BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017G18

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO75234.1|  hypothetical protein CISIN_1g015465mg                   411   2e-140   Citrus sinensis [apfelsine]
ref|XP_006468322.1|  PREDICTED: obg-like ATPase 1-like                  411   4e-140   Citrus sinensis [apfelsine]
ref|XP_006448884.1|  hypothetical protein CICLE_v10015175mg             411   4e-140   
ref|XP_006448885.1|  hypothetical protein CICLE_v10015175mg             412   2e-139   
gb|EYU43227.1|  hypothetical protein MIMGU_mgv1a007827mg                409   3e-139   Erythranthe guttata [common monkey flower]
gb|KDP34925.1|  hypothetical protein JCGZ_09213                         408   5e-139   Jatropha curcas
gb|AAF65513.1|  GTP-binding protein                                     406   3e-138   Capsicum annuum
ref|XP_004231561.1|  PREDICTED: obg-like ATPase 1                       406   3e-138   Solanum lycopersicum
ref|XP_011085197.1|  PREDICTED: obg-like ATPase 1                       406   4e-138   Sesamum indicum [beniseed]
ref|XP_006360314.1|  PREDICTED: obg-like ATPase 1-like                  405   7e-138   Solanum tuberosum [potatoes]
emb|CDP17295.1|  unnamed protein product                                404   2e-137   Coffea canephora [robusta coffee]
ref|XP_007211399.1|  hypothetical protein PRUPE_ppa006821mg             402   9e-137   Prunus persica
ref|XP_010051911.1|  PREDICTED: obg-like ATPase 1                       402   1e-136   Eucalyptus grandis [rose gum]
ref|XP_002263885.1|  PREDICTED: obg-like ATPase 1                       401   3e-136   Vitis vinifera
ref|XP_004293982.1|  PREDICTED: obg-like ATPase 1                       401   3e-136   Fragaria vesca subsp. vesca
ref|XP_009362223.1|  PREDICTED: obg-like ATPase 1                       401   3e-136   Pyrus x bretschneideri [bai li]
ref|XP_003546267.1|  PREDICTED: obg-like ATPase 1-like                  399   1e-135   Glycine max [soybeans]
ref|XP_008225608.1|  PREDICTED: obg-like ATPase 1                       399   2e-135   Prunus mume [ume]
ref|NP_001242520.1|  uncharacterized protein LOC100793501               399   2e-135   Glycine max [soybeans]
ref|XP_008372236.1|  PREDICTED: obg-like ATPase 1                       399   3e-135   Malus domestica [apple tree]
ref|XP_010098556.1|  Obg-like ATPase 1                                  399   3e-135   Morus notabilis
ref|XP_008383389.1|  PREDICTED: obg-like ATPase 1                       398   6e-135   Malus domestica [apple tree]
ref|XP_010245345.1|  PREDICTED: obg-like ATPase 1                       397   9e-135   Nelumbo nucifera [Indian lotus]
ref|XP_009803590.1|  PREDICTED: obg-like ATPase 1                       395   5e-134   Nicotiana sylvestris
ref|XP_009412029.1|  PREDICTED: obg-like ATPase 1                       395   8e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603694.1|  PREDICTED: obg-like ATPase 1 {ECO:0000255|HA...    395   8e-134   Nicotiana tomentosiformis
ref|XP_010478480.1|  PREDICTED: obg-like ATPase 1                       394   2e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010499597.1|  PREDICTED: obg-like ATPase 1                       394   2e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010460862.1|  PREDICTED: obg-like ATPase 1                       394   2e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010926935.1|  PREDICTED: obg-like ATPase 1                       394   3e-133   Elaeis guineensis
ref|XP_006377958.1|  hypothetical protein POPTR_0011s16690g             393   4e-133   Populus trichocarpa [western balsam poplar]
gb|KJB69089.1|  hypothetical protein B456_011G005000                    393   4e-133   Gossypium raimondii
ref|XP_011037748.1|  PREDICTED: obg-like ATPase 1                       393   7e-133   Populus euphratica
ref|XP_007147477.1|  hypothetical protein PHAVU_006G127800g             392   9e-133   Phaseolus vulgaris [French bean]
ref|XP_006305006.1|  hypothetical protein CARUB_v10009370mg             392   9e-133   Capsella rubella
ref|XP_010519060.1|  PREDICTED: obg-like ATPase 1                       392   1e-132   Tarenaya hassleriana [spider flower]
ref|XP_010687083.1|  PREDICTED: obg-like ATPase 1                       392   1e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002893634.1|  GTP binding protein                                392   1e-132   Arabidopsis lyrata subsp. lyrata
ref|NP_001061206.2|  Os08g0199300                                       392   1e-132   
gb|KHF97630.1|  Obg-like ATPase 1                                       392   2e-132   Gossypium arboreum [tree cotton]
gb|KFK44867.1|  hypothetical protein AALP_AA1G312800                    390   4e-132   Arabis alpina [alpine rockcress]
ref|NP_174346.1|  GTP-binding protein                                   390   6e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002523184.1|  GTP-dependent nucleic acid-binding protein e...    390   6e-132   Ricinus communis
gb|EEC83063.1|  hypothetical protein OsI_28170                          390   7e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_011039799.1|  PREDICTED: obg-like ATPase 1                       390   7e-132   Populus euphratica
emb|CDY12460.1|  BnaC08g09490D                                          390   9e-132   Brassica napus [oilseed rape]
ref|XP_002300568.1|  hypothetical protein POPTR_0001s47010g             389   1e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008799072.1|  PREDICTED: obg-like ATPase 1                       389   1e-131   Phoenix dactylifera
ref|XP_006659204.1|  PREDICTED: obg-like ATPase 1-like                  389   2e-131   Oryza brachyantha
gb|AAM63059.1|  putative GTP-binding protein                            388   4e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022926.1|  GTP binding                                        388   5e-131   Theobroma cacao [chocolate]
ref|XP_008445378.1|  PREDICTED: obg-like ATPase 1                       388   5e-131   Cucumis melo [Oriental melon]
ref|XP_003573525.1|  PREDICTED: obg-like ATPase 1                       387   9e-131   Brachypodium distachyon [annual false brome]
ref|XP_010941555.1|  PREDICTED: obg-like ATPase 1                       386   2e-130   
ref|XP_010538270.1|  PREDICTED: obg-like ATPase 1                       386   3e-130   Tarenaya hassleriana [spider flower]
gb|AFK48623.1|  unknown                                                 385   5e-130   Lotus japonicus
gb|KJB69090.1|  hypothetical protein B456_011G005000                    384   6e-130   Gossypium raimondii
ref|XP_004486463.1|  PREDICTED: obg-like ATPase 1-like                  385   6e-130   Cicer arietinum [garbanzo]
ref|XP_002445191.1|  hypothetical protein SORBIDRAFT_07g005700          384   2e-129   Sorghum bicolor [broomcorn]
ref|NP_001150211.1|  GTP-binding protein PTD004                         384   2e-129   Zea mays [maize]
ref|XP_004135546.1|  PREDICTED: obg-like ATPase 1-like                  384   2e-129   Cucumis sativus [cucumbers]
ref|XP_003594539.1|  Obg-like ATPase                                    382   8e-129   Medicago truncatula
gb|ACJ85184.1|  unknown                                                 382   1e-128   Medicago truncatula
ref|XP_004972629.1|  PREDICTED: obg-like ATPase 1-like                  382   2e-128   Setaria italica
gb|ABK25108.1|  unknown                                                 380   7e-128   Picea sitchensis
gb|AFK49195.1|  unknown                                                 379   2e-127   Medicago truncatula
ref|XP_006415450.1|  hypothetical protein EUTSA_v10007733mg             380   2e-127   
ref|XP_009107765.1|  PREDICTED: obg-like ATPase 1                       378   3e-127   Brassica rapa
emb|CDX98216.1|  BnaC07g08820D                                          377   9e-127   
emb|CDX77584.1|  BnaA07g07220D                                          377   1e-126   
ref|XP_009144765.1|  PREDICTED: obg-like ATPase 1                       377   1e-126   Brassica rapa
emb|CDM85617.1|  unnamed protein product                                373   3e-125   Triticum aestivum [Canadian hard winter wheat]
emb|CDY02308.1|  BnaA09g25940D                                          372   6e-125   
emb|CDY09558.1|  BnaC05g23610D                                          371   2e-124   Brassica napus [oilseed rape]
gb|EMS48297.1|  Obg-like ATPase 1                                       370   5e-124   Triticum urartu
gb|EMT28525.1|  Obg-like ATPase 1                                       369   2e-123   
ref|XP_009115125.1|  PREDICTED: obg-like ATPase 1                       362   5e-121   Brassica rapa
ref|XP_001776504.1|  predicted protein                                  353   3e-117   
gb|KDO75236.1|  hypothetical protein CISIN_1g015465mg                   350   7e-116   Citrus sinensis [apfelsine]
ref|XP_011015196.1|  PREDICTED: obg-like ATPase 1                       348   2e-115   Populus euphratica
ref|XP_002985543.1|  hypothetical protein SELMODRAFT_234816             336   9e-111   Selaginella moellendorffii
ref|XP_008812127.1|  PREDICTED: obg-like ATPase 1                       332   6e-109   
gb|AAP43929.1|  GTP-binding protein                                     320   1e-106   Triticum aestivum [Canadian hard winter wheat]
gb|AFW56960.1|  hypothetical protein ZEAMMB73_810066                    322   2e-105   
gb|KDO75237.1|  hypothetical protein CISIN_1g015465mg                   320   3e-105   Citrus sinensis [apfelsine]
gb|AFW56959.1|  hypothetical protein ZEAMMB73_810066                    303   6e-101   
gb|KJB69091.1|  hypothetical protein B456_011G005000                    303   3e-98    Gossypium raimondii
ref|XP_001699763.1|  flagellar associated protein                       303   1e-97    Chlamydomonas reinhardtii
ref|XP_002953429.1|  hypothetical protein VOLCADRAFT_105955             302   2e-97    Volvox carteri f. nagariensis
gb|EMS48298.1|  Obg-like ATPase 1                                       295   2e-95    Triticum urartu
ref|XP_005847323.1|  hypothetical protein CHLNCDRAFT_56178              293   5e-94    Chlorella variabilis
gb|KDD75506.1|  DUF933 hypothetical protein                             293   5e-94    Helicosporidium sp. ATCC 50920
ref|XP_005650863.1|  flagellar associated protein                       291   4e-93    Coccomyxa subellipsoidea C-169
ref|XP_003064009.1|  predicted protein                                  288   7e-92    Micromonas pusilla CCMP1545
ref|XP_011395756.1|  Obg-like ATPase 1                                  285   2e-91    Auxenochlorella protothecoides
ref|XP_001421839.1|  predicted protein                                  286   5e-91    Ostreococcus lucimarinus CCE9901
ref|XP_006845996.1|  hypothetical protein AMTR_s00155p00052120          274   6e-90    
ref|XP_002502254.1|  predicted protein                                  275   8e-87    Micromonas commoda
ref|XP_003388006.1|  PREDICTED: obg-like ATPase 1                       276   8e-87    Amphimedon queenslandica
emb|CEG00523.1|  P-loop containing nucleoside triphosphate hydrolase    272   1e-85    Ostreococcus tauri
gb|EPY26360.1|  GTP binding protein                                     264   3e-85    Angomonas deanei
ref|XP_005703761.1|  GTP-binding protein                                267   8e-84    Galdieria sulphuraria
gb|EPY39657.1|  GTP binding protein                                     265   4e-83    Angomonas deanei
gb|EPY25232.1|  GTP binding protein                                     258   8e-83    Angomonas deanei
ref|XP_004220982.1|  GTP-binding protein                                263   4e-82    Plasmodium cynomolgi strain B
ref|XP_003083821.1|  GTP-binding protein (ISS)                          273   5e-82    
ref|XP_010736093.1|  PREDICTED: obg-like ATPase 1 isoform X2            257   5e-82    
gb|EPS62769.1|  hypothetical protein M569_12020                         253   7e-82    Genlisea aurea
gb|EPY23726.1|  GTP binding protein                                     257   1e-81    Strigomonas culicis
ref|XP_008818190.1|  GTP-binding protein YchF                           261   2e-81    Plasmodium inui San Antonio 1
ref|XP_005452977.1|  PREDICTED: obg-like ATPase 1-like isoform X8       256   3e-81    Oreochromis niloticus
ref|XP_005019763.1|  PREDICTED: obg-like ATPase 1                       254   5e-81    
