  484  F  484


 Score = 41.2 bits (95),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFER  536
            PE PF L+G+ G+ +++   ++  G  V+ +AEGAGQ+L+ ++  E+
Sbjct  323  PESPFYLEGKGGLFEYIGKRLKENGHMVIVMAEGAGQELLSENRNEK  369


 Score = 40.0 bits (92),  Expect(3) = 3e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  301  RYSGFIAMYATLASRDVDCCLIPESPF  327



>gb|KFK27231.1| hypothetical protein AALP_AA8G354500 [Arabis alpina]
Length=489

 Score =   107 bits (266),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF KI+ ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLKDVGLWLSQSIKDHFNKIKMVMNLKYIDPTYMIRAVPSNASDNVYC  390

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP 
Sbjct  391  TLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPS  450

Query  195  F  193
            F
Sbjct  451  F  451


 Score = 49.3 bits (116),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEFIEKRLKEHGHMVIVLAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_002286176.1| 6-phosphofructokinase [Thalassiosira pseudonana CCMP1335]
 gb|EED95817.1| 6-phosphofructokinase, partial [Thalassiosira pseudonana CCMP1335]
Length=394

 Score =   107 bits (266),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T  DASGN  L  +G  ++  +  +F+K  +   VKYIDP+Y++R   A+A+D + C  L
Sbjct  259  TETDASGNKKLPQIGEFMKKAVNDYFRKQGEEATVKYIDPSYMIRSVPANATDTLYCMQL  318

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAAS-RHVDPNSRMWHRCLTSTGQPDFS  190
            GQNAVHG FAG+TG +VG+CN     LPIPE++A S R ++P  R W R L  T QP+  
Sbjct  319  GQNAVHGCFAGYTGFSVGLCNNKMCLLPIPELVATSPRQMNPMGRTWERILAVTRQPNTR  378

Query  189  *YRQSQCYKTKN  154
               +    +TK+
Sbjct  379  KITRKSMARTKS  390


 Score = 48.1 bits (113),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVP  LDG NG L HL   ++  G AV+ VAEGAG++L+ +S 
Sbjct  216  PEVPIVLDGPNGCLPHLWRRVKKNGYAVIVVAEGAGEELLGEST  259


 Score = 40.8 bits (94),  Expect(3) = 5e-35, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RSSGFIA HA+L SG +D CLIP 
Sbjct  194  RSSGFIAAHATLGSGDVDLCLIPE  217



>ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
 gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
Length=487

 Score =   105 bits (263),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T KDASGN +L DVG+ +   IK HF K + ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  333  TLKDASGNKLLKDVGLWLSQSIKDHFNKNKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  392

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  393  AQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450


 Score = 49.7 bits (117),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEFIEKRLKESGHMVIVLAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 7e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010433524.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Camelina sativa]
Length=488

 Score =   103 bits (258),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF K   ++++KYIDPTY++R   ++ASD + C
Sbjct  331  ESMTLKDASGNKLLKDVGLWLSQSIKDHFNKKM-VMNLKYIDPTYMIRAVPSNASDNVYC  389

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP 
Sbjct  390  TLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPS  449

Query  195  F  193
            F
Sbjct  450  F  450


 Score = 51.2 bits (121),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+  ++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFDYIEKRLKESGHMVIVIAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 8e-35, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_008447679.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=514

 Score =   100 bits (249),  Expect(3) = 9e-35, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGV-hiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            K +   DASGN +  DVG    Q        K   L+++KYIDPTY++R   ++ASD I 
Sbjct  369  KDKNQMDASGNKLHEDVGSWLSQQITDHFKGKGNILINLKYIDPTYMIRAVPSNASDNIY  428

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L  NA+HGA AG+TG TVG  N  + Y+P   +      V    RMW R L+ST QP
Sbjct  429  CTLLAHNAIHGAMAGYTGFTVGPVNGEHAYVPFHRITERQNKVVTTDRMWARLLSSTNQP  488

Query  198  DF  193
             F
Sbjct  489  TF  490


 Score = 48.1 bits (113),  Expect(3) = 9e-35, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE PF L+GE G+ +++EH ++ +G  V+ +AEGAGQ+L+ K
Sbjct  328  PESPFYLEGEGGLFEYIEHCLKEQGHMVMVIAEGAGQELISK  369


 Score = 46.2 bits (108),  Expect(3) = 9e-35, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAMHA+LASG +D CLIP   F
Sbjct  306  RNSGFIAMHATLASGDVDCCLIPESPF  332



>ref|XP_006451353.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64593.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=512

 Score =   108 bits (269),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S T +DASGN +L DVG+ +  +IK HF K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  342  RSATQQDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVY  401

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+ VHGA AG+TG T G+ N    Y+P   +I    HV    RMW R L+ST QP
Sbjct  402  CTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQP  461

Query  198  DF  193
             F
Sbjct  462  SF  463


 Score = 46.6 bits (109),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  298  PESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAES  340


 Score = 40.0 bits (92),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  276  RYSGFIAMYATLASRDVDCCLIPESPF  302



>emb|CDY32769.1| BnaA10g10800D [Brassica napus]
Length=369

 Score =   104 bits (259),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             ++ DASGN +L DVG+ +   IK +FKKI  ++++KYIDPTY++R   ++ASD + CT+
Sbjct  212  ESNTDASGNKLLKDVGLWLSQSIKDYFKKINMVMNLKYIDPTYMIRAVPSNASDNVYCTL  271

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  272  LAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  330


 Score = 50.4 bits (119),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+L+ +E  I+  G  V+ +AEGAGQ+LM KS
Sbjct  168  PESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKS  210


 Score = 40.0 bits (92),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  146  RYSGFIAMYATLASRDVDCCLIPESPF  172



>ref|XP_001766110.1| predicted protein [Physcomitrella patens]
 gb|EDQ69169.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   112 bits (280),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhi-qhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCT  373
            +   DASGN +L DVG+ + Q+  +   K+ ++ +++KYIDPTY++R   ++ASD + CT
Sbjct  331  KNLNDASGNKLLLDVGLWLCQNLKEHFLKEFKEPLNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  372  VLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            +L  +A+HGA AG+ G TVG  N  + Y+PIP V+A SRHV+   RMW R ++ST QP F
Sbjct  391  LLAHSAIHGAMAGYCGFTVGPVNVRHCYIPIPRVVAKSRHVNVADRMWARLMSSTNQPSF  450

Query  192  S*YRQ  178
            S Y +
Sbjct  451  SQYNE  455


 Score = 46.2 bits (108),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF L G  G+++++ H ++  G  V+ VAEGAGQ+L+ +S
Sbjct  284  PEVPFYLLGPGGLIEYVHHRLKENGHMVIVVAEGAGQELIAES  326


 Score = 36.2 bits (82),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SG+IA++A+LAS  +D CLIP   F
Sbjct  262  RYSGYIALYATLASRDVDLCLIPEVPF  288



>ref|XP_005702907.1| 6-phosphofructokinase [Galdieria sulphuraria]
 gb|EME26387.1| 6-phosphofructokinase [Galdieria sulphuraria]
Length=489

 Score =   114 bits (285),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN  L D+G  +  +I+  FKK    V +KYIDPTY++R   ++ASD I CT+L  +
Sbjct  338  DASGNKKLGDIGHFLYQEIESTFKKQGIEVSMKYIDPTYMIRAVASNASDNIYCTLLAHS  397

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHG+FAG+TG TVG  +  + Y+P+ E++ A + VD   RMW R + STGQPDFS
Sbjct  398  AVHGSFAGYTGFTVGPIHGRHAYIPMTEIVTAQKQVDLRDRMWSRLVNSTGQPDFS  453


 Score = 41.6 bits (96),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIA+HASL+S ++D CLIP   F
Sbjct  266  RNSGFIALHASLSSREVDCCLIPEVPF  292


 Score = 38.5 bits (88),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PEVPF + G  G+++++   +  +G  V+ VAEGAGQ+ + 
Sbjct  288  PEVPFVIHGRGGLIEYIHKCLIERGKMVLVVAEGAGQEYVR  328



>ref|XP_006475360.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=561

 Score =   107 bits (268),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S T +DASGN +L DVG+ +  +IK HF K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  391  RSATQQDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVY  450

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+ VHGA AG+TG T G+ N    Y+P   +I    HV    RMW R L+ST QP
Sbjct  451  CTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQP  510

Query  198  DF  193
             F
Sbjct  511  SF  512


 Score = 46.2 bits (108),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  347  PESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAES  389


 Score = 40.0 bits (92),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  325  RYSGFIAMYATLASRDVDCCLIPESPF  351



>ref|XP_010438777.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Camelina 
sativa]
Length=486

 Score =   102 bits (255),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             T KDASGN +L DVG+ +   IK HF K   ++++KYIDPTY++R   ++ASD + CT+
Sbjct  331  ETLKDASGNKLLKDVGLWLSQSIKDHFNKKM-VMNLKYIDPTYMIRAVPSNASDNVYCTL  389

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP F
Sbjct  390  LAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPSF  448


 Score = 51.6 bits (122),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGAGQDLMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010451175.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Camelina sativa]
Length=456

 Score =   102 bits (255),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             T KDASGN +L DVG+ +   IK HF K   ++++KYIDPTY++R   ++ASD + CT+
Sbjct  331  ETLKDASGNKLLKDVGLWLSQSIKDHFNKKM-VMNLKYIDPTYMIRAVPSNASDNVYCTL  389

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG   G+ N    Y+P   +     HV    RMW R L+ST QP F
Sbjct  390  LAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPSF  448


 Score = 51.6 bits (122),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGAGQDLMSKS  329


 Score = 39.7 bits (91),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_006451354.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64594.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=561

 Score =   107 bits (268),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S T +DASGN +L DVG+ +  +IK HF K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  391  RSATQQDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVY  450

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+ VHGA AG+TG T G+ N    Y+P   +I    HV    RMW R L+ST QP
Sbjct  451  CTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQP  510

Query  198  DF  193
             F
Sbjct  511  SF  512


 Score = 46.2 bits (108),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  347  PESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAES  389


 Score = 40.0 bits (92),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  325  RYSGFIAMYATLASRDVDCCLIPESPF  351



>ref|XP_011401573.1| 6-phosphofructokinase 5, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28539.1| 6-phosphofructokinase 5, chloroplastic [Auxenochlorella protothecoides]
Length=455

 Score =   104 bits (260),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  444  VKYIDPTYILRGCRASASDAIMCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIA  265
            VKYIDP+Y++R     +SD   C VL  NAVH AFAGFTG TVG+ NTHY+ LPIP V  
Sbjct  371  VKYIDPSYLVRSVPTVSSDRTYCKVLAHNAVHAAFAGFTGTTVGLVNTHYVLLPIPFVTQ  430

Query  264  ASRHVDPNSRMWHRCLTSTGQPDFS  190
            A R VDP    W+R   + GQP+F+
Sbjct  431  APRRVDPQGNQWNRLRAANGQPNFT  455


 Score = 51.6 bits (122),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFERC  533
            PE+ F LDGE G+  +L+  ++ +GSAVVCVAEGAGQ   +  + +R 
Sbjct  302  PEIRFLLDGEAGLSTYLDRLLQRQGSAVVCVAEGAGQHFFDTPHRDRA  349


 Score = 37.7 bits (86),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  740  SSGFIAMHASLASGQIDACLIPRGAF  663
            +SGFIA+ AS+ASG +DACLIP   F
Sbjct  281  ASGFIALEASMASGIVDACLIPEIRF  306



>ref|XP_006357682.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=504

 Score =   105 bits (263),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGV-hiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            +S  S D SGN +L DVG+   +   +   K+ + L+++KYIDPTY++R   ++ASD + 
Sbjct  350  ESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVY  409

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG  N  + Y+P   +I     V    RMW R L+ST QP
Sbjct  410  CTLLAQSAVHGAMAGYTGFTVGPVNHRHAYIPFNRIIEKQNKVVITDRMWARLLSSTNQP  469

Query  198  DF  193
             F
Sbjct  470  SF  471


 Score = 47.4 bits (111),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++EH ++  G  V+ +AEGAGQ+L+ +S
Sbjct  309  PESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSES  351


 Score = 40.8 bits (94),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  287  RDSGFIAMYATLASRDVDCCLIPESPF  313



>ref|XP_001770890.1| predicted protein [Physcomitrella patens]
 gb|EDQ64220.1| predicted protein [Physcomitrella patens]
Length=499

 Score =   108 bits (271),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -2

Query  540  KDASGNPILSDVGVhi-qhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            KDASGN +L DVG+ +          +  + +++KYIDP Y++R   ++ASD + CT+L 
Sbjct  337  KDASGNKLLLDVGLWLCTILKDHFQAEFRETLNLKYIDPKYMIRAIPSNASDNVYCTLLA  396

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*Y  184
              A+HGA AG++G TVG  N  + Y+PI  V+A SR+V+   RMW R ++ST QP+FS Y
Sbjct  397  HGAIHGAMAGYSGFTVGPINNRHCYIPIKRVVAKSRNVNVADRMWARLMSSTNQPNFSRY  456

Query  183  RQ  178
             +
Sbjct  457  EE  458


 Score = 44.7 bits (104),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF L G  G+++ +   +   G  V+ VAEGAGQ+LM +S
Sbjct  287  PEVPFYLHGSGGLIEFVRKRLRESGHMVIVVAEGAGQELMAES  329


 Score = 40.4 bits (93),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SG+IAMHA+LAS  +D CLIP   F
Sbjct  265  RYSGYIAMHATLASRDVDCCLIPEVPF  291



>ref|XP_004243602.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Solanum 
lycopersicum]
Length=490

 Score =   105 bits (261),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGV-hiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            +S  S D SGN +L DVG+   +   +   K+ + L+++KYIDPTY++R   ++ASD + 
Sbjct  331  ESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVY  390

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG  N    Y+P   +I     V    RMW R L+ST QP
Sbjct  391  CTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEKQNKVVITDRMWARLLSSTNQP  450

Query  198  DF  193
             F
Sbjct  451  SF  452


 Score = 47.8 bits (112),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++EH ++  G  V+ +AEGAGQ+L+ +S
Sbjct  290  PESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSES  332


 Score = 40.8 bits (94),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  268  RDSGFIAMYATLASRDVDCCLIPESPF  294



>emb|CDY32873.1| BnaC09g33200D [Brassica napus]
Length=488

 Score =   103 bits (257),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             ++ DASGN +L DVG+ +   IK +FKKI  ++++KYIDPTY++R   ++ASD + CT+
Sbjct  331  ESNTDASGNKLLKDVGLWLSQSIKDYFKKINMVMNLKYIDPTYMIRAVPSNASDNVYCTL  390

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  391  LAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  449


 Score = 50.1 bits (118),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+L+ +E  I+  G  V+ +AEGAGQ+LM KS
Sbjct  287  PESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 2e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_005709060.1| 6-phosphofructokinase [Galdieria sulphuraria]
 gb|EME32540.1| 6-phosphofructokinase [Galdieria sulphuraria]
Length=334

 Score =   114 bits (285),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN  L D+G  +  +I+  FKK    V +KYIDPTY++R   ++ASD I CT+L  +
Sbjct  183  DASGNKKLGDIGHFLYQEIESTFKKQGIEVSMKYIDPTYMIRAVASNASDNIYCTLLAHS  242

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS  190
            AVHG+FAG+TG TVG  +  + Y+P+ E++ A + VD   RMW R + STGQPDFS
Sbjct  243  AVHGSFAGYTGFTVGPIHGRHAYIPMTEIVTAQKQVDLRDRMWSRLVNSTGQPDFS  298


 Score = 41.2 bits (95),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIA+HASL+S ++D CLIP   F
Sbjct  111  RNSGFIALHASLSSREVDCCLIPEVPF  137


 Score = 38.1 bits (87),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLME  554
            PEVPF + G  G+++++   +  +G  V+ VAEGAGQ+ + 
Sbjct  133  PEVPFVIHGRGGLIEYIHKCLIERGKMVLVVAEGAGQEYVR  173



>ref|XP_006451355.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64595.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=463

 Score =   107 bits (267),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S T +DASGN +L DVG+ +  +IK HF K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  293  RSATQQDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVY  352

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+ VHGA AG+TG T G+ N    Y+P   +I    HV    RMW R L+ST QP
Sbjct  353  CTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQP  412

Query  198  DF  193
             F
Sbjct  413  SF  414


 Score = 46.2 bits (108),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  249  PESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAES  291


 Score = 40.0 bits (92),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  227  RYSGFIAMYATLASRDVDCCLIPESPF  253



>gb|EPS60907.1| hypothetical protein M569_13894, partial [Genlisea aurea]
Length=284