ref|XP_009490257.1|  PREDICTED: obg-like ATPase 1                       254   9e-81    Pelecanus crispus
ref|XP_005519867.1|  PREDICTED: obg-like ATPase 1 isoform X4            255   1e-80    
ref|XP_009581765.1|  PREDICTED: obg-like ATPase 1                       254   2e-80    Fulmarus glacialis
gb|EPY30421.1|  GTP binding protein                                     258   2e-80    Angomonas deanei
ref|XP_005452976.1|  PREDICTED: obg-like ATPase 1-like isoform X7       255   2e-80    Oreochromis niloticus
ref|XP_010162756.1|  PREDICTED: obg-like ATPase 1                       254   2e-80    Antrostomus carolinensis
gb|EWC89308.1|  GTP-binding protein YchF                                257   2e-80    Plasmodium falciparum NF54
ref|XP_004601224.1|  PREDICTED: obg-like ATPase 1 isoform X3            253   2e-80    Sorex araneus [Eurasian shrew]
gb|ETW39419.1|  GTP-binding protein YchF                                257   2e-80    Plasmodium falciparum NF135/5.C10
gb|ETW37410.1|  GTP-binding protein YchF                                257   2e-80    Plasmodium falciparum Tanzania (2000708)
ref|XP_009086253.1|  PREDICTED: obg-like ATPase 1 isoform X2            254   2e-80    
ref|XP_010073941.1|  PREDICTED: obg-like ATPase 1                       254   2e-80    Pterocles gutturalis
gb|ETW50152.1|  GTP-binding protein YchF                                257   2e-80    Plasmodium falciparum MaliPS096_E11
ref|XP_005442958.1|  PREDICTED: obg-like ATPase 1                       254   3e-80    
ref|XP_010116935.1|  PREDICTED: obg-like ATPase 1                       254   3e-80    Chlamydotis macqueenii
gb|KFP49878.1|  Obg-like ATPase 1                                       254   3e-80    Cathartes aura
ref|XP_004703789.1|  PREDICTED: obg-like ATPase 1 isoform X3            253   3e-80    Echinops telfairi [lesser hedgehog tenrec]
gb|ETW28438.1|  GTP-binding protein YchF                                258   3e-80    Plasmodium falciparum FCH/4
gb|KFV04274.1|  Obg-like ATPase 1                                       254   4e-80    Tauraco erythrolophus
ref|XP_009276861.1|  PREDICTED: obg-like ATPase 1                       254   4e-80    Aptenodytes forsteri
ref|XP_001466463.1|  putative GTP binding protein                       258   4e-80    Leishmania infantum JPCM5
ref|XP_008929287.1|  PREDICTED: obg-like ATPase 1                       253   5e-80    
ref|XP_011488091.1|  PREDICTED: obg-like ATPase 1                       252   6e-80    
ref|XP_004092018.1|  PREDICTED: obg-like ATPase 1 isoform 2             252   6e-80    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003961956.1|  PREDICTED: obg-like ATPase 1-like                  257   7e-80    Takifugu rubripes [tiger puffer]
ref|XP_008116321.1|  PREDICTED: obg-like ATPase 1 isoform X3            252   8e-80    Anolis carolinensis [Carolina anole]
ref|XP_004426695.1|  PREDICTED: obg-like ATPase 1 isoform 3             251   9e-80    
ref|XP_009977093.1|  PREDICTED: obg-like ATPase 1                       253   9e-80    Tauraco erythrolophus
ref|XP_010192575.1|  PREDICTED: obg-like ATPase 1                       251   9e-80    Mesitornis unicolor
ref|XP_005452975.1|  PREDICTED: obg-like ATPase 1-like isoform X6       255   9e-80    
ref|XP_001349125.1|  conserved GTP-binding protein, putative            257   9e-80    Plasmodium falciparum 3D7
ref|XP_001515633.1|  PREDICTED: obg-like ATPase 1 isoform X1            257   1e-79    Ornithorhynchus anatinus [duck-billed platypus]
emb|CEG70465.1|  Putative Obg-like ATPase 1                             257   1e-79    Rhizopus microsporus
ref|XP_002261143.1|  GTP-binding protein                                256   1e-79    Plasmodium knowlesi strain H
ref|XP_004878683.1|  PREDICTED: obg-like ATPase 1-like                  251   1e-79    
ref|NP_001011708.1|  obg-like ATPase 1 isoform 2                        251   1e-79    Homo sapiens [man]
gb|AAF71123.1|AF116721_103  PRO2455                                     251   1e-79    Homo sapiens [man]
ref|XP_007431000.1|  PREDICTED: obg-like ATPase 1-like isoform X3       255   1e-79    
ref|XP_005484131.1|  PREDICTED: obg-like ATPase 1                       252   1e-79    
ref|XP_007527278.1|  PREDICTED: obg-like ATPase 1 isoform X2            251   1e-79    Erinaceus europaeus [common hedgehog]
emb|CCC89543.1|  putative GTP binding protein                           256   1e-79    Trypanosoma congolense IL3000
ref|XP_003722043.1|  putative GTP binding protein                       256   2e-79    Leishmania major strain Friedlin
ref|XP_007938961.1|  PREDICTED: obg-like ATPase 1 isoform X2            251   2e-79    Orycteropus afer afer
gb|EPY37092.1|  GTP binding protein                                     256   2e-79    Strigomonas culicis
gb|ESL11226.1|  GTP-binding protein                                     252   2e-79    Trypanosoma rangeli SC58
ref|XP_001612801.1|  GTP-binding protein                                256   2e-79    Plasmodium vivax
ref|XP_004267373.1|  PREDICTED: obg-like ATPase 1 isoform 2             251   2e-79    Orcinus orca [Orca]
gb|KFZ54967.1|  Obg-like ATPase 1                                       253   2e-79    Antrostomus carolinensis
ref|XP_001368232.1|  PREDICTED: Obg-like ATPase 1                       256   2e-79    Monodelphis domestica
ref|XP_005921550.1|  PREDICTED: obg-like ATPase 1-like isoform X4       252   2e-79    Haplochromis burtoni
emb|CDO63681.1|  GTP-binding protein, putative                          256   2e-79    Plasmodium reichenowi
ref|XP_007451127.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   3e-79    Lipotes vexillifer [baiji]
ref|XP_003876812.1|  putative GTP binding protein                       255   3e-79    Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_009932339.1|  PREDICTED: obg-like ATPase 1                       251   3e-79    Opisthocomus hoazin [hoatzin]
ref|XP_009330922.1|  PREDICTED: obg-like ATPase 1 isoform X1            252   3e-79    Pygoscelis adeliae
gb|EHA99193.1|  Obg-like ATPase 1                                       251   3e-79    Heterocephalus glaber [naked mole rat]
ref|XP_010736092.1|  PREDICTED: obg-like ATPase 1 isoform X1            255   4e-79    Larimichthys crocea [croceine croaker]
ref|XP_008533775.1|  PREDICTED: obg-like ATPase 1                       249   4e-79    Equus przewalskii [Przewalski horse]
ref|XP_003764019.1|  PREDICTED: obg-like ATPase 1                       255   4e-79    Sarcophilus harrisii
emb|CEI96573.1|  Putative Obg-like ATPase 1                             255   5e-79    Rhizopus microsporus
ref|XP_008136766.1|  PREDICTED: obg-like ATPase 1 isoform X2            249   5e-79    Eptesicus fuscus
ref|XP_010878192.1|  PREDICTED: obg-like ATPase 1 isoform X4            255   5e-79    
gb|AAY14876.1|  unknown                                                 249   5e-79    Homo sapiens [man]
ref|XP_010878191.1|  PREDICTED: obg-like ATPase 1 isoform X3            255   6e-79    Esox lucius
gb|EYC24730.1|  hypothetical protein Y032_0013g2079                     255   6e-79    Ancylostoma ceylanicum
ref|XP_009236113.1|  PREDICTED: obg-like ATPase 1 isoform X2            249   6e-79    
ref|XP_007430999.1|  PREDICTED: obg-like ATPase 1-like isoform X2       254   6e-79    Python bivittatus
ref|XP_010878190.1|  PREDICTED: obg-like ATPase 1 isoform X2            256   6e-79    Esox lucius
ref|XP_010605332.1|  PREDICTED: obg-like ATPase 1 isoform X2            251   7e-79    Fukomys damarensis [Damara mole rat]
ref|XP_005452974.1|  PREDICTED: obg-like ATPase 1-like isoform X5       253   7e-79    Oreochromis niloticus
ref|XP_010878189.1|  PREDICTED: obg-like ATPase 1 isoform X1            256   7e-79    Esox lucius
ref|NP_001026425.1|  obg-like ATPase 1                                  254   7e-79    Gallus gallus [bantam]
ref|XP_007430998.1|  PREDICTED: obg-like ATPase 1-like isoform X1       254   7e-79    Python bivittatus
gb|ADD38665.1|  GTP-binding protein CG1354                              254   8e-79    Lepeophtheirus salmonis
gb|ETN73871.1|  GTP-binding protein YchF                                254   8e-79    Necator americanus
ref|XP_009952424.1|  PREDICTED: obg-like ATPase 1                       250   9e-79    Leptosomus discolor
gb|AEB61109.1|  obg-like ATPase 1-like protein                          251   9e-79    Equus caballus [domestic horse]
ref|XP_005510535.1|  PREDICTED: obg-like ATPase 1-like                  253   9e-79    
gb|ACO12256.1|  Obg-like ATPase 1                                       254   9e-79    Lepeophtheirus salmonis
ref|XP_008275154.1|  PREDICTED: obg-like ATPase 1                       254   1e-78    Stegastes partitus
ref|XP_006866714.1|  PREDICTED: obg-like ATPase 1 isoform X2            249   1e-78    Chrysochloris asiatica
gb|KCW75747.1|  hypothetical protein EUGRSUZ_D00127                     251   1e-78    Eucalyptus grandis [rose gum]
gb|EFN78354.1|  Obg-like ATPase 1                                       251   1e-78    Harpegnathos saltator
ref|XP_005798398.1|  PREDICTED: obg-like ATPase 1-like                  254   1e-78    Xiphophorus maculatus
ref|XP_003442972.1|  PREDICTED: obg-like ATPase 1-like                  254   1e-78    Oreochromis niloticus
gb|KFO14346.1|  Obg-like ATPase 1                                       253   2e-78    Balearica regulorum gibbericeps
ref|XP_003695060.1|  PREDICTED: GTP-binding protein CG1354-like         253   2e-78    Apis florea [dwarf honeybee]
emb|CAG09966.1|  unnamed protein product                                252   2e-78    Tetraodon nigroviridis
ref|XP_003447358.1|  PREDICTED: obg-like ATPase 1-like isoform X1       253   2e-78    
gb|KFW10028.1|  Obg-like ATPase 1                                       252   2e-78    Fulmarus glacialis
ref|XP_668381.1|  GTP-binding protein                                   253   2e-78    Cryptosporidium hominis TU502
emb|CCW63611.1|  unnamed protein product                                253   2e-78    Phytomonas sp. isolate EM1
gb|KFM07037.1|  Obg-like ATPase 1                                       252   2e-78    Aptenodytes forsteri
gb|KFP41102.1|  Obg-like ATPase 1                                       252   2e-78    Chlamydotis macqueenii
gb|EFN60681.1|  Obg-like ATPase 1                                       251   2e-78    Camponotus floridanus
gb|KFV08740.1|  Obg-like ATPase 1                                       252   2e-78    Pterocles gutturalis
ref|XP_007576845.1|  PREDICTED: obg-like ATPase 1                       253   2e-78    Poecilia formosa
ref|XP_006744648.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   2e-78    
ref|XP_005723778.1|  PREDICTED: obg-like ATPase 1-like                  253   3e-78    Pundamilia nyererei
emb|CCW70456.1|  unnamed protein product                                253   3e-78    Phytomonas sp. isolate Hart1
ref|XP_008297045.1|  PREDICTED: obg-like ATPase 1                       253   3e-78    Stegastes partitus
ref|XP_006798459.1|  PREDICTED: obg-like ATPase 1-like                  253   3e-78    Neolamprologus brichardi [lyretail cichlid]
gb|EGI59771.1|  GTP-binding protein                                     251   3e-78    Acromyrmex echinatior
emb|CBK21211.2|  unnamed protein product                                253   3e-78    Blastocystis hominis
ref|XP_005452973.1|  PREDICTED: obg-like ATPase 1-like isoform X4       253   3e-78    Oreochromis niloticus
ref|XP_628099.1|  yyaF/YCHF TRANSFAC/OBG family small GTpase plus...    253   3e-78    Cryptosporidium parvum Iowa II
ref|XP_005452972.1|  PREDICTED: obg-like ATPase 1-like isoform X3       253   4e-78    
ref|XP_008397950.1|  PREDICTED: obg-like ATPase 1                       253   4e-78    Poecilia reticulata
emb|CDQ57167.1|  unnamed protein product                                253   5e-78    Oncorhynchus mykiss
ref|XP_396711.3|  PREDICTED: obg-like ATPase 1-like isoformX1           252   5e-78    
ref|XP_005237197.1|  PREDICTED: obg-like ATPase 1                       252   5e-78    
ref|XP_003400207.1|  PREDICTED: GTP-binding protein CG1354-like         252   6e-78    
gb|ESL05473.1|  GTP-binding protein                                     251   7e-78    Trypanosoma rangeli SC58
ref|XP_006788528.1|  PREDICTED: obg-like ATPase 1-like                  252   7e-78    Neolamprologus brichardi [lyretail cichlid]