 Score = 72.0 bits (175),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
             +   + DASGN +L D+GVH+  + KK FK+I    D KYIDPTY++R CRA+ASD I+
Sbjct  216  LEKTNANDASGNVVLGDIGVHLLKETKKFFKEIGSPADTKYIDPTYMIRACRANASDGIL  275

Query  378  CTVLGQNAV  352
            CTVLGQNAV
Sbjct  276  CTVLGQNAV  284


 Score = 71.6 bits (174),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVL HL++ +E KGSAV+C+AEGAGQDL+EK+N
Sbjct  177  PEVPFNLHGPNGVLNHLKYLLEQKGSAVICIAEGAGQDLLEKTN  220


 Score = 50.1 bits (118),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            RSSGFIAMHASLASGQID CLIP   F 
Sbjct  155  RSSGFIAMHASLASGQIDICLIPEVPFN  182



>ref|XP_004243600.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Solanum 
lycopersicum]
Length=509

 Score =   105 bits (261),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGV-hiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
            +S  S D SGN +L DVG+   +   +   K+ + L+++KYIDPTY++R   ++ASD + 
Sbjct  350  ESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVY  409

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG  N    Y+P   +I     V    RMW R L+ST QP
Sbjct  410  CTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEKQNKVVITDRMWARLLSSTNQP  469

Query  198  DF  193
             F
Sbjct  470  SF  471


 Score = 47.8 bits (112),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++EH ++  G  V+ +AEGAGQ+L+ +S
Sbjct  309  PESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSES  351


 Score = 40.8 bits (94),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  287  RDSGFIAMYATLASRDVDCCLIPESPF  313



>ref|XP_009120176.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Brassica rapa]
Length=488

 Score =   103 bits (257),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             ++ DASGN +L DVG+ +   IK +FKKI  ++++KYIDPTY++R   ++ASD + CT+
Sbjct  331  ESNTDASGNKLLKDVGLWLSQSIKDYFKKINMVMNLKYIDPTYMIRAVPSNASDNVYCTL  390

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  391  LAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  449


 Score = 50.1 bits (118),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+L+ +E  I+  G  V+ +AEGAGQ+LM KS
Sbjct  287  PESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKS  329


 Score = 40.0 bits (92),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010536840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Tarenaya hassleriana]
Length=474

 Score =   107 bits (268),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF   +  +++KYIDPTY++R   ++ASD + C
Sbjct  328  ESTTLKDASGNKLLKDVGLWLFQSIKDHFSAKKATINLKYIDPTYMIRAVPSNASDNVYC  387

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ N    Y+P   +      V    RMW R L+ST QP 
Sbjct  388  TLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPS  447

Query  195  F  193
            F
Sbjct  448  F  448


 Score = 45.4 bits (106),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQ+LM +S 
Sbjct  287  PESPFYLEGEGGLFEFVERRLKENGHMVIVIAEGAGQELMLEST  330


 Score = 40.0 bits (92),  Expect(3) = 3e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   105 bits (262),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T KDASGN +L DVG+ +   IK HF K + ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  333  TLKDASGNKLLKDVGLWLSQSIKVHFNKNKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  392

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  393  AQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITETQNNVVITDRMWARLLSSTNQPSF  450


 Score = 47.4 bits (111),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEFVERRLKENGHMVIVLAEGAGQDLMCKS  329


 Score = 40.0 bits (92),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_010539385.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=487

 Score =   107 bits (267),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L DVG+ +   IK HF K + ++++KYIDPTY++R   ++ASD + C
Sbjct  328  ESMTLKDASGNKLLKDVGLWLSQSIKDHFSKKKTVINLKYIDPTYMIRAVPSNASDNVYC  387

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ N  + Y+P   +      V    R W R L+ST QP 
Sbjct  388  TLLAQSAVHGAMAGYTGFTSGLVNGRHTYIPFYRITEKQNKVVITDRTWARLLSSTNQPS  447

Query  195  F  193
            F
Sbjct  448  F  448


 Score = 45.8 bits (107),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQ+LM +S
Sbjct  287  PESPFYLEGEGGLFEFIERRLKENGHMVIVIAEGAGQELMLES  329


 Score = 40.0 bits (92),  Expect(3) = 4e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_008447566.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=530

 Score =   100 bits (250),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLV-DVKYIDPTYILRGCRASASDAIMCTVL  367
             +DASGN +  DVG+ I  QIK  FK+  ++V ++KYIDPTY++R   + ASD I CT+L
Sbjct  375  QQDASGNKLHQDVGLWISQQIKDFFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCTLL  434

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+A+HGA AG+TG TVG  N  + Y+P   +I     V    RMW R L+ST QP F
Sbjct  435  AQSAIHGAMAGYTGFTVGPVNGRHAYIPFHRIIERQNKVVITDRMWARLLSSTNQPSF  492


 Score = 50.8 bits (120),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++EH I+  G  V+ +AEGAGQ+LM +S
Sbjct  327  PESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSES  369


 Score = 40.8 bits (94),  Expect(3) = 6e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  305  RNSGFIAMYATLASRDVDCCLIPESPF  331



>ref|XP_010545328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=490

 Score =   103 bits (258),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S   +DASGN +L DVG+ I   IK HF + +  +++KYIDPTY++R    +ASD + C
Sbjct  328  ESSNLEDASGNKLLKDVGLWISQSIKDHFSRKKTTINLKYIDPTYMIRAVPGNASDNVYC  387

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ N    Y+P   +      V    RMW R L+ST QP 
Sbjct  388  TLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPS  447

Query  195  F  193
            F
Sbjct  448  F  448


 Score = 48.1 bits (113),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDL-MEKSNFE  539
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQ+L ME SN E
Sbjct  287  PESPFYLEGEGGLFEFIERRLKENGHMVIVIAEGAGQELMMESSNLE  333


 Score = 40.0 bits (92),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>gb|EYU20177.1| hypothetical protein MIMGU_mgv1a004503mg [Erythranthe guttata]
Length=523

 Score =   111 bits (277),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTVL  367
             KDASGN +L DVG+ +  + K HF K+ ++ +++KYIDPTY++R   ++ASD I CT+L
Sbjct  396  EKDASGNKLLLDVGLWLTQKFKDHFTKVRKMGINMKYIDPTYMIRAVPSNASDNIYCTLL  455

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AGFTG TVG  N+ + Y+PI  V  A   V    RMW R L ST QP F
Sbjct  456  AQSAVHGAMAGFTGFTVGPVNSRHAYIPISRVTEAQNTVKLTDRMWARLLASTNQPSF  513


 Score = 42.4 bits (98),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LAS  +D CLIP   F
Sbjct  326  RYSGFIAMHATLASRDVDCCLIPESPF  352


 Score = 38.5 bits (88),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++     V+ +AEGAGQ+ + +S
Sbjct  348  PESPFYLEGQGGLFEFIEERLKENSHIVIVLAEGAGQEYVAQS  390



>ref|XP_004149188.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 7-like 
[Cucumis sativus]
Length=512

 Score =   100 bits (248),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  543  SKDASGNPILSDVG--VhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
             +DASGN +  DVG  +  Q +     KK + ++++KYIDPTY++R   + ASD I CT+
Sbjct  356  QQDASGNKLHQDVGLWISQQIKDYFKEKKEKMVINLKYIDPTYMIRAVPSIASDNIFCTL  415

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+A+HGA AG+TG TVG  N  + Y+P   +      V    RMW R L+ST QP F
Sbjct  416  LAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  474


 Score = 50.8 bits (120),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++EH I+  G  V+ +AEGAGQ+LM +S
Sbjct  308  PESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSES  350


 Score = 40.8 bits (94),  Expect(3) = 9e-34, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  286  RNSGFIAMYATLASRDVDCCLIPESPF  312



>ref|XP_001780597.1| predicted protein [Physcomitrella patens]
 gb|EDQ54580.1| predicted protein [Physcomitrella patens]
Length=481

 Score =   105 bits (262),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = -2

Query  537  DASGNPILSDVGVhi-qhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQ  361
            DASGN +L DVG+ +  H  +   K   + +++KYIDPTY++R   ++ASD + CT+L  
Sbjct  331  DASGNKLLLDVGLWLCNHLKEHFLKAFREPLNLKYIDPTYMIRAIPSNASDNVYCTLLAH  390

Query  360  NAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*YR  181
            +A+HGA AG+ G TVG  N  + Y+PI  V+A SR V+   RMW R ++ST QP+F+ Y 
Sbjct  391  SAIHGAMAGYCGFTVGPVNVRHCYIPIARVVATSRRVNVADRMWARLMSSTNQPNFAQYS  450

Query  180  QS-QCYKTKNCYNKND  136
             + Q  + +N   + +
Sbjct  451  HAIQQSRKQNATKRRE  466


 Score = 46.6 bits (109),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PEVPF L G  G+++ + H +   G  V+ VAEGAGQ+LM ++
Sbjct  280  PEVPFYLHGPGGLIEFVHHRLRENGHMVIVVAEGAGQELMAET  322


 Score = 39.7 bits (91),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SG+IAMHA+LAS  +D CLIP   F
Sbjct  258  RYSGYIAMHATLASRDVDLCLIPEVPF  284



>ref|XP_004158491.1| PREDICTED: 6-phosphofructokinase 3-like [Cucumis sativus]
Length=511

 Score = 99.8 bits (247),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLV-DVKYIDPTYILRGCRASASDAIMCTVL  367
             +DASGN +  DVG+ I  QIK +FK+  ++V ++KYIDPTY++R   + ASD I CT+L
Sbjct  356  QQDASGNKLHQDVGLWISQQIKDYFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCTLL  415

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+A+HGA AG+TG TVG  N  + Y+P   +      V    RMW R L+ST QP F
Sbjct  416  AQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  473


 Score = 50.8 bits (120),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++EH I+  G  V+ +AEGAGQ+LM +S
Sbjct  308  PESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSES  350


 Score = 40.8 bits (94),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  286  RNSGFIAMYATLASRDVDCCLIPESPF  312



>ref|XP_006293955.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
 gb|EOA26853.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
Length=496

 Score = 73.6 bits (179),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF L G NGVLKHL++ IETKGSAV+CVAEGAGQ+ +EK+N
Sbjct  378  PEVPFHLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNFLEKTN  421


 Score = 72.4 bits (176),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
             +KDASGN +L D GV+IQ + KK+FK+    +DVKYIDPTY++R  RA+ASD I+CTVL
Sbjct  421  NAKDASGNTVLGDFGVYIQQETKKYFKEKSIPIDVKYIDPTYMIRAVRANASDGILCTVL  480

Query  366  GQNAV  352
            GQNAV
Sbjct  481  GQNAV  485


 Score = 45.4 bits (106),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SGFIAM ASLASGQ+D CLIP   F 
Sbjct  356  RNSGFIAMQASLASGQVDICLIPEVPFH  383



>gb|KGN58020.1| hypothetical protein Csa_3G435010 [Cucumis sativus]
Length=529

 Score = 99.8 bits (247),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLV-DVKYIDPTYILRGCRASASDAIMCTVL  367
             +DASGN +  DVG+ I  QIK +FK+  ++V ++KYIDPTY++R   + ASD I CT+L
Sbjct  374  QQDASGNKLHQDVGLWISQQIKDYFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCTLL  433

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+A+HGA AG+TG TVG  N  + Y+P   +      V    RMW R L+ST QP F
Sbjct  434  AQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  491


 Score = 50.8 bits (120),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++EH I+  G  V+ +AEGAGQ+LM +S
Sbjct  326  PESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSES  368


 Score = 40.8 bits (94),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  304  RNSGFIAMYATLASRDVDCCLIPESPF  330



>ref|XP_009395732.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Musa acuminata subsp. malaccensis]
Length=522

 Score =   106 bits (264),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S   +DASGN +L DVG+ +  +IK +F   +++ +++KYIDPTY++R   ++ASD + 
Sbjct  384  RSMGHEDASGNKLLLDVGLWLSQKIKNYFTSRQRMTINLKYIDPTYMIRAIPSNASDNVY  443

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L QNAVHGA AG+TG T+G+ N  + Y+P   V      V    RMW R L+ST QP
Sbjct  444  CTLLAQNAVHGAMAGYTGFTIGVVNGRHTYIPFYRVTEKRNKVIITDRMWARLLSSTNQP  503

Query  198  DF  193
             F
Sbjct  504  SF  505


 Score = 45.1 bits (105),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ VAEGAGQ+L+  S
Sbjct  340  PESPFYLEGRGGLFEYIEKRLKDNGHMVIVVAEGAGQELIADS  382


 Score = 39.7 bits (91),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  318  RFSGFIAMYATLASRDVDCCLIPESPF  344



>gb|KDO55889.1| hypothetical protein CISIN_1g0098041mg, partial [Citrus sinensis]
Length=233

 Score =   108 bits (271),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S T +DASGN +L DVG+ +  +IK HF K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  63   RSATQQDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVY  122

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+ VHGA AG+TG T G+ N    Y+P   +I    HV    RMW R L+ST QP
Sbjct  123  CTLLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQP  182

Query  198  DF  193
             F
Sbjct  183  SF  184


 Score = 46.2 bits (108),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  19   PESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAES  61


 Score = 35.4 bits (80),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -3

Query  731  FIAMHASLASGQIDACLIPRGAF  663
            FIAM+A+LAS  +D CLIP   F
Sbjct  1    FIAMYATLASRDVDCCLIPESPF  23



>dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=488

 Score =   103 bits (258),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T  DASGN +L DVG+ +   IK HFKK + ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  336  TPMDASGNKLLKDVGLWLSQSIKDHFKKNKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  395

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  396  AQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQNNVVITDRMWARLLSSTNQPSF  453


 Score = 47.8 bits (112),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  290  PESPFYLEGEGGLFEFIERRLKDHGHMVIVLAEGAGQDLMCKS  332


 Score = 38.9 bits (89),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SG+IAM+A+LAS  +D CLIP   F
Sbjct  268  RYSGYIAMYATLASRDVDCCLIPESPF  294



>ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
 sp|Q9C5J7.1|PFKA7_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 7; Short=ATP-PFK 
7; Short=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 
7 [Arabidopsis thaliana]
 gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
Length=485

 Score =   103 bits (258),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVL  367
            T  DASGN +L DVG+ +   IK HFKK + ++++KYIDPTY++R   ++ASD + CT+L
Sbjct  333  TPMDASGNKLLKDVGLWLSQSIKDHFKKNKMVMNLKYIDPTYMIRAVPSNASDNVYCTLL  392

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG T G+ N    Y+P   +     +V    RMW R L+ST QP F
Sbjct  393  AQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQNNVVITDRMWARLLSSTNQPSF  450


 Score = 47.8 bits (112),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ + +E  ++  G  V+ +AEGAGQDLM KS
Sbjct  287  PESPFYLEGEGGLFEFIERRLKDHGHMVIVLAEGAGQDLMCKS  329


 Score = 38.9 bits (89),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SG+IAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGYIAMYATLASRDVDCCLIPESPF  291



>ref|XP_011401490.1| 6-phosphofructokinase 5, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28475.1| 6-phosphofructokinase 5, chloroplastic [Auxenochlorella protothecoides]
Length=486

 Score =   116 bits (291),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DA+GNP+LSDVG  ++ + K HF+      D+KYIDP+ ++R   AS+ D I C +LG  
Sbjct  365  DAAGNPVLSDVGPWLKAKFKAHFQD----ADIKYIDPSCLIRSIPASSQDRIYCRMLGHG  420

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            AVH AFAG+TG+TVG+ NTHY Y+PIP VI A R VDP+  +W R  ++ GQP F
Sbjct  421  AVHAAFAGYTGVTVGLINTHYCYIPIPMVIQAPRTVDPHGELWARLRSAIGQPSF  475


 Score = 53.5 bits (127),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFERCIWESN  518
            PEVPF+L+GE G+L ++E  +   G AV+CVAE A QDLM      R     N
Sbjct  317  PEVPFRLEGEKGLLAYVEKIMARDGHAVICVAEAAAQDLMHGEGPRRLDAAGN  369



>ref|XP_007152950.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
 gb|ESW24944.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
Length=531

 Score =   105 bits (263),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S +++DASGN +L DVG+ I  +IK HF + + L + +KYIDPTY++R   ++ASD + 
Sbjct  371  QSMSTQDASGNKLLQDVGLWISQKIKDHFAEQKTLPITLKYIDPTYMIRAVPSNASDNVY  430

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG T G+ N    Y+P   +     HV    RMW R L+ST QP
Sbjct  431  CTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQP  490

Query  198  DF  193
             F
Sbjct  491  SF  492


 Score = 43.5 bits (101),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQ+L+ +S
Sbjct  327  PESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELVSES  369