gb|KFW86891.1|  Obg-like ATPase 1                                       251   7e-78    Manacus vitellinus
ref|XP_002646525.1|  C. briggsae CBR-TAG-210 protein                    252   7e-78    Caenorhabditis briggsae
ref|XP_004557802.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   7e-78    Maylandia zebra
ref|XP_005519864.1|  PREDICTED: obg-like ATPase 1 isoform X1            252   8e-78    
ref|XP_005049114.1|  PREDICTED: obg-like ATPase 1                       252   8e-78    Ficedula albicollis
ref|XP_005723547.1|  PREDICTED: obg-like ATPase 1-like isoform X4       250   8e-78    
ref|XP_002198993.1|  PREDICTED: obg-like ATPase 1 isoform 1             252   9e-78    Taeniopygia guttata
ref|XP_009070315.1|  PREDICTED: obg-like ATPase 1                       252   9e-78    Acanthisitta chloris
gb|KFH65596.1|  GTP-binding protein YchF                                252   9e-78    Mortierella verticillata NRRL 6337
gb|EDL27121.1|  RIKEN cDNA 2810409H07, isoform CRA_a                    249   9e-78    Mus musculus [mouse]
ref|XP_003704224.1|  PREDICTED: GTP-binding protein CG1354-like         251   9e-78    Megachile rotundata
ref|XP_005723546.1|  PREDICTED: obg-like ATPase 1-like isoform X3       250   1e-77    Pundamilia nyererei
ref|XP_008216612.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Nasonia vitripennis
ref|XP_006636567.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   1e-77    
ref|NP_001268915.1|  obg-like ATPase 1 isoform 2                        250   1e-77    Danio rerio [leopard danio]
ref|XP_009311370.1|  GTP-binding protein                                251   1e-77    Trypanosoma grayi
gb|KFH16391.1|  putative GTP-binding protein                            245   1e-77    Toxoplasma gondii MAS
ref|XP_008933239.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Merops nubicus
ref|XP_009680050.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Struthio camelus australis
ref|XP_009639084.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Egretta garzetta
ref|XP_005152654.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Melopsittacus undulatus
ref|XP_010564826.1|  PREDICTED: obg-like ATPase 1                       251   1e-77    Haliaeetus leucocephalus
ref|XP_004774421.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   2e-77    Mustela putorius furo [black ferret]
ref|XP_011329428.1|  PREDICTED: obg-like ATPase 1                       251   2e-77    
ref|XP_005452971.1|  PREDICTED: obg-like ATPase 1-like isoform X2       253   2e-77    
ref|XP_001748154.1|  hypothetical protein                               251   2e-77    Monosiga brevicollis MX1
gb|AGG11697.1|  hypothetical protein                                    250   2e-77    Leptomonas pyrrhocoris
ref|XP_003494408.1|  PREDICTED: GTP-binding protein CG1354-like         251   3e-77    Bombus impatiens
ref|XP_004601222.1|  PREDICTED: obg-like ATPase 1 isoform X1            250   3e-77    Sorex araneus [Eurasian shrew]
ref|XP_007546548.1|  PREDICTED: obg-like ATPase 1                       250   3e-77    Poecilia formosa
gb|KFH07802.1|  putative GTP-binding protein                            243   3e-77    Toxoplasma gondii VAND
ref|XP_008116320.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   3e-77    Anolis carolinensis [Carolina anole]
ref|XP_006275601.1|  PREDICTED: obg-like ATPase 1-like isoform X1       251   3e-77    
ref|XP_006275602.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   3e-77    Alligator mississippiensis
ref|XP_005300475.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   3e-77    Chrysemys picta bellii
ref|XP_011162955.1|  PREDICTED: obg-like ATPase 1                       250   3e-77    Solenopsis invicta [imported red fire ant]
ref|XP_007060593.1|  PREDICTED: obg-like ATPase 1                       250   4e-77    
ref|XP_005300476.1|  PREDICTED: obg-like ATPase 1 isoform X3            250   4e-77    Chrysemys picta bellii
ref|XP_011063639.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   4e-77    Acromyrmex echinatior
ref|XP_004703787.1|  PREDICTED: obg-like ATPase 1 isoform X1            250   4e-77    Echinops telfairi [lesser hedgehog tenrec]
gb|KFR10255.1|  Obg-like ATPase 1                                       249   4e-77    Opisthocomus hoazin [hoatzin]
ref|XP_005300474.1|  PREDICTED: obg-like ATPase 1 isoform X1            250   4e-77    Chrysemys picta bellii
ref|XP_011063638.1|  PREDICTED: obg-like ATPase 1 isoform X1            250   4e-77    Acromyrmex echinatior
ref|XP_010884736.1|  PREDICTED: obg-like ATPase 1                       250   4e-77    
ref|XP_008565607.1|  PREDICTED: obg-like ATPase 1                       248   5e-77    Galeopterus variegatus [Malayan flying lemur]
ref|XP_005723545.1|  PREDICTED: obg-like ATPase 1-like isoform X2       250   5e-77    
ref|XP_006636566.1|  PREDICTED: obg-like ATPase 1-like isoform X1       250   5e-77    Lepisosteus oculatus
ref|XP_005723544.1|  PREDICTED: obg-like ATPase 1-like isoform X1       249   6e-77    Pundamilia nyererei
ref|NP_999865.1|  obg-like ATPase 1 isoform 1                           249   6e-77    Danio rerio [leopard danio]
emb|CDJ65501.1|  GTP binding protein, putative                          249   6e-77    Eimeria necatrix
ref|XP_004557801.1|  PREDICTED: obg-like ATPase 1-like isoform X1       249   7e-77    Maylandia zebra
ref|XP_006878885.1|  PREDICTED: obg-like ATPase 1-like                  249   7e-77    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003253776.1|  PREDICTED: obg-like ATPase 1 isoform 1             249   7e-77    Nomascus leucogenys [White-cheeked Gibbon]
gb|EGT58351.1|  hypothetical protein CAEBREN_10889                      249   7e-77    
ref|XP_004476856.1|  PREDICTED: obg-like ATPase 1 isoform 2             249   7e-77    
ref|XP_005907299.1|  PREDICTED: obg-like ATPase 1                       249   8e-77    
ref|XP_004674578.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   8e-77    
ref|XP_004476855.1|  PREDICTED: obg-like ATPase 1 isoform 1             249   8e-77    
ref|XP_008326510.1|  PREDICTED: obg-like ATPase 1 isoform X2            249   8e-77    
ref|XP_008326509.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   8e-77    
ref|NP_001254006.1|  Protein OLA-1, isoform a                           249   8e-77    
ref|XP_001499403.1|  PREDICTED: Obg-like ATPase 1 isoformX1             249   9e-77    
ref|XP_006116547.1|  PREDICTED: obg-like ATPase 1 isoform X2            250   9e-77    
ref|XP_004426693.1|  PREDICTED: obg-like ATPase 1 isoform 1             249   9e-77    
gb|EPQ02313.1|  Obg-like ATPase 1                                       248   9e-77    
ref|XP_010988428.1|  PREDICTED: obg-like ATPase 1                       249   9e-77    
ref|XP_005573571.1|  PREDICTED: uncharacterized LOC101926459 isof...    249   1e-76    
ref|XP_004341541.1|  GTP binding protein                                249   1e-76    
ref|XP_008549165.1|  PREDICTED: obg-like ATPase 1                       246   1e-76    
ref|NP_001039510.1|  obg-like ATPase 1                                  249   1e-76    
ref|XP_005676004.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
gb|AIC56285.1|  OLA1                                                    249   1e-76    
ref|XP_003225685.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
gb|ERG79748.1|  gtp-binding protein                                     249   1e-76    
gb|AAD44500.1|  homologous yeast-44.2 protein                           249   1e-76    
dbj|BAB55174.1|  unnamed protein product                                249   1e-76    
gb|EFX64851.1|  hypothetical protein DAPPUDRAFT_333762                  249   1e-76    
ref|XP_004634805.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
ref|XP_004032861.1|  PREDICTED: obg-like ATPase 1-like isoform 1        249   1e-76    
ref|XP_008853504.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_004757606.1|  PREDICTED: obg-like ATPase 1-like                  243   1e-76    
ref|XP_004092019.1|  PREDICTED: obg-like ATPase 1 isoform 3             249   1e-76    
ref|XP_008685352.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_006972493.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_011267424.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_010356768.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
ref|XP_007527277.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
ref|XP_010605331.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
ref|XP_011148752.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_011355667.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
ref|NP_037473.3|  obg-like ATPase 1 isoform 1                           249   1e-76    
ref|XP_009351070.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
gb|KFO22378.1|  Obg-like ATPase 1                                       249   1e-76    
ref|XP_008503320.1|  PREDICTED: obg-like ATPase 1                       249   1e-76    
ref|XP_004857751.1|  PREDICTED: obg-like ATPase 1-like                  249   1e-76    
ref|XP_004267372.1|  PREDICTED: obg-like ATPase 1 isoform 1             249   1e-76    
ref|XP_007183357.1|  PREDICTED: obg-like ATPase 1                       248   1e-76    
ref|XP_008996931.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   1e-76    
emb|CDJ43406.1|  GTP binding protein, putative                          248   2e-76    
gb|AGG11505.1|  hypothetical protein                                    248   2e-76    
emb|CBH09562.1|  GTP binding protein, putative                          248   2e-76    
ref|XP_004004627.1|  PREDICTED: obg-like ATPase 1                       249   2e-76    
ref|XP_003406265.1|  PREDICTED: obg-like ATPase 1                       248   2e-76    
ref|XP_007451126.1|  PREDICTED: obg-like ATPase 1 isoform X1            248   2e-76    
ref|XP_003474516.1|  PREDICTED: obg-like ATPase 1-like                  248   2e-76    
ref|NP_001040339.1|  GTP binding protein                                248   2e-76    
ref|XP_004032863.1|  PREDICTED: obg-like ATPase 1-like isoform 3        249   2e-76    
ref|XP_003478641.1|  PREDICTED: obg-like ATPase 1                       248   2e-76    
ref|XP_011498533.1|  PREDICTED: obg-like ATPase 1                       248   2e-76    
gb|KFQ13404.1|  Obg-like ATPase 1                                       244   2e-76    
ref|XP_007963584.1|  PREDICTED: obg-like ATPase 1 isoform X1            249   2e-76    
ref|XP_951682.1|  GTP binding protein                                   248   2e-76    
ref|XP_005799467.1|  PREDICTED: obg-like ATPase 1-like                  248   2e-76    
ref|XP_006003588.1|  PREDICTED: obg-like ATPase 1 isoform X2            248   2e-76    
ref|XP_001566005.1|  putative GTP binding protein                       248   3e-76    
ref|XP_006003587.1|  PREDICTED: obg-like ATPase 1 isoform X1            248   3e-76    
gb|EHH54959.1|  hypothetical protein EGM_04072                          248   3e-76    
gb|EDL79133.1|  similar to RIKEN cDNA 2810409H07, isoform CRA_a         248   3e-76    
ref|XP_003115069.1|  CRE-TAG-210 protein                                248   3e-76    
dbj|BAE39543.1|  unnamed protein product                                248   3e-76    
ref|NP_080218.1|  obg-like ATPase 1 isoform a                           248   3e-76    
ref|NP_001029099.1|  obg-like ATPase 1                                  248   4e-76    
ref|XP_005857658.1|  PREDICTED: obg-like ATPase 1                       248   4e-76    
gb|EIE82570.1|  GTP-binding protein YchF                                248   4e-76    
gb|ELK32737.1|  Obg-like ATPase 1                                       248   4e-76    
ref|XP_010700320.1|  GTP binding protein, putative                      247   4e-76    
ref|XP_008136765.1|  PREDICTED: obg-like ATPase 1 isoform X1            248   4e-76    
ref|NP_001158828.1|  obg-like ATPase 1                                  248   4e-76    
ref|XP_005346631.1|  PREDICTED: obg-like ATPase 1                       247   4e-76    
dbj|BAE35446.1|  unnamed protein product                                247   4e-76    
gb|EFX64850.1|  hypothetical protein DAPPUDRAFT_219469                  247   4e-76    
gb|ELW64153.1|  Obg-like ATPase 1                                       250   5e-76    
gb|ACO09273.1|  GTP-binding protein PTD004                              247   5e-76    