 Score = 41.2 bits (95),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  305  RNSGFIAMYATLASRDVDCCLIPESPF  331



>ref|XP_002511010.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF51612.1| phosphofructokinase, putative [Ricinus communis]
Length=522

 Score =   109 bits (272),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            ++   +DASGN +L DVG+ +   IK+HF  I+++ V++KYIDPTY++R   ++ASD I 
Sbjct  373  QASEERDASGNRLLLDVGLWLSQNIKEHFTNIQKMAVNMKYIDPTYMIRAVPSNASDNIY  432

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG  N+ + Y+PI  V  A+  V    RMW R L ST QP
Sbjct  433  CTLLAQSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEATNTVKVTDRMWARLLASTNQP  492

Query  198  DF  193
             F
Sbjct  493  SF  494


 Score = 42.7 bits (99),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQ+ + +S
Sbjct  329  PESPFYLEGPGGLFEYIEQRLKENGHLVIVIAEGAGQEYVAQS  371


 Score = 38.5 bits (88),  Expect(3) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM A+LAS  +D CLIP   F
Sbjct  307  RYSGFIAMFATLASRDVDCCLIPESPF  333



>ref|XP_010546132.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010546133.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=532

 Score =   109 bits (272),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAI  382
             ++   KD SGN +L DVG+ +  QIK HF    ++ +++KYIDPTY++R   ++ASD I
Sbjct  383  MRATEEKDESGNRLLLDVGLWLTQQIKDHFANARKMAINMKYIDPTYMIRAVPSNASDNI  442

Query  381  MCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQ  202
             CT+L Q+AVHGA AGFTG TVG  N+ + Y+PI +V   +  V    RMW R L ST Q
Sbjct  443  YCTLLAQSAVHGAMAGFTGFTVGPVNSRHAYIPISQVTETTNKVKLTDRMWARLLASTNQ  502

Query  201  PDF  193
            P F
Sbjct  503  PSF  505


 Score = 42.4 bits (98),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G++G+ + +   ++  G  V+ +AEGAGQD + +S
Sbjct  340  PESPFFLEGKDGLFEFISQRLKENGHMVIVIAEGAGQDYVAQS  382


 Score = 38.5 bits (88),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM A+LAS  +D CLIP   F
Sbjct  318  RYSGFIAMFATLASRDVDCCLIPESPF  344



>ref|XP_002182086.1| pyrophosphate-dependent phosphofructose kinase [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|EEC46626.1| pyrophosphate-dependent phosphofructose kinase [Phaeodactylum 
tricornutum CCAP 1055/1]
Length=564

 Score =   107 bits (267),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DASGN  L  +G  ++  +   F K   +  VKYIDP+Y +R   A+A+D++ C  L QN
Sbjct  429  DASGNKKLPAIGEFMKQAVTDFFAKHGDVATVKYIDPSYTVRSVPANAADSLYCMQLAQN  488

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAAS-RHVDPNSRMWHRCLTSTGQPD  196
            AVHGA AGFTG +VG+CN   ++LPIPE++A S R ++P  R W R L  T QP+
Sbjct  489  AVHGAMAGFTGFSVGLCNNRMVWLPIPELVATSPRSMNPRGRTWERVLALTRQPN  543


 Score = 45.4 bits (106),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PEVP  L+G NG L HL   ++ +G AVV VAEGAG++++
Sbjct  383  PEVPTVLEGPNGCLPHLMRRVKQQGYAVVVVAEGAGEEVL  422


 Score = 37.4 bits (85),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RS+GFIA HA++AS  +D CL+P 
Sbjct  361  RSAGFIAAHATMASSDVDLCLVPE  384



>ref|XP_010049141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW81625.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=510

 Score =   106 bits (265),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTV  370
              +DASGN +L DVG+ I H+I+ HF + +++ + +KYIDPTY++R   ++ASD + CT+
Sbjct  335  NQQDASGNRLLQDVGLWISHKIRDHFARQQKMGITLKYIDPTYMIRAVPSNASDNVNCTL  394

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AGFTG TVG+ NT + Y+P   V      V    RMW R L+ST QP F
Sbjct  395  LAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTERQNKVVITDRMWARLLSSTNQPSF  453


 Score = 43.9 bits (102),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  289  PESPFFLEGKGGLYEFIEKRLKENGHMVIVIAEGAGQDLVAES  331


 Score = 39.7 bits (91),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  267  RYSGFIAMYATLASRDVDCCLIPESPF  293



>ref|XP_010049142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW81626.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=492

 Score =   106 bits (265),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTV  370
              +DASGN +L DVG+ I H+I+ HF + +++ + +KYIDPTY++R   ++ASD + CT+
Sbjct  335  NQQDASGNRLLQDVGLWISHKIRDHFARQQKMGITLKYIDPTYMIRAVPSNASDNVNCTL  394

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AGFTG TVG+ NT + Y+P   V      V    RMW R L+ST QP F
Sbjct  395  LAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTERQNKVVITDRMWARLLSSTNQPSF  453


 Score = 43.9 bits (102),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  289  PESPFFLEGKGGLYEFIEKRLKENGHMVIVIAEGAGQDLVAES  331


 Score = 39.7 bits (91),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  267  RYSGFIAMYATLASRDVDCCLIPESPF  293



>gb|KDP33769.1| hypothetical protein JCGZ_07340 [Jatropha curcas]
Length=558

 Score =   103 bits (257),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTV  370
            T +DASGN +L DVG+ I  +IK  F K  ++ +++KYIDPTY++R   ++ASD + CT+
Sbjct  394  TQQDASGNKLLQDVGLWISQKIKDFFAKKRKMTINLKYIDPTYMIRAVPSNASDNVYCTL  453

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N    Y+P   +      V    RMW R L+ST QP F
Sbjct  454  LAQSAVHGAMAGYTGFTSGLVNGRQTYIPFHRITEKQNKVVITDRMWARLLSSTNQPSF  512


 Score = 44.3 bits (103),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQ+L+ ++
Sbjct  348  PESPFYLEGEGGLFEYIEKCLKENGHMVIVIAEGAGQELLTET  390


 Score = 42.4 bits (98),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LAS  +D CLIP   F
Sbjct  326  RYSGFIAMHATLASRDVDCCLIPESPF  352



>ref|XP_009362710.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Pyrus x bretschneideri]
Length=536

 Score =   109 bits (272),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 75/124 (60%), Gaps = 1/124 (1%)
 Frame = -2

Query  540  KDASGNPILSDVGV-hiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
            KDASGN +L DVG+   Q       K  +  +++KYIDPTY++R   ++ASD I CT+L 
Sbjct  396  KDASGNKLLLDVGLWLTQKIKDHFTKVKKTAINMKYIDPTYMIRAIPSNASDNIYCTLLA  455

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*Y  184
            Q+AVHGA AGF+G TVG  N+ + Y+PI  V      V    RMW R L ST QP F  Y
Sbjct  456  QSAVHGAMAGFSGFTVGPVNSRHAYIPIARVTETQNTVKLTDRMWARLLASTNQPSFLEY  515

Query  183  RQSQ  172
             + Q
Sbjct  516  SEGQ  519


 Score = 40.8 bits (94),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIA+HA+LAS  +D CLIP   F
Sbjct  325  RYSGFIALHATLASRDVDCCLIPESPF  351


 Score = 39.7 bits (91),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLM  557
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQ+ +
Sbjct  347  PESPFYLEGQGGLFEFVEERLKENGHVVIVLAEGAGQEYI  386



>gb|KDP22466.1| hypothetical protein JCGZ_26297 [Jatropha curcas]
Length=530

 Score =   107 bits (267),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTVL  367
             KDASGN +L DVG+ +  +IK HF  + ++ V++KYIDPTY++R   ++ASD I CT+L
Sbjct  390  EKDASGNKLLLDVGLWLSQKIKDHFVNVRKMEVNMKYIDPTYMIRAIPSNASDNIYCTLL  449

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
              +AVHGA AG+TG TVG  N+ + Y+PI  V  A+  V    RMW R L ST QP F
Sbjct  450  AHSAVHGAMAGYTGFTVGPVNSRHAYIPISRVTEATNTVKLTDRMWARLLASTNQPSF  507


 Score = 44.7 bits (104),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PF L+G +G+ +++E  ++  G  V+ VAEGAGQD + +S 
Sbjct  342  PESPFYLEGPDGLFEYIELRLKENGHLVIVVAEGAGQDYVAQST  385


 Score = 38.1 bits (87),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R  GFIA HA+LAS  +D CLIP   F
Sbjct  320  RYCGFIATHATLASRDVDCCLIPESPF  346



>gb|AIE47276.1| phosphofructokinase [Hevea brasiliensis]
Length=563

 Score =   102 bits (254),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTV  370
            T +DASGN +L DVG+ I  +IK +F K +++ +++KYIDPTY++R   ++ASD + CT+
Sbjct  399  TQQDASGNKLLQDVGLWISQRIKDYFSKQKKMTINLKYIDPTYMIRAIPSNASDNVYCTL  458

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+ +HGA AG+TG T G+ N    Y+P   +I     V    RMW R L+ST QP F
Sbjct  459  LAQSVLHGAMAGYTGFTSGLVNGRQTYIPFYRIIEKQNKVVITDRMWARLLSSTNQPSF  517


 Score = 45.8 bits (107),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+  ++E  ++  G  V+ +AEGAGQ+L+ ++
Sbjct  353  PESPFYLEGEGGLFDYIEKRLKENGHMVIVIAEGAGQELLSQT  395


 Score = 41.2 bits (95),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  331  RNSGFIAMYATLASRDVDCCLIPESPF  357



>ref|XP_009132191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=485

 Score =   101 bits (252),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++ T +DASGN +L DVG+ +   IK HFKKI+ ++++KYIDPTY++R   ++A+D + C
Sbjct  326  ETNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMVMNLKYIDPTYMIRAIPSNAADNVYC  385

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ +    Y+P   +      V    RMW R L+ST QP 
Sbjct  386  TLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQNSVVITDRMWARLLSSTNQPS  445

Query  195  F  193
            F
Sbjct  446  F  446


 Score = 47.4 bits (111),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQ++M KS
Sbjct  282  PESPFYLEGEGGLFEYIEKRLKEHGHMVIVLAEGAGQEMMTKS  324


 Score = 40.4 bits (93),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  260  RHSGFIAMYATLASRDVDCCLIPESPF  286



>ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN10174.1| 6-phosphofructokinase 3 [Glycine soja]
Length=509

 Score =   105 bits (261),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTVL  367
             KDASGN +L DVG+ I H+IK HF + +++ +++KYIDPTY++R  +++ASD + CT+L
Sbjct  336  QKDASGNKLLQDVGLWISHKIKDHFARKDKIPINLKYIDPTYMIRAIQSNASDNVYCTLL  395

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHGA AG+TG TVG+ N  + Y+P   +      V    RMW R L+ST QP F
Sbjct  396  AQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRINERQNKVVITDRMWARLLSSTNQPSF  453


 Score = 44.3 bits (103),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + ++  ++  G  V+ +AEGAGQDL+ +S
Sbjct  288  PESPFYLEGKGGLFEFIQKRLKENGHMVIVIAEGAGQDLLTES  330


 Score = 40.0 bits (92),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  266  RYSGFIAMYATLASRDVDCCLIPESPF  292



>emb|CDY11911.1| BnaC03g13370D [Brassica napus]
Length=478

 Score =   101 bits (252),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            ++ T +DASGN +L DVG+ +   IK HFKKI+ ++++KYIDPTY++R   ++A+D + C
Sbjct  326  ETNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMVMNLKYIDPTYMIRAIPSNAADNVYC  385

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG T G+ +    Y+P   +      V    RMW R L+ST QP 
Sbjct  386  TLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQNSVVITDRMWARLLSSTNQPS  445

Query  195  F  193
            F
Sbjct  446  F  446


 Score = 47.4 bits (111),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQ++M KS
Sbjct  282  PESPFYLEGEGGLFEYIEKRLKEHGHMVIVLAEGAGQEMMTKS  324


 Score = 40.4 bits (93),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  260  RHSGFIAMYATLASRDVDCCLIPESPF  286



>ref|XP_009387228.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   103 bits (256),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLV-DVKYIDPTYILRGCRASASDAI  382
             +S   +DASGN +L DVG+ +  +IK +F   +++V ++KYIDPTY++R   ++ASD +
Sbjct  385  MRSMNHEDASGNKLLLDVGLWLSQRIKNYFTSRQKMVINLKYIDPTYMIRAIPSNASDNV  444

Query  381  MCTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQ  202
             CT+L Q AVHGA AG+TG TVG+ N  + Y+P   V      V    RMW R L+ST Q
Sbjct  445  YCTLLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFDRVTETRNTVVITDRMWARLLSSTNQ  504

Query  201  PDF  193
            P F
Sbjct  505  PSF  507


 Score = 47.4 bits (111),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ +++E  ++  G  V+ VAEGAGQDL+ +S
Sbjct  342  PESPFYLEGKGGLFEYMEKQLKENGHMVIVVAEGAGQDLIAES  384


 Score = 38.9 bits (89),  Expect(3) = 5e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGF+AM+A+LAS  +D CLIP   F
Sbjct  320  RYSGFLAMYATLASRDVDCCLIPESPF  346



>ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN18140.1| 6-phosphofructokinase 3 [Glycine soja]
Length=507

 Score =   103 bits (257),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 94/164 (57%), Gaps = 8/164 (5%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTVL  367
             KDASGN +L DVG+ I H+IK HF + +++ +++KYIDPTY++R   ++ASD + CT+L
Sbjct  336  QKDASGNKLLQDVGLWISHKIKDHFARKDKMPINLKYIDPTYMIRAIPSNASDNVYCTLL  395

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDFS*  187
             Q+AVHGA AG+TG TVG+ N    Y+P   +      V    RMW R L+ST QP F  
Sbjct  396  AQSAVHGAMAGYTGFTVGLVNGRQTYIPFIRINERQNKVVITDRMWARLLSSTNQPSFLS  455

Query  186  YRQSQCYKTKNC----YNKNDCMK*GCFSREY---FRIMSGNHT  76
             +  +  K          +N+C   G   +E        SGNHT
Sbjct  456  PKDLEEAKKAESPTQLLEENNCNDVGDAEKEQPPKDEQESGNHT  499


 Score = 45.4 bits (106),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  288  PESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQDLLTES  330


 Score = 40.0 bits (92),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  266  RYSGFIAMYATLASRDVDCCLIPESPF  292



>gb|EYU30678.1| hypothetical protein MIMGU_mgv1a005513mg [Erythranthe guttata]
Length=481

 Score =   107 bits (266),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S   KDASGN +L DVG+ I  +IK HF K  ++ +++KYIDPTY++R   +SASD + 
Sbjct  328  ESLNQKDASGNKLLQDVGLWISQKIKDHFSKERKMTINLKYIDPTYMIRAIPSSASDNVY  387

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG  N  Y Y+P   +      V    RMW R L+ST QP
Sbjct  388  CTLLAQSAVHGAMAGYTGFTVGPVNGRYAYIPFHRINERQNKVVITDRMWARLLSSTSQP  447

Query  198  DF  193
             F
Sbjct  448  SF  449


 Score = 42.7 bits (99),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQ+++ +S
Sbjct  287  PESPFYLEGRGGLFEYIEKRLKEFGHMVIVIAEGAGQEMLSES  329


 Score = 38.9 bits (89),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A++AS  +D CLIP   F
Sbjct  265  RYSGFIAMYATIASRDVDCCLIPESPF  291



>ref|XP_010690141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   107 bits (266),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLG  364
             KDASGN +L DVG+ I  +IK +FK+ E ++++KYIDPTY++R   A+ASD + CT+L 
Sbjct  340  EKDASGNKLLQDVGLWISQKIKDYFKQQEWVINLKYIDPTYMIRAIPANASDNVYCTLLA  399

Query  363  QNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             +A+HGA AG+TG TVG  N+ + Y+P   +      V    RMW R L+ST QP F
Sbjct  400  HSAIHGAMAGYTGFTVGPVNSRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  456


 Score = 42.7 bits (99),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQ+L+ +
Sbjct  292  PESPFYLEGPGGLFEYMEKRLKENGHMVIVIAEGAGQNLLSE  333


 Score = 39.3 bits (90),  Expect(3) = 6e-33, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIA++A+LAS  +D CLIP   F
Sbjct  270  RDSGFIALYATLASRDVDCCLIPESPF  296



>ref|XP_002514189.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF48143.1| phosphofructokinase, putative [Ricinus communis]
Length=632