ref|XP_008310339.1|  PREDICTED: obg-like ATPase 1                       247   5e-76    
emb|CAB66481.1|  hypothetical protein                                   247   6e-76    
ref|XP_006866713.1|  PREDICTED: obg-like ATPase 1 isoform X1            247   6e-76    
tpg|DAA13236.1|  TPA: Obg-like ATPase 1-like                            247   6e-76    
ref|NP_001127505.1|  obg-like ATPase 1                                  247   6e-76    
gb|AEH16630.1|  GTPase                                                  247   7e-76    
ref|XP_007248906.1|  PREDICTED: obg-like ATPase 1-like                  247   7e-76    
gb|AAY18927.1|  DKFZp761C10121                                          248   7e-76    
ref|XP_008397269.1|  PREDICTED: obg-like ATPase 1 isoform X1            247   8e-76    
emb|CDH52754.1|  gtp-binding protein                                    246   9e-76    
ref|XP_004375552.1|  PREDICTED: obg-like ATPase 1                       246   9e-76    
emb|CDS09858.1|  Putative GTP-binding protein YchF                      246   1e-75    
ref|XP_515918.2|  PREDICTED: obg-like ATPase 1 isoform X1               248   1e-75    
emb|CDU17077.1|  GTP-binding protein, putative                          245   1e-75    
ref|XP_003824289.1|  PREDICTED: obg-like ATPase 1 isoform X1            248   1e-75    
ref|XP_850320.2|  PREDICTED: LOW QUALITY PROTEIN: Obg-like ATPase...    246   1e-75    
gb|EKF26595.1|  GTP-binding protein, putative                           246   2e-75    
ref|XP_007888200.1|  PREDICTED: obg-like ATPase 1                       246   2e-75    
ref|XP_010831175.1|  PREDICTED: obg-like ATPase 1                       245   2e-75    
ref|XP_001635003.1|  predicted protein                                  245   2e-75    
ref|XP_817773.1|  GTP-binding protein                                   245   3e-75    
dbj|BAB27201.1|  unnamed protein product                                245   3e-75    
emb|CDQ81805.1|  unnamed protein product                                247   3e-75    
gb|EUD71003.1|  GTP-binding protein YchF                                245   4e-75    
gb|ETB58464.1|  GTP-binding protein YchF                                245   4e-75    
emb|CDR11783.1|  GTP-binding protein, putative                          244   4e-75    
ref|XP_008625563.1|  GTP-binding protein YchF                           244   4e-75    
gb|KFW61884.1|  Obg-like ATPase 1                                       244   5e-75    
ref|XP_004521628.1|  PREDICTED: obg-like ATPase 1-like isoform X1       244   5e-75    
ref|XP_009236111.1|  PREDICTED: obg-like ATPase 1 isoform X1            246   6e-75    
ref|XP_011307687.1|  PREDICTED: obg-like ATPase 1                       244   6e-75    
gb|ETN66120.1|  GTP-binding protein                                     242   6e-75    
ref|XP_009553897.1|  PREDICTED: obg-like ATPase 1                       244   7e-75    
gb|ESS62262.1|  GTP-binding protein                                     244   9e-75    
gb|AAO26205.1|  GTP-binding protein                                     244   9e-75    
ref|XP_003745114.1|  PREDICTED: GTP-binding protein CG1354-like         244   9e-75    
ref|NP_001079680.1|  obg-like ATPase 1                                  244   9e-75    
ref|XP_002407922.1|  GTP-binding protein, putative                      244   1e-74    
ref|XP_676964.1|  GTP-binding protein                                   244   1e-74    
ref|XP_004786306.1|  PREDICTED: obg-like ATPase 1-like                  239   1e-74    
ref|XP_730137.1|  hypothetical protein                                  245   1e-74    
ref|NP_001270427.1|  uncharacterized protein LOC101926459               244   1e-74    
ref|XP_002163078.2|  PREDICTED: obg-like ATPase 1-like                  244   1e-74    
emb|CDJ59407.1|  GTP binding protein, putative                          245   1e-74    
gb|ETE71660.1|  Obg-like ATPase 1                                       243   1e-74    
ref|XP_003884761.1|  putative GTP binding protein                       243   2e-74    
ref|XP_813495.1|  GTP-binding protein                                   243   2e-74    
ref|XP_311198.2|  AGAP000672-PA                                         243   2e-74    
dbj|BAM19435.1|  GTP-binding protein                                    243   2e-74    
ref|XP_010350251.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    245   2e-74    
emb|CCC46753.1|  putative GTP binding protein                           243   2e-74    
gb|EFA09583.1|  hypothetical protein TcasGA2_TC011700                   240   4e-74    
ref|XP_001654823.1|  AAEL002160-PA                                      242   4e-74    
ref|XP_002370768.1|  GTP binding protein, putative                      242   4e-74    
ref|XP_011213430.1|  PREDICTED: obg-like ATPase 1                       242   5e-74    
gb|EKG08395.1|  hypothetical protein TCSYLVIO_000468                    242   6e-74    
ref|XP_007512524.1|  predicted protein                                  242   7e-74    
ref|XP_006174828.1|  PREDICTED: obg-like ATPase 1 isoform X1            241   9e-74    
gb|KHN83895.1|  Obg-like ATPase 1                                       243   1e-73    
ref|XP_006020859.1|  PREDICTED: obg-like ATPase 1                       241   1e-73    
emb|CAJ83205.1|  novel protein similar to GTP-binding protein PTD004    241   1e-73    
ref|XP_008885365.1|  GTP-binding protein, putative                      241   1e-73    
emb|CCD81858.1|  GTP-binding protein-related                            241   1e-73    
gb|ELR47977.1|  Obg-like ATPase 1                                       241   2e-73    
ref|XP_010793340.1|  PREDICTED: obg-like ATPase 1                       241   2e-73    
ref|XP_743834.1|  GTP-binding protein                                   240   2e-73    
ref|XP_008472914.1|  PREDICTED: obg-like ATPase 1 isoform X3            241   2e-73    
ref|XP_010747153.1|  PREDICTED: obg-like ATPase 1                       241   2e-73    
gb|KFB40079.1|  AGAP000672-PA-like protein                              240   3e-73    
ref|XP_011185359.1|  PREDICTED: obg-like ATPase 1                       240   3e-73    
ref|XP_008472912.1|  PREDICTED: obg-like ATPase 1 isoform X1            241   4e-73    
gb|KGB37524.1|  Obg-like ATPase 1                                       239   4e-73    
gb|EZA60180.1|  GTP-binding protein                                     251   4e-73    
gb|EHJ68331.1|  GTP binding protein                                     254   4e-73    
ref|XP_008472913.1|  PREDICTED: obg-like ATPase 1 isoform X2            240   5e-73    
ref|NP_001153863.1|  Obg-like ATPase 1                                  239   6e-73    
gb|ERE71973.1|  obg-like ATPase 1-like protein                          250   7e-73    
ref|XP_969865.2|  PREDICTED: obg-like ATPase 1                          239   7e-73    
ref|NP_001008044.1|  obg-like ATPase 1                                  239   8e-73    
ref|XP_001846950.1|  GTP-binding protein                                237   9e-73    
ref|XP_002010541.1|  GI15984                                            239   1e-72    
gb|KJB69092.1|  hypothetical protein B456_011G005000                    237   1e-72    
ref|XP_010793747.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    239   1e-72    
gb|EPY31725.1|  GTP binding protein                                     238   1e-72    
ref|XP_002142230.1|  GTP-binding protein                                238   1e-72    
emb|CEF67024.1|  Obg-like ATPase 1                                      238   2e-72    
gb|EUB60715.1|  GTP-binding protein                                     237   2e-72    
ref|XP_002116391.1|  hypothetical protein TRIADDRAFT_30808              237   2e-72    
ref|XP_010959009.1|  PREDICTED: obg-like ATPase 1                       237   3e-72    
ref|XP_797209.1|  PREDICTED: obg-like ATPase 1-like                     237   4e-72    
emb|CDS18927.1|  GTP binding protein CG1354                             238   4e-72    
ref|XP_002605213.1|  hypothetical protein BRAFLDRAFT_114616             236   9e-72    
gb|EJY78341.1|  putative GTPase, probable translation factor            236   1e-71    
ref|XP_001454300.1|  hypothetical protein                               236   1e-71    
ref|XP_006616484.1|  PREDICTED: LOW QUALITY PROTEIN: obg-like ATP...    236   1e-71    
ref|XP_001462345.1|  hypothetical protein                               235   1e-71    
emb|CDW82130.1|  gtp-binding protein                                    236   2e-71    
ref|XP_005182762.2|  PREDICTED: obg-like ATPase 1                       235   2e-71    
ref|XP_003962811.1|  PREDICTED: obg-like ATPase 1-like                  235   2e-71    
ref|XP_006683298.1|  hypothetical protein BATDEDRAFT_33861              235   3e-71    
emb|CDJ01997.1|  GTP binding protein CG1354                             235   3e-71    
ref|XP_002055571.1|  GJ18714                                            234   3e-71    
ref|XP_001991915.1|  GH11803                                            234   5e-71    
ref|XP_002124995.1|  PREDICTED: obg-like ATPase 1                       234   6e-71    
dbj|GAN04407.1|  GTP-binding protein                                    234   6e-71    
ref|XP_005416153.1|  PREDICTED: obg-like ATPase 1                       241   6e-71    
ref|XP_002772113.1|  GTP-binding protein, putative                      234   7e-71    
gb|EPB88277.1|  obg-like ATPase 1                                       234   8e-71    
ref|XP_002774229.1|  GTP-binding protein, putative                      234   8e-71    
ref|XP_001846949.1|  ras-related protein Rab-10                         233   9e-71    
ref|XP_004347436.1|  GTP-binding protein                                233   1e-70    
ref|NP_727364.1|  CG1354, isoform B                                     232   1e-70    
gb|ACX32983.1|  SD24341p                                                232   2e-70    
ref|XP_005716907.1|  GTP-binding protein of Obg family                  233   2e-70    
ref|XP_003137166.1|  GTP-binding protein                                233   2e-70    
ref|XP_001956259.1|  GF25119                                            233   3e-70    
emb|CDQ02627.1|  Protein BM-TAG-210, isoform c                          232   3e-70    
ref|XP_009497559.1|  GTP-binding protein YchF                           232   3e-70    
ref|XP_009024324.1|  hypothetical protein HELRODRAFT_187336             232   3e-70    
ref|XP_007370743.1|  cytoplasmic protein                                232   3e-70    
ref|XP_002787114.1|  GTP-binding protein, putative                      232   3e-70    
ref|XP_002767889.1|  GTP-binding protein, putative                      232   5e-70    
gb|ENN79155.1|  hypothetical protein YQE_04341                          232   5e-70    
ref|XP_002071025.1|  GK25358                                            232   5e-70    
ref|XP_001977300.1|  GG18324                                            231   6e-70    
ref|XP_010858116.1|  PREDICTED: obg-like ATPase 1 isoform X2            231   7e-70    
ref|NP_572580.1|  CG1354, isoform A                                     231   8e-70    
ref|XP_002041803.1|  GM11387                                            231   9e-70    
ref|XP_002101766.1|  GE17809                                            231   2e-69    
ref|XP_007393236.1|  hypothetical protein PHACADRAFT_251809             230   2e-69    
emb|CDW53501.1|  GTP binding protein CG1354                             230   2e-69    
ref|XP_008472916.1|  PREDICTED: obg-like ATPase 1                       224   2e-69    
gb|AEE61569.1|  unknown                                                 229   4e-69    
gb|KFO72251.1|  Obg-like ATPase 1                                       229   4e-69    
ref|XP_008397279.1|  PREDICTED: obg-like ATPase 1 isoform X2            229   5e-69    
ref|XP_005535678.1|  GTP-binding protein of Obg family                  229   6e-69    
ref|XP_001836147.2|  cytoplasmic protein                                229   6e-69    
gb|EJW81490.1|  GTP-binding protein YchF                                229   7e-69    
emb|CDS05214.1|  hypothetical protein LRAMOSA07743                      229   7e-69    
gb|EFA85891.1|  GTP-binding protein                                     228   8e-69    
ref|XP_005827580.1|  hypothetical protein GUITHDRAFT_75397              228   1e-68    



>gb|KDO75234.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=374

 Score =   411 bits (1056),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  162  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  221

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  222  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  281

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  282  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAV  341

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  342  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  374



>ref|XP_006468322.1| PREDICTED: obg-like ATPase 1-like [Citrus sinensis]
 gb|KDO75235.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=394

 Score =   411 bits (1056),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006448884.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62124.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=394

 Score =   411 bits (1056),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006448885.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
 gb|ESR62125.1| hypothetical protein CICLE_v10015175mg [Citrus clementina]
Length=460

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  248  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  307

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  308  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  367

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  368  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAV  427

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  428  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  460



>gb|EYU43227.1| hypothetical protein MIMGU_mgv1a007827mg [Erythranthe guttata]
Length=394

 Score =   409 bits (1050),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELCL+VK SL+EGKDARL +WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCLRVKASLEEGKDARLVDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE +IPFS +LER+L D+ PDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETMIPFSCSLERNLTDLSPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTY+VQDGD+IFFKFNVSGGGKK
Sbjct  362  KASGKYRQEGKTYIVQDGDIIFFKFNVSGGGKK  394



>gb|KDP34925.1| hypothetical protein JCGZ_09213 [Jatropha curcas]
Length=394

 Score =   408 bits (1049),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHE+C KVK  L++GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHEMCQKVKAWLEDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFSAA ER+LADM PDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSAAFERNLADMTPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAG IH+D ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGTIHSDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KAGG+YRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAGGRYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|AAF65513.1| GTP-binding protein [Capsicum annuum]
Length=394

 Score =   406 bits (1044),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELCL+VK SL+EGKD RLG+WKAADIE+LNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCLRVKASLEEGKDVRLGDWKAADIELLNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG++IIPFSAA+ER+LADMPPDEA+KYCEENK+QS LPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDIIIPFSAAVERNLADMPPDEASKYCEENKLQSCLPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_004231561.1| PREDICTED: obg-like ATPase 1 [Solanum lycopersicum]
Length=394

 Score =   406 bits (1044),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELCL+VK SL EGKD RLG+WKAAD+E LNTFQLLTAKP+VYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCLRVKASLQEGKDVRLGDWKAADVEFLNTFQLLTAKPIVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE+IIPFSAA+ER+LADMPPDEAAKYCEENK+QS LPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEIIIPFSAAVERNLADMPPDEAAKYCEENKLQSCLPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_011085197.1| PREDICTED: obg-like ATPase 1 [Sesamum indicum]
Length=394

 Score =   406 bits (1043),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC++VK SL+EGKDARL EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KLEHELCIRVKASLEEGKDARLVEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LAD+ PDEAAKYCEENKVQSALPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCVLERNLADISPDEAAKYCEENKVQSALPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVS GGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSSGGKK  394



>ref|XP_006360314.1| PREDICTED: obg-like ATPase 1-like [Solanum tuberosum]
Length=394

 Score =   405 bits (1042),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELCL+VK SL+EGKD RLGEWKAADIE LNTFQLLTAKP+VYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCLRVKASLEEGKDVRLGEWKAADIEFLNTFQLLTAKPIVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE+IIPFSAA+ER+LADMPPDEAAKYCEENK+ S LPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEIIIPFSAAVERNLADMPPDEAAKYCEENKLISCLPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDP17295.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKDARLG+WKAADIEILNT QLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIEHELCERVKAWLTDGKDARLGDWKAADIEILNTLQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER L D+PP+EAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSGALERDLTDLPPEEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGDVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  394



>ref|XP_007211399.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
 gb|EMJ12598.1| hypothetical protein PRUPE_ppa006821mg [Prunus persica]
Length=394

 Score =   402 bits (1034),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC K+K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQKIKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD DVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_010051911.1| PREDICTED: obg-like ATPase 1 [Eucalyptus grandis]
 gb|KCW75746.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=394

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHE CLKVK  L++GKD RLGEWKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHECCLKVKAWLEDGKDVRLGEWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LAD+  DEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCALERNLADISADEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRHTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002263885.1| PREDICTED: obg-like ATPase 1 [Vitis vinifera]
 emb|CBI31027.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELCLKVK  L++GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIELELCLKVKAFLEDGKDIRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQ+HGGE IIPFS ALER+LADMP DEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQDHGGETIIPFSCALERNLADMPEDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IH+D ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHSDFERGFICAEVMKFDDLKELGSEGAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD D+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADIIFFKFNVSGGGKK  394



>ref|XP_004293982.1| PREDICTED: obg-like ATPase 1 [Fragaria vesca subsp. vesca]
Length=394

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC ++K  L++GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KVEHELCGRLKAWLEDGKDIRLGDWKAADVEILNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LAD+PPDEAAKYCEENKV+SALPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEKIIPFSCALERNLADLPPDEAAKYCEENKVESALPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR +KAPQAAG IHTD ERGFICAEVMKFEDLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLSKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009362223.1| PREDICTED: obg-like ATPase 1 [Pyrus x bretschneideri]
Length=394

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC K+K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQKIKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD DVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_003546267.1| PREDICTED: obg-like ATPase 1-like [Glycine max]
 gb|KHN14324.1| Obg-like ATPase 1 [Glycine soja]
Length=394

 Score =   399 bits (1026),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C +VK  L+EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQRVKALLEEGKDIRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENK QSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCALERNLADMPPDEAAKYCEENKTQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008225608.1| PREDICTED: obg-like ATPase 1 [Prunus mume]
Length=394

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE+ELC K+K  L++GKD RLGEWKAA++EILNTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIENELCQKIKAWLEDGKDVRLGEWKAAEVEILNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD DVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADVIFFKFNVSGGGKK  394



>ref|NP_001242520.1| uncharacterized protein LOC100793501 [Glycine max]
 gb|ACU21485.1| unknown [Glycine max]
Length=394

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C +VK  L+EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQRVKALLEEGKDIRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENK QSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCALERNLADMPPDEAAKYCEENKTQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008372236.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC K+K  L++GKD RLGEWKAA++EILN FQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQKIKAWLEDGKDVRLGEWKAAEVEILNPFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD DVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_010098556.1| Obg-like ATPase 1 [Morus notabilis]
 gb|EXB75216.1| Obg-like ATPase 1 [Morus notabilis]
Length=394

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHE C KVK  L++GKD RLG+WKAAD+EILN FQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIEHECCQKVKAWLEDGKDVRLGDWKAADVEILNAFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LADMPPDEAA YCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCVLERNLADMPPDEAANYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKE GSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKEHGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008383389.1| PREDICTED: obg-like ATPase 1 [Malus domestica]
Length=394

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC K+K  L+ GKD RLG+WKAA++EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQKIKAWLEGGKDVRLGDWKAAEVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHG E IIPFS ALER+LAD+PP+EAAKYCE+N VQSAL KIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGAEPIIPFSCALERNLADLPPEEAAKYCEQNNVQSALTKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD DVIFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADVIFFKFNVSGGGKK  394



>ref|XP_010245345.1| PREDICTED: obg-like ATPase 1 [Nelumbo nucifera]
Length=394

 Score =   397 bits (1021),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHE C +VK  L+EGKD RLG+WKAADIEI+NT QLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHECCQRVKAWLEEGKDIRLGDWKAADIEIMNTLQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFSA LE++L DMP DEAAKYC ENKVQSALPKIIK GFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSAVLEKNLTDMPEDEAAKYCAENKVQSALPKIIKIGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGVIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009803590.1| PREDICTED: obg-like ATPase 1 [Nicotiana sylvestris]
Length=394

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHEL L+V  SL EGKD RLG+WKAAD+E LNTFQLLTAKPVVYLVNMNEKDY RKKN
Sbjct  182  KIEHELSLRVMASLKEGKDIRLGDWKAADVEFLNTFQLLTAKPVVYLVNMNEKDYARKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE+IIPFSAA+ER+LADMPPDEA+KYCEENK+QS LPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEIIIPFSAAVERNLADMPPDEASKYCEENKLQSCLPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009412029.1| PREDICTED: obg-like ATPase 1 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   395 bits (1015),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC ++K  L++GKD RLG+WKAAD+EILN+FQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCDRIKAWLNDGKDVRLGDWKAADVEILNSFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIP S  LE+ L DMP DEAAKYCEENKVQS LPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEPIIPVSCVLEKKLVDMPEDEAAKYCEENKVQSVLPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009603694.1| PREDICTED: obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167} 
[Nicotiana tomentosiformis]
Length=394

 Score =   395 bits (1015),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHEL L+V  SL EGKD RLG+WKAADIE LNTFQLLTAKPVVYLVNMNEKDY RKKN
Sbjct  182  KIEHELSLRVMASLKEGKDIRLGDWKAADIEFLNTFQLLTAKPVVYLVNMNEKDYARKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE+IIPFSAA+ER+LADMPPDEA++YCEENK+QS LPKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGEIIIPFSAAVERNLADMPPDEASQYCEENKLQSCLPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR  KAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLMKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010478480.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010499597.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010460862.1| PREDICTED: obg-like ATPase 1 [Camelina sativa]
Length=394

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ER+LADMPPDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERTLADMPPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010926935.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926936.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
 ref|XP_010926937.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC KV   L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KLEHELCEKVTAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQ+HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQDHGGEPIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFE+LKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEELKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006377958.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
 gb|ERP55755.1| hypothetical protein POPTR_0011s16690g [Populus trichocarpa]
Length=394

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC KVK  L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKN
Sbjct  182  KIELELCQKVKAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+QS LPKI+K GFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQSCLPKILKIGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KJB69089.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=394

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKN
Sbjct  182  KIEHELCERVKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_011037748.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   393 bits (1009),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC KV   L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKN
Sbjct  182  KIELELCQKVNAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+QS LPKIIK GFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQSCLPKIIKIGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_007147477.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
 gb|ESW19471.1| hypothetical protein PHAVU_006G127800g [Phaseolus vulgaris]
Length=394

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C +VK  L EGKD RLG+WKAADIEILN+FQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQRVKALLLEGKDVRLGDWKAADIEILNSFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS A ER+L+D+PPDEAAKYCEENK+QSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCAFERNLSDLPPDEAAKYCEENKIQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKE  SE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKEHSSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006305006.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
 gb|EOA37904.1| hypothetical protein CARUB_v10009370mg [Capsella rubella]
Length=394

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERTLADMAPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010519060.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC +VK  L++GKD RLGEWKAADIEILNTFQLL+AKPVVYLVNM E+DYQRKKN
Sbjct  183  KIELELCQRVKAWLEDGKDIRLGEWKAADIEILNTFQLLSAKPVVYLVNMTERDYQRKKN  242

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM PDEAAKYCEENKVQSAL KIIKTGFSA
Sbjct  243  KFLPKIHAWVQEHGGEQIIPFSGVLERNLADMLPDEAAKYCEENKVQSALSKIIKTGFSA  302

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELG+E AV
Sbjct  303  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGNEGAV  362

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  363  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  395



>ref|XP_010687083.1| PREDICTED: obg-like ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=394

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHE CLKVKT L+EGKD RLG+WKAAD+E+LNTFQLLTAKPVVYLVNM E+DYQRKKN
Sbjct  182  KLEHETCLKVKTWLEEGKDIRLGDWKAADVEVLNTFQLLTAKPVVYLVNMTERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHG E IIPFS   ER+ ADMP DEAAKYC+ENKVQSA+PKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGAEPIIPFSGVFERNYADMPEDEAAKYCDENKVQSAIPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMK+EDLKE G+E AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKYEDLKEHGNEGAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002893634.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69893.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|NP_001061206.2| Os08g0199300 [Oryza sativa Japonica Group]
 dbj|BAD03576.1| putative GTP-binding protein [Oryza sativa Japonica Group]
 dbj|BAG88257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93810.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68206.1| hypothetical protein OsJ_26368 [Oryza sativa Japonica Group]
 dbj|BAF23120.2| Os08g0199300 [Oryza sativa Japonica Group]
Length=394

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC KVK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKN
Sbjct  182  KLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS A ER LADMPPDEAAKYC EN++ S +PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KHF97630.1| Obg-like ATPase 1 [Gossypium arboreum]
Length=394

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC +VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM E+DYQRKKN
Sbjct  182  KVEHELCERVKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KFK44867.1| hypothetical protein AALP_AA1G312800 [Arabis alpina]
Length=394

 Score =   390 bits (1003),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -1

Query  740  IEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNK  561
            +E EL LKVK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNK
Sbjct  183  VELELLLKVKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNK  242

Query  560  FLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            FLPKIHAWVQEHGG+ +IPFS   ER++ADM PDEAAKYCEENK+QSALP+IIKTGFSAI
Sbjct  243  FLPKIHAWVQEHGGDTMIPFSGVFERTIADMAPDEAAKYCEENKLQSALPRIIKTGFSAI  302

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK
Sbjct  303  NLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVK  362

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  363  AAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|NP_174346.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAD25745.1|AC007060_3 Similar to WO8E3.3 gi|3880615 putative GTP-binding protein from 
C. elegans cosmid gb|Z92773. EST gb|AA597331 comes from this 
gene [Arabidopsis thaliana]
 gb|ABG25054.1| At1g30580 [Arabidopsis thaliana]
 gb|AEE31246.1| GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   390 bits (1002),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+N+NE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINLNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002523184.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
 gb|EEF39215.1| GTP-dependent nucleic acid-binding protein engD, putative [Ricinus 
communis]
Length=394

 Score =   390 bits (1002),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC +VK  L++ KD RLG+WKAA+IEI+NTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIELELCQRVKAWLEDEKDVRLGDWKAAEIEIMNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAW+QEHGGE IIPFS  LE++LAD+ PDEA KYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWLQEHGGETIIPFSCVLEQNLADISPDEATKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD E+GFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|EEC83063.1| hypothetical protein OsI_28170 [Oryza sativa Indica Group]
Length=394

 Score =   390 bits (1002),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC KVK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKN
Sbjct  182  KLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS A ER LADMPPDEAAKYC EN++ S +PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQD D+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDADIIFFKFNVSGGGKK  394



>ref|XP_011039799.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=394

 Score =   390 bits (1002),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E+C +VK  L+E KD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIEMEMCQRVKAWLEEEKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIH WVQEHGGE IIPFS  LER+LADM P E AKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHTWVQEHGGETIIPFSCVLERNLADMLPHEGAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTK PQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKTPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDY12460.1| BnaC08g09490D [Brassica napus]
Length=394

 Score =   390 bits (1001),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+E +L LKVK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KVELDLLLKVKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KGAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002300568.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
 gb|EEE85373.1| hypothetical protein POPTR_0001s47010g [Populus trichocarpa]
Length=394

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E+C +VK  L+E KD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIEMEMCQRVKAWLEEEKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIH WVQEHGGE IIPFS  LER+LADM P EA KYCEENKVQSAL KIIKTGFSA
Sbjct  242  KFLPKIHTWVQEHGGETIIPFSCILERNLADMLPHEADKYCEENKVQSALSKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KAGGKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAGGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008799072.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799073.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799075.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799076.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
 ref|XP_008799077.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=394

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC KVK  L +GKDAR G+WKAAD+EILNT QLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCEKVKAWLKDGKDARGGDWKAADVEILNTLQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQ+HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQDHGGEPIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IH+D E+GFICAEVMKFE+LKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHSDFEKGFICAEVMKFEELKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_006659204.1| PREDICTED: obg-like ATPase 1-like [Oryza brachyantha]
Length=394

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC KVK  L++GKD R G+WK+ADIEILNTFQLLTAKPVVYLVNM+EKDYQRKKN
Sbjct  182  KIEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS A ER+LADMP DEAAKYC EN++ S + KIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCAFERNLADMPQDEAAKYCAENQITSVISKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEV+CWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  IHLIYFFTAGPDEVRCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|AAM63059.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=394

 Score =   388 bits (997),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE EL  KVK  L++GKD R G+WK ADIEILNTFQLL+AKPVVYL+N+NE+DYQRKKN
Sbjct  182  KIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLINLNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+EPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNEPAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTY VQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYFVQDGDIIFFKFNVSGGGKK  394



>ref|XP_007022926.1| GTP binding [Theobroma cacao]
 gb|EOY25548.1| GTP binding [Theobroma cacao]
Length=394

 Score =   388 bits (996),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC KVK+ L++GKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELELCQKVKSWLEDGKDIRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS   ER+L DM  +EAAKYCEENK+QSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSGVFERNLVDMESEEAAKYCEENKLQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAG DEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AV
Sbjct  302  INLIYFFTAGADEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_008445378.1| PREDICTED: obg-like ATPase 1 [Cucumis melo]
Length=395

 Score =   388 bits (996),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 196/214 (92%), Gaps = 1/214 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK SL+EGKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQKVKASLEEGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMP-PDEAAKYCEENKVQSALPKIIKTGFS  387
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM  P +  KYCEENK+QSALPKIIKTGFS
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSGVLERNLADMSSPADVEKYCEENKIQSALPKIIKTGFS  301

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKELGSE A
Sbjct  302  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKELGSETA  361

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            VKA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  VKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  395



>ref|XP_003573525.1| PREDICTED: obg-like ATPase 1 [Brachypodium distachyon]
Length=394

 Score =   387 bits (994),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +V   L EGKD RLGEWK+A+IEILNTFQLLTAKPVVYLVNM+EKDYQRKKN
Sbjct  182  KIEHELCQRVMAHLREGKDVRLGEWKSAEIEILNTFQLLTAKPVVYLVNMSEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCAFEQKLVDMPADEAAKYCAENQITSLIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010941555.1| PREDICTED: obg-like ATPase 1 [Elaeis guineensis]
Length=394

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC K+K  L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCEKIKAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQ+HGGE IIPFS   E++L DMP  EA KYCE NK+QSA+PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQDHGGEPIIPFSCVFEKNLVDMPEGEAPKYCEANKIQSAIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIH+D E+GFICAEVMKFEDLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHSDFEKGFICAEVMKFEDLKELGSEAAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_010538270.1| PREDICTED: obg-like ATPase 1 [Tarenaya hassleriana]
Length=395

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC +VK  L++GKD RLG+WK ADIEI+NTFQLLTAKPVVYLVNM E+DYQRKKN
Sbjct  183  KIELELCQRVKAWLEDGKDIRLGDWKTADIEIMNTFQLLTAKPVVYLVNMTERDYQRKKN  242

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADM PDEAAKYCEEN VQS LPKIIKTGFSA
Sbjct  243  KFLPKIHAWVQEHGGEPIIPFSGALERNLADMLPDEAAKYCEENTVQSVLPKIIKTGFSA  302

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IH+D E+GFICAEVMKFEDL ELGSE AV
Sbjct  303  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHSDFEKGFICAEVMKFEDLMELGSEGAV  362

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVV DGDVIFFKFNVSGGGKK
Sbjct  363  KAAGKYKQEGKTYVVHDGDVIFFKFNVSGGGKK  395



>gb|AFK48623.1| unknown [Lotus japonicus]
Length=394

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  ++EGKD RLGEWKAAD +ILN+FQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQKVKAYIEEGKDVRLGEWKAADTDILNSFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG  IIPFS  LER+LAD+P DE AKYCEENKVQSALP+IIKTGF+A
Sbjct  242  KFLPKIHAWVQEHGGGSIIPFSGVLERNLADLPSDEVAKYCEENKVQSALPEIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELG+E AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGTESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|KJB69090.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=361

 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  740  IEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNK  561
            I  EL LKVK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKNK
Sbjct  150  ISAELRLKVKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKNK  209

Query  560  FLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            FLPKIHAWVQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSAI
Sbjct  210  FLPKIHAWVQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSAI  269

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AVK
Sbjct  270  NLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAVK  329

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  330  AAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  361



>ref|XP_004486463.1| PREDICTED: obg-like ATPase 1-like [Cicer arietinum]
Length=394

 Score =   385 bits (989),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  L+EGKD RLG+WKAA++EILN+FQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQKVKAHLEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAGAIHTD E+GFICAEVMKFEDLKELG+E AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLTKAPQAAGAIHTDFEKGFICAEVMKFEDLKELGTESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_002445191.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
 gb|EES14686.1| hypothetical protein SORBIDRAFT_07g005700 [Sorghum bicolor]
Length=393

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+EHELC +V   L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM+EKD+QRKKN
Sbjct  181  KVEHELCERVVAHLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMSEKDFQRKKN  240

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+A
Sbjct  241  KFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAA  300

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  301  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  360

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  361  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  393



>ref|NP_001150211.1| GTP-binding protein PTD004 [Zea mays]
 gb|ACF85733.1| unknown [Zea mays]
 gb|ACG38260.1| GTP-binding protein PTD004 [Zea mays]
 gb|AFW56961.1| GTP-binding protein PTD004 [Zea mays]
Length=393

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +V   L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYLVNM+EKD+QRKKN
Sbjct  181  KIEHELCERVIGHLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMSEKDFQRKKN  240

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+A
Sbjct  241  KFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAA  300

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  301  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  360

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  361  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  393



>ref|XP_004135546.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 ref|XP_004158075.1| PREDICTED: obg-like ATPase 1-like [Cucumis sativus]
 gb|KGN65918.1| hypothetical protein Csa_1G538160 [Cucumis sativus]
Length=395

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 195/214 (91%), Gaps = 1/214 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK SL+EGKD RLG+WKA+D+EILNTFQLLTAKPVVYLVNM EKDYQRKKN
Sbjct  182  KIELECCQKVKASLEEGKDIRLGDWKASDVEILNTFQLLTAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMP-PDEAAKYCEENKVQSALPKIIKTGFS  387
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM  P +  KYCEENK+QSALPKIIKTGFS
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSGVLERNLADMSSPADVEKYCEENKIQSALPKIIKTGFS  301

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            AINLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD E+GFICAEVMKFEDLKE GSE A
Sbjct  302  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFEKGFICAEVMKFEDLKEHGSETA  361

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            VKA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  VKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  395



>ref|XP_003594539.1| Obg-like ATPase [Medicago truncatula]
 gb|AES64790.1| GTP-binding protein [Medicago truncatula]
Length=394

 Score =   382 bits (981),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKN
Sbjct  182  KIELECCQKVKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIH WVQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSA
Sbjct  242  KFLPKIHTWVQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>gb|ACJ85184.1| unknown [Medicago truncatula]
Length=394

 Score =   382 bits (981),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKN
Sbjct  182  KIELECCQKVKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIH WVQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSA
Sbjct  242  KFLPKIHTWVQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>ref|XP_004972629.1| PREDICTED: obg-like ATPase 1-like [Setaria italica]
Length=393

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +V   L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNM+EKD+QRKKN
Sbjct  181  KIEHELCERVIKHLQDGKDIRLGDWKAADIEILNTFQLLTAKPVVYLVNMSEKDFQRKKN  240

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+A
Sbjct  241  KFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAA  300

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKF++LKELGSE AV
Sbjct  301  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFDELKELGSESAV  360

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  361  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  393



>gb|ABK25108.1| unknown [Picea sitchensis]
Length=392

 Score =   380 bits (975),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  L+EGKD RLG+WKAA++EILNTFQLL+AKPVVYLVNM EKDYQRKKN
Sbjct  181  KIEMECCQKVKAWLEEGKDVRLGDWKAAEVEILNTFQLLSAKPVVYLVNMTEKDYQRKKN  240

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+LPKIH+WVQ HGGE IIPFS ALE+ LADMPPDEAAKYCEENK QSAL KIIKTGFSA
Sbjct  241  KYLPKIHSWVQGHGGEPIIPFSGALEQKLADMPPDEAAKYCEENKTQSALTKIIKTGFSA  300

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQ+R+Q KAPQAAGAIHTD ERGFICAEVMK EDLKELGSE AV
Sbjct  301  INLIYFFTAGPDEVKCWQVRKQIKAPQAAGAIHTDFERGFICAEVMKVEDLKELGSESAV  360

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            KAGGKYRQEGKTYVVQDGD+I FKFNVSGG K
Sbjct  361  KAGGKYRQEGKTYVVQDGDIILFKFNVSGGKK  392



>gb|AFK49195.1| unknown [Medicago truncatula]
Length=401

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE E C KVK  ++EGKD RLG+WKAA++EILN+FQLLTAKPVVYL+NM E+DYQRKKN
Sbjct  182  KIELECCQKVKAFIEEGKDVRLGDWKAAEVEILNSFQLLTAKPVVYLINMTERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIH WVQEHGG  +IPFS  LE++L+DMPPDEAAKYCE N VQSALPKIIKTGFSA
Sbjct  242  KFLPKIHTWVQEHGGGQMIPFSCVLEKNLSDMPPDEAAKYCEANNVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRR TKAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRLTKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGG++
Sbjct  362  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGEE  394



>ref|XP_006415450.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
 gb|ESQ33803.1| hypothetical protein EUTSA_v10007733mg [Eutrema salsugineum]
Length=419

 Score =   380 bits (975),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  220  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  279

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ERSLADMPPDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  280  GGDTMIPFSGVFERSLADMPPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  339

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            VKCWQIRR +KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  340  VKCWQIRRLSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  399

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            +VQDGD+IFFKFNVSGGGKK
Sbjct  400  IVQDGDIIFFKFNVSGGGKK  419



>ref|XP_009107765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
 emb|CDY47157.1| BnaA08g05260D [Brassica napus]
Length=394

 Score =   378 bits (971),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>emb|CDX98216.1| BnaC07g08820D [Brassica napus]
Length=394

 Score =   377 bits (968),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>emb|CDX77584.1| BnaA07g07220D [Brassica napus]
Length=394

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>ref|XP_009144765.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=394

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  195  LEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  254

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ER+LADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFTAGPDE
Sbjct  255  GGDTMIPFSGVFERTLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE  314

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            VKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELG+E AVK  GKYRQEGKTY
Sbjct  315  VKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGNETAVKGAGKYRQEGKTY  374

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            VVQDGD+IFFKFNVSGGGKK
Sbjct  375  VVQDGDIIFFKFNVSGGGKK  394



>emb|CDM85617.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   373 bits (958),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KI+HELC +V   L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM++KDY RKKN
Sbjct  182  KIDHELCQRVMAHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSKKDYLRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWV+EHGGE IIPFS A E+ L DMP DEAAKYC EN+  S +PKIIKTGF+A
Sbjct  242  KFLPKIHAWVKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTASLIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  302  IHLIYFFTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  394



>emb|CDY02308.1| BnaA09g25940D [Brassica napus]
Length=394

 Score =   372 bits (956),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+E +L LKVK  L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  182  KVELDLLLKVKAWLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFT G  EV+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AV
Sbjct  302  INLIYFFTVGHGEVRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEYGNETAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  GKYRQEGKTYVV DGD+I FKFNVSGGGKK
Sbjct  362  KGAGKYRQEGKTYVVLDGDIIHFKFNVSGGGKK  394



>emb|CDY09558.1| BnaC05g23610D [Brassica napus]
Length=397

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+E +L LKVK  L+EGKD R G+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKN
Sbjct  185  KVELDLLLKVKAWLEEGKDVRFGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKN  244

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGG+ +IPFS   ERSLAD+ PDEAAKYCEENK+QSALP+IIKTGFSA
Sbjct  245  KFLPKIHAWVQEHGGDTMIPFSGVFERSLADILPDEAAKYCEENKLQSALPRIIKTGFSA  304

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFT G  EV+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AV
Sbjct  305  INLIYFFTVGHGEVRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEFGNETAV  364

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  GKYRQEGKTYVV DGD+I+FKFNVSGGGKK
Sbjct  365  KGAGKYRQEGKTYVVLDGDIIYFKFNVSGGGKK  397



>gb|EMS48297.1| Obg-like ATPase 1 [Triticum urartu]
Length=397

 Score =   370 bits (950),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 191/216 (88%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KI+HELC +V T L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKN
Sbjct  182  KIDHELCQRVMTHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA---LPKIIKTG  393
            KFLPKIHAWV+EHGGE IIPFS A E+ L DMP DEAAKYC EN+       +PKIIKTG
Sbjct  242  KFLPKIHAWVKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTARQVILIPKIIKTG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+AI+LIYFFTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE
Sbjct  302  FAAIHLIYFFTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  SAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  397



>gb|EMT28525.1| Obg-like ATPase 1 [Aegilops tauschii]
Length=397

 Score =   369 bits (946),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 191/216 (88%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KI+HELC +V T L +GKD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKN
Sbjct  182  KIDHELCQRVMTHLQDGKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA---LPKIIKTG  393
            KFLPKIHAWV++HGGE IIPFS A E+ L DMP DEAAKYC EN+       +PKIIKTG
Sbjct  242  KFLPKIHAWVKDHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTARQVILIPKIIKTG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+AI+LIYFFTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE
Sbjct  302  FAAIHLIYFFTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  SAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  397



>ref|XP_009115125.1| PREDICTED: obg-like ATPase 1 [Brassica rapa]
Length=395

 Score =   362 bits (930),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL+NMNE+DYQRKKNKFLPKIHAWVQEH
Sbjct  196  LEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYLINMNERDYQRKKNKFLPKIHAWVQEH  255

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ +IPFS   ERSLADM PDEAAKYCEENK+QSALP+IIKTGFSAINLIYFFT G  E
Sbjct  256  GGDTMIPFSGVFERSLADMLPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTVGHGE  315

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            V+CWQIRRQ+KAPQAAGAIH+D ERGFICAEVMKFED+KE G+E AVK  GKYRQEGKTY
Sbjct  316  VRCWQIRRQSKAPQAAGAIHSDFERGFICAEVMKFEDIKEYGNETAVKGAGKYRQEGKTY  375

Query  164  VVQDGDVIFFKFNVSGGGKK  105
            VV DGD+I+FKFNVSGGGKK
Sbjct  376  VVLDGDIIYFKFNVSGGGKK  395



>ref|XP_001776504.1| predicted protein [Physcomitrella patens]
 gb|EDQ58637.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   353 bits (905),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+E E C KV   L + KD RLG+WK A+IEILNTFQLL+AKPVVYL+NM EKDYQRKKN
Sbjct  182  KMELECCQKVYDWLKQEKDVRLGDWKTAEIEILNTFQLLSAKPVVYLINMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L KIHAWVQEHGG ++IPFS  LE+ LADMP DEAA YC+EN + SALPKIIKTGF+A
Sbjct  242  KWLAKIHAWVQEHGGGVLIPFSGVLEQKLADMPADEAAVYCKENDLVSALPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIR+Q+KAPQAAGAIHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  302  INLIYFFTAGPDEVKCWQIRKQSKAPQAAGAIHTDFERGFICAEVMKFDDLKELGSESAV  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGK YVVQDGD+IFFKFNV+  GKK
Sbjct  362  KAAGKYKQEGKNYVVQDGDIIFFKFNVTASGKK  394



>gb|KDO75236.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=406

 Score =   350 bits (897),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSEPAV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSEPAV  361

Query  203  KAG  195
            K  
Sbjct  362  KVN  364



>ref|XP_011015196.1| PREDICTED: obg-like ATPase 1 [Populus euphratica]
Length=392

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 184/213 (86%), Gaps = 2/213 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE ELC KVK  L+E KD RLGEWKAADIEILNTFQLLTAKPVVYL+NMNEKDYQRKKN
Sbjct  182  KIELELCQKVKAWLEEEKDVRLGEWKAADIEILNTFQLLTAKPVVYLINMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS  LER+LADM PDEAAKYCEENK+Q  + +        
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCILERTLADMLPDEAAKYCEENKLQRLVLR--SQWLVN  299

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+ ++FF +  D+VKCWQIRRQTKAPQAAG IHTD ERGFICAEVMKF+DLKELGSE AV
Sbjct  300  ISQVFFFFSFEDQVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAV  359

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  360  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  392



>ref|XP_002985543.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
 ref|XP_002987026.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ11869.1| hypothetical protein SELMODRAFT_158442 [Selaginella moellendorffii]
 gb|EFJ13417.1| hypothetical protein SELMODRAFT_234816 [Selaginella moellendorffii]
Length=389

 Score =   336 bits (862),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 179/212 (84%), Gaps = 7/212 (3%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K+E E C KV  SL +GKD RL EWK ++IE LNTFQLL+AKPVVYLVNM EKDY RKKN
Sbjct  185  KLELECCHKVHESLKQGKDVRLVEWKQSEIEFLNTFQLLSAKPVVYLVNMTEKDYLRKKN  244

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+LPKIHAWVQEHGG+ +IPFS  LE+ LAD P DEAA       VQSALPKIIKTGF+A
Sbjct  245  KWLPKIHAWVQEHGGDPLIPFSGVLEQRLADAPSDEAA-------VQSALPKIIKTGFAA  297

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLIYFFTAGPDEVKCWQIR+ +KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  298  INLIYFFTAGPDEVKCWQIRKHSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEAAV  357

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            KA GKY+QEGK YVVQDGD+IFFKFNV+   K
Sbjct  358  KAAGKYKQEGKNYVVQDGDIIFFKFNVTAAKK  389



>ref|XP_008812127.1| PREDICTED: obg-like ATPase 1 [Phoenix dactylifera]
Length=412

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 184/231 (80%), Gaps = 18/231 (8%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC KVK  L +GKD RLG+WKAAD+EILNTFQLLTAKPVVYLVNMNE+DYQRKKN
Sbjct  182  KIEHELCEKVKAWLKDGKDVRLGDWKAADVEILNTFQLLTAKPVVYLVNMNERDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQ HGGE IIPFS  LE++L DMP DEAAKYCEENKVQSA+PKIIKTGF+A
Sbjct  242  KFLPKIHAWVQNHGGETIIPFSCVLEKNLVDMPEDEAAKYCEENKVQSAIPKIIKTGFAA  301

Query  383  INLIYFFTAGPDEVKCWQ-----IRRQTKAPQAAGAIHTDLERGFI-------------C  258
            INL+YFFTAGPDEVKC        R +  A     + + ++ R ++             C
Sbjct  302  INLVYFFTAGPDEVKCCYNSFVLHRIRCLADMLLESKYLEISRSYVFAFHEMVFYLELYC  361

Query  257  AEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             +VMKFEDLKELGSE AVKA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  362  LQVMKFEDLKELGSEAAVKAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  412



>gb|AAP43929.1| GTP-binding protein [Triticum aestivum]
Length=232

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KI+HELC +V   L + KD RLGEWKAA+IEILN FQLLTAKPVVYLVNM+EKDY RKKN
Sbjct  10   KIDHELCQRVMAHLQDRKDVRLGEWKAAEIEILNAFQLLTAKPVVYLVNMSEKDYLRKKN  69

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWV+EHGGE IIPFS A E+ L DMP DEAAKYC EN+  S +PKIIKTGF+A
Sbjct  70   KFLPKIHAWVKEHGGETIIPFSCAFEQKLVDMPEDEAAKYCAENQTASLIPKIIKTGFAA  129

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAG DEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  130  IHLIYFFTAGHDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  189

Query  203  KAGGKYR  183
            KA GKYR
Sbjct  190  KAAGKYR  196



>gb|AFW56960.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=369

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 172/213 (81%), Gaps = 24/213 (11%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +V   L+EGKD RLG+WKAADIEILNTFQLL+AKPVVYL             
Sbjct  181  KIEHELCERVIGHLEEGKDVRLGDWKAADIEILNTFQLLSAKPVVYL-------------  227

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
                       EHGGE I+PFS A E+ L DMP DEAAKYC EN++ S +PKIIKTGF+A
Sbjct  228  -----------EHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSMIPKIIKTGFAA  276

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  277  IHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  336

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  337  KAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  369



>gb|KDO75237.1| hypothetical protein CISIN_1g015465mg [Citrus sinensis]
Length=350

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L +GKD RLG+WKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LADMPPDEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEQIIPFSCALERNLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVM  246
            INLIYFFTAGPDEVKCWQIRRQTKAPQAAG IHTD ERGFICAEV+
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVV  347



>gb|AFW56959.1| hypothetical protein ZEAMMB73_810066 [Zea mays]
Length=164

 Score =   303 bits (775),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  596  MNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSA  417
            M+EKD+QRKKNKFLPKIHAWVQEHGGE I+PFS A E+ L DMP DEAAKYC EN++ S 
Sbjct  1    MSEKDFQRKKNKFLPKIHAWVQEHGGETILPFSCAFEQKLVDMPEDEAAKYCAENQITSM  60

Query  416  LPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFE  237
            +PKIIKTGF+AI+LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFE
Sbjct  61   IPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFE  120

Query  236  DLKELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            DLKELGSE AVKA GKY+QEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  121  DLKELGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK  164



>gb|KJB69091.1| hypothetical protein B456_011G005000 [Gossypium raimondii]
Length=357

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHELC +VK  L + KD RLG+WKAADIEILNTFQLL+AKPVVYLVNM EKDYQRKKN
Sbjct  182  KIEHELCERVKAWLADEKDVRLGDWKAADIEILNTFQLLSAKPVVYLVNMTEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS   ER+LADM P +AAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGEPIIPFSGVFERNLADMEPADAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEV  249
            INLIYFFTAGPDEVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEV
Sbjct  302  INLIYFFTAGPDEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEV  346



>ref|XP_001699763.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP07459.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=391

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            E E   ++   L++  D R G+W A D+E LN +QLLTAKP VYLVNM+E D+ RKKNKF
Sbjct  181  ELECAGRILEHLNKEIDVRFGDWSAKDVEWLNEYQLLTAKPAVYLVNMSENDFARKKNKF  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAIN  378
            LPKIH WVQ HGGE IIPFSA+ E  + DMP DE  KYC+E  V   LPKII TGF AI+
Sbjct  241  LPKIHEWVQAHGGEPIIPFSASFENKINDMPDDEKDKYCKELGVVCQLPKIITTGFRAIH  300

Query  377  LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKA  198
            LIYFFTAG DEVKCWQIR+  KAPQAAG IHTD ERGFICAEVMKFE+LKELG+E AVKA
Sbjct  301  LIYFFTAGEDEVKCWQIRQGAKAPQAAGTIHTDFERGFICAEVMKFEELKELGTESAVKA  360

Query  197  GGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             GKYRQ+GK YVV DGD+IFFKFNV+  GKK
Sbjct  361  AGKYRQQGKEYVVTDGDIIFFKFNVTSSGKK  391



>ref|XP_002953429.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
 gb|EFJ45402.1| hypothetical protein VOLCADRAFT_105955 [Volvox carteri f. nagariensis]
Length=391

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            E E   ++   L++  D R GEW A D+E LN +QLLTAKP VYLVNM+E D+ RKKNKF
Sbjct  181  ELECANRILEHLNKEVDVRFGEWGAKDVEWLNEYQLLTAKPAVYLVNMSETDFARKKNKF  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAIN  378
            LPKIH WVQ HGGE IIPFSAA E  + +MP DE  KYC+E  V S LPKII TGF AI+
Sbjct  241  LPKIHEWVQAHGGEPIIPFSAAFENKIFEMPDDEKDKYCKEAGVISMLPKIITTGFKAIH  300

Query  377  LIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKA  198
            LIYFFTAG DEVKCWQIR+ TKAPQAAG IHTD ERGFICAEVMK+++LKELGSE AVKA
Sbjct  301  LIYFFTAGDDEVKCWQIRQGTKAPQAAGTIHTDFERGFICAEVMKYDELKELGSEGAVKA  360

Query  197  GGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             GKYRQ+GK YVV DGD+I+FKFNV+   KK
Sbjct  361  AGKYRQQGKEYVVTDGDIIYFKFNVTSSAKK  391



>gb|EMS48298.1| Obg-like ATPase 1 [Triticum urartu]
Length=347

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 162/213 (76%), Gaps = 39/213 (18%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KI+HELC ++ T L +GKD RLGEWKAA+IEILNTFQLLTAKPVVYLVNM+EKDY RKKN
Sbjct  174  KIDHELCQRIMTHLQDGKDLRLGEWKAAEIEILNTFQLLTAKPVVYLVNMSEKDYLRKKN  233

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHA +                                       +PKIIKTGF+A
Sbjct  234  KFLPKIHACL---------------------------------------IPKIIKTGFAA  254

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            I+LIYFFTAG  EVKCWQIRRQ+KAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE AV
Sbjct  255  IHLIYFFTAGHGEVKCWQIRRQSKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSESAV  314

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            KA GKYRQEGKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  315  KAAGKYRQEGKTYVVQDGDIIFFKFNVSGGGKK  347



>ref|XP_005847323.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
 gb|EFN55221.1| hypothetical protein CHLNCDRAFT_56178 [Chlorella variabilis]
Length=390

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -1

Query  704  LDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEH  525
            L+EGKD R GEW   D++ LNT Q LTAKPVVYLVN++E+DYQRKKNK+L K+  WV+ H
Sbjct  191  LEEGKDIRFGEWTQKDVDWLNTVQFLTAKPVVYLVNLSERDYQRKKNKWLVKLFEWVKAH  250

Query  524  GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDE  345
            GG+ IIPFS ALE  L DMP DE   YC+E++VQSALPKI+  GF A+ LIY+FTAG  E
Sbjct  251  GGDPIIPFSGALEAKLLDMPEDEREVYCQEHEVQSALPKIVTAGFKAVRLIYYFTAGVQE  310

Query  344  VKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTY  165
            V+CWQIR  TKAPQAAGAIH+D ERGFICAEVM F D+KE GSE AVK+ G +RQEGKTY
Sbjct  311  VRCWQIREHTKAPQAAGAIHSDFERGFICAEVMAFADMKEHGSEAAVKSAGNWRQEGKTY  370

Query  164  VVQDGDVIFFKFNVSGGGKK  105
             VQDGD+I +KFNV+ GGKK
Sbjct  371  EVQDGDIIHWKFNVTSGGKK  390



>gb|KDD75506.1| DUF933 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=398

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  716  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  537
            V   L+EGKD RLG+W A ++E LN  Q +TAKPV+YL N++EKDY RKKNK+L K+HAW
Sbjct  195  VANWLEEGKDIRLGDWTAIEVEFLNANQFITAKPVIYLANLSEKDYIRKKNKWLVKLHAW  254

Query  536  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  357
            V+ HGG  IIPFS  LE  L DMP DE A YC+EN+  SA+PKII +GF A+NLIYFFT 
Sbjct  255  VEAHGGGQIIPFSGQLEGKLLDMPEDERAVYCKENECVSAIPKIITSGFRAVNLIYFFTC  314

Query  356  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  177
            GP+EV+CWQIR+ +KAPQAAGAIH+D ERGFICAEVM++ DL E+G+E AVKA GKY+QE
Sbjct  315  GPEEVRCWQIRKYSKAPQAAGAIHSDFERGFICAEVMRYSDLHEIGNEQAVKAAGKYKQE  374

Query  176  GKTYVVQDGDVIFFKFNVSGGGKK  105
            GK YVV+DGD+I+FKFNV+   KK
Sbjct  375  GKNYVVEDGDIIYFKFNVTADKKK  398



>ref|XP_005650863.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26319.1| flagellar associated protein [Coccomyxa subellipsoidea C-169]
Length