 Score =   103 bits (256),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +  T +DASGN +L DVG++I  +IK  F K +++ +++KYIDPTY++R   ++ASD + 
Sbjct  387  QQSTLQDASGNKLLQDVGLYISQRIKDFFSKQKKMPINLKYIDPTYMIRAIPSNASDNVY  446

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG T G+ N    Y+P   +  +   V    RMW R L+ST QP
Sbjct  447  CTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITESQNKVVITDRMWARLLSSTNQP  506

Query  198  DF  193
             F
Sbjct  507  SF  508


 Score = 45.4 bits (106),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQ+L+ + +
Sbjct  346  PESPFYLEGEGGLFEYIEKRLKENGHMVIVIAEGAGQELLSQQS  389


 Score = 40.0 bits (92),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  324  RYSGFIAMYATLASRDVDCCLIPESPF  350



>ref|XP_005536329.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM80043.1| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Cyanidioschyzon 
merolae strain 10D]
Length=475

 Score =   110 bits (274),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            + +   DASGN  + +VG+ +  +I   F      V++K++DPTY +R   A A+D IMC
Sbjct  351  EEKKEVDASGNIKMQNVGLWLAERINSWFSLRGIEVNLKFLDPTYEIRSVPAVATDNIMC  410

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRH-VDPNSRMWHRCLTSTGQP  199
            T+L Q+AVHGA AGFTG T G  NTH++ +P+ E+I+  R+ VD +SRMWHR L +T QP
Sbjct  411  TLLAQSAVHGAMAGFTGFTCGTVNTHHVMIPMKEIISRGRNRVDLSSRMWHRVLAATMQP  470


 Score = 40.8 bits (94),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNFER  536
            PE+ F LDG +G+L H+E+ +  K   V+ +AEGAG    + +  E+
Sbjct  307  PEIDFDLDGPHGLLVHIENLLRHKKYCVIVIAEGAGLQYTQNAQEEK  353


 Score = 38.1 bits (87),  Expect(3) = 7e-33, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R+SG+I+M A+LA+G +D CLIP   F 
Sbjct  285  RNSGYISMMATLAAGDVDVCLIPEIDFD  312



>ref|XP_010526423.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Tarenaya 
hassleriana]
Length=489

 Score =   105 bits (262),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 1/121 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMC  376
            +S T KDASGN +L D+G+ I  +IK HF K    + +KYIDPTY++R   ++ASD + C
Sbjct  331  QSMTLKDASGNKLLQDIGLWISQRIKDHFAKKMT-ISLKYIDPTYMIRAIPSNASDNVYC  389

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG TVG+ N  + Y+P   +      V    RMW R L+ST QP 
Sbjct  390  TLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFDRITEKQNKVVITDRMWARLLSSTHQPS  449

Query  195  F  193
            F
Sbjct  450  F  450


 Score = 43.5 bits (101),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQ+L+ +S
Sbjct  287  PESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQELLSES  329


 Score = 39.7 bits (91),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>ref|XP_011458966.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   102 bits (254),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S   +DASGN +L DVG+ I  +IK HF    +L V++KYIDPTY++R   ++A+D + 
Sbjct  331  QSMNQQDASGNKLLKDVGLWISQRIKDHFAHQHKLSVNLKYIDPTYMIRAIPSNAADNVY  390

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AGFTG  VG  N  + Y+P   +      V    RMW R L+ST QP
Sbjct  391  CTLLAQSAVHGAMAGFTGFVVGPVNGRHSYIPFNHITERQNKVVITDRMWARLLSSTNQP  450

Query  198  DF  193
             F
Sbjct  451  SF  452


 Score = 46.6 bits (109),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ + +E  ++  G  V+ +AEGAGQDL+E+S
Sbjct  287  PESPFFLEGRGGLFEFIEKRLKENGHMVIVIAEGAGQDLLEES  329


 Score = 39.7 bits (91),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  265  RYSGFIAMYATLASRDVDCCLIPESPF  291



>gb|AIE47275.1| phosphofructokinase [Hevea brasiliensis]
Length=551

 Score =   100 bits (250),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -2

Query  546  TSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTV  370
              +DASGN +L D+G+ I H+IK+HF K +++ +++KYIDPTY++R   ++ASD + CT+
Sbjct  387  NQQDASGNKLLRDIGLWISHRIKEHFSKQKKMTINLKYIDPTYMIRAIPSNASDNVYCTL  446

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N    Y+P   +      V    RMW R L+ST QP F
Sbjct  447  LAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  505


 Score = 45.4 bits (106),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+GE G+ +++E  ++  G  V+ +AEGAGQ+L+ ++
Sbjct  341  PESPFYLEGEGGLFEYIEKRLKEDGHMVIVIAEGAGQELLSET  383


 Score = 42.4 bits (98),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LAS  +D CLIP   F
Sbjct  319  RYSGFIAMHATLASRDVDCCLIPESPF  345



>ref|XP_007137260.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
 gb|ESW09254.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
Length=339

 Score =   102 bits (255),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  543  SKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMCTVL  367
             KDASGN +L DVG+ I H+IK HF + +++ +++KYIDPTY++R   ++ASD + CT+L
Sbjct  157  QKDASGNKLLQDVGLWISHKIKDHFARKDKIAINLKYIDPTYMIRAIPSNASDNVNCTLL  216

Query  366  GQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
             Q+AVHG  AG++G TVG+ N  + Y+P   +      V    RMW R L+ST QP F
Sbjct  217  AQSAVHGVMAGYSGFTVGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSF  274


 Score = 45.8 bits (107),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G+ G+ + +E  ++  G  V+ +AEGAGQDL+ +S
Sbjct  109  PESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQDLLTES  151


 Score = 40.0 bits (92),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  87   RYSGFIAMYATLASRDVDCCLIPESPF  113



>ref|XP_008354543.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=447

 Score =   106 bits (265),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMC  376
            S T +DASGN +L DVG+ I  +IK HFK+  ++ +++KYIDPTY++R   ++ASD + C
Sbjct  288  SMTKQDASGNKLLQDVGLWISQKIKDHFKEGNKMSINLKYIDPTYMIRAVPSNASDNVYC  347

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG TVG  N  + Y+P   +I     V    RMW R L+ST QP 
Sbjct  348  TLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPS  407

Query  195  F  193
            F
Sbjct  408  F  408


 Score = 42.0 bits (97),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  +   G  V+ +AEGAGQ+L+ +S
Sbjct  243  PESPFYLEGPGGLFEYIEKRLIENGHMVIVMAEGAGQELLSES  285


 Score = 40.0 bits (92),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  221  RYSGFIAMYATLASRDVDCCLIPESPF  247



>ref|XP_010244403.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=547

 Score =   105 bits (262),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 12/155 (8%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            ++   KDASGN +L DVG+ I  +IK HF    ++ +++KYIDPTY++R   ++ASD + 
Sbjct  392  RNMDQKDASGNKLLPDVGLWISQRIKDHFSSRNKMSINLKYIDPTYMIRAIPSNASDNVY  451

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG+ N  + Y+P   V      V    RMW R L+ST QP
Sbjct  452  CTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRVTERQNKVVITDRMWARLLSSTTQP  511

Query  198  DFS*YRQ-----------SQCYKTKNCYNKNDCMK  127
             F   ++           +Q    +N +N +D  K
Sbjct  512  SFVRPKELISKKQEPEPPTQLLDGENSHNDSDTQK  546


 Score = 42.7 bits (99),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ ++LE  ++  G  V+ +AEGAG +L+ +S
Sbjct  348  PESPFYLEGPGGLFEYLEKRLKENGHMVIVIAEGAGLELLSQS  390


 Score = 40.0 bits (92),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  326  RYSGFIAMYATLASRDVDCCLIPESPF  352



>emb|CCA20233.1| unnamed protein product [Albugo laibachii Nc14]
Length=502

 Score = 95.5 bits (236),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = -2

Query  537  DASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTVLGQN  358
            DA GN  L  +G  ++ QIK +F K  + V VKYIDP+Y++R   A+A+D++ C +L QN
Sbjct  373  DAGGNKKLPAIGEFMRDQIKNYFVKQHKEVTVKYIDPSYMIRSVPANAADSLYCMILAQN  432

Query  357  AVHGAFAGFTGITVGICNTHYIYLPIPEVIAAS-RHVDPNSRMWHRCLTSTGQPD  196
            AVHGA AGFTG TVG+     +Y PI  +   S R +DP  R W R L  T QP+
Sbjct  433  AVHGAMAGFTGFTVGLSANRVVYFPIAAITQNSPRSMDPFGRTWERVLCLTRQPN  487


 Score = 51.6 bits (122),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSNF  542
            PEVP +L G  G ++HLE  +E KG AVV VAEGAG++L+  S+ 
Sbjct  327  PEVPIELSGPRGCIEHLERVVEEKGRAVVVVAEGAGEELLGTSSI  371


 Score = 41.2 bits (95),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPR  672
            RSSGFIA HA+L+SG +D CLIP 
Sbjct  305  RSSGFIAAHATLSSGDVDLCLIPE  328



>ref|WP_002706063.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
saccharophilum]
 gb|EIC00899.1| 6-phosphofructokinase [Treponema saccharophilum DSM 2985]
Length=453

 Score = 95.5 bits (236),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -2

Query  558  WKSRTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIM  379
             ++    DASGN  LSD+G++++ +I ++F K     ++KY+DP+Y +R    +A+D+I 
Sbjct  317  LQTTNETDASGNKKLSDIGIYLKDKINEYFDKKGIHTNLKYVDPSYQVRASVTTANDSIY  376

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            C  LG NAVH A AG T   VG+ +  Y+Y+PI E +     VDP   +W   L +TGQP
Sbjct  377  CERLGNNAVHAAMAGKTKCVVGLVHDKYVYIPITEAVRKRNTVDPEGSLWRDALDATGQP  436


 Score = 61.6 bits (148),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKSN  545
            PEVPF LDG NG L HLE  ++++G AVV VAEGAGQ+L++ +N
Sbjct  278  PEVPFDLDGPNGFLAHLEARLKSRGHAVVIVAEGAGQELLQTTN  321


 Score = 31.2 bits (69),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAFQ  660
            R SGFIA   +LAS + + CLIP   F 
Sbjct  256  RESGFIATATALASHETNFCLIPEVPFD  283



>ref|XP_009395050.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   105 bits (262),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            KS   +DASGN +L DVG+ +   IK +F   +++ +++KYIDPTY++R   ++ASD + 
Sbjct  390  KSMDHEDASGNKLLLDVGLWLSQGIKNYFTSRQKMTINLKYIDPTYMIRAIPSNASDNVY  449

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG+ N    Y+P   V      V    RMW R L+ST QP
Sbjct  450  CTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEKRNKVVITDRMWARLLSSTNQP  509

Query  198  DF  193
             F
Sbjct  510  SF  511


 Score = 43.1 bits (100),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE  F L+G+ G+ +++E  ++  G  V+ VAEGAGQDL+ +S
Sbjct  346  PESRFYLEGKGGLYEYIEKRLKENGHMVIVVAEGAGQDLIAES  388


 Score = 39.7 bits (91),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  324  RYSGFIAMYATLASRDVDCCLIPESRF  350



>ref|XP_009395051.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   105 bits (262),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            KS   +DASGN +L DVG+ +   IK +F   +++ +++KYIDPTY++R   ++ASD + 
Sbjct  390  KSMDHEDASGNKLLLDVGLWLSQGIKNYFTSRQKMTINLKYIDPTYMIRAIPSNASDNVY  449

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG TVG+ N    Y+P   V      V    RMW R L+ST QP
Sbjct  450  CTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEKRNKVVITDRMWARLLSSTNQP  509

Query  198  DF  193
             F
Sbjct  510  SF  511


 Score = 42.7 bits (99),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE  F L+G+ G+ +++E  ++  G  V+ VAEGAGQDL+ +S
Sbjct  346  PESRFYLEGKGGLYEYIEKRLKENGHMVIVVAEGAGQDLIAES  388


 Score = 39.7 bits (91),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  324  RYSGFIAMYATLASRDVDCCLIPESRF  350



>ref|XP_002309528.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
 gb|EEE93051.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
Length=466

 Score = 99.8 bits (247),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S   +DASGN +L DVG+ I H+I  HF +++++ + +KYIDPTY++R    +ASD + 
Sbjct  315  QSMNQQDASGNNLLQDVGLWISHKINDHFARVQKMAITLKYIDPTYMIRAVPGNASDNVY  374

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            C++L Q+AVHGA AG+TG TVG  N  + Y+P   +      V    RMW R L+ST QP
Sbjct  375  CSLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFERINERQNQVVITDRMWARLLSSTNQP  434

Query  198  DF  193
             F
Sbjct  435  SF  436


 Score = 46.2 bits (108),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEK  551
            PE PF L+G+ G+ + ++  I+  G  V+ VAEGAGQDL+ K
Sbjct  271  PESPFYLEGKGGLFEFIKRRIKENGHMVIVVAEGAGQDLLAK  312


 Score = 42.4 bits (98),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAMHA+LAS  +D CLIP   F
Sbjct  249  RHSGFIAMHATLASRDVDCCLIPESPF  275



>ref|XP_006583562.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
Length=434

 Score =   103 bits (257),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -2

Query  555  KSRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIM  379
            +S + +DASGN +  DVG+ I  +I+ HF   + L + +KYIDPTY++R   ++ASD + 
Sbjct  269  QSMSKQDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVY  328

Query  378  CTVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQP  199
            CT+L Q+AVHGA AG+TG T G+ N    Y+P   +     HV    RMW R L+ST QP
Sbjct  329  CTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQP  388

Query  198  DF  193
             F
Sbjct  389  SF  390


 Score = 43.5 bits (101),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++  G  V+ +AEGAGQ+L+ +S
Sbjct  225  PESPFYLEGTGGLYEYIEKRLKENGHMVIVIAEGAGQELVSES  267


 Score = 40.8 bits (94),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R+SGFIAM+A+LAS  +D CLIP   F
Sbjct  203  RNSGFIAMYATLASRDVDCCLIPESPF  229



>gb|KJB83095.1| hypothetical protein B456_013G229200 [Gossypium raimondii]
Length=476

 Score =   107 bits (267),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  549  RTSKDASGNPILSDVGVhiqhqikkhfkkieQLVDVKYIDPTYILRGCRASASDAIMCTV  370
            +++ DASGN +L DVG+ I   IK HF K +  +++KYIDPTY++R   ++ASD + CT+
Sbjct  334  QSTTDASGNKLLQDVGLWISQSIKDHFSKQKMPINLKYIDPTYMIRAVPSNASDNVYCTL  393

Query  369  LGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPDF  193
            L Q+AVHGA AG+TG T G+ N  + Y+P   +I     V    RMW R L+ST QP F
Sbjct  394  LAQSAVHGAMAGYTGFTSGLVNGRHTYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  452


 Score = 40.8 bits (94),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  ++     V+ +AEGAGQ+L+ +S
Sbjct  290  PESPFYLEGPGGLFEYIEKRLKEDEHMVIVIAEGAGQELLSQS  332


 Score = 39.7 bits (91),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  268  RYSGFIAMYATLASRDVDCCLIPESPF  294



>ref|XP_008387449.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
 ref|XP_008344002.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=538

 Score =   106 bits (264),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -2

Query  552  SRTSKDASGNPILSDVGVhiqhqikkhfkkieQL-VDVKYIDPTYILRGCRASASDAIMC  376
            S T +DASGN +L DVG+ I  +IK HFK+  ++ +++KYIDPTY++R   ++ASD + C
Sbjct  379  SMTKQDASGNKLLQDVGLWISQKIKDHFKEGNKMSINLKYIDPTYMIRAVPSNASDNVYC  438

Query  375  TVLGQNAVHGAFAGFTGITVGICNTHYIYLPIPEVIAASRHVDPNSRMWHRCLTSTGQPD  196
            T+L Q+AVHGA AG+TG TVG  N  + Y+P   +I     V    RMW R L+ST QP 
Sbjct  439  TLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPS  498

Query  195  F  193
            F
Sbjct  499  F  499


 Score = 42.0 bits (97),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  676  PEVPFKLDGENGVLKHLEHXIETKGSAVVCVAEGAGQDLMEKS  548
            PE PF L+G  G+ +++E  +   G  V+ +AEGAGQ+L+ +S
Sbjct  334  PESPFYLEGPGGLFEYIEKRLIENGHMVIVMAEGAGQELLSES  376


 Score = 39.7 bits (91),  Expect(3) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  743  RSSGFIAMHASLASGQIDACLIPRGAF  663
            R SGFIAM+A+LAS  +D CLIP   F
Sbjct  312  RYSGFIAMYATLASRDVDCCLIPESPF  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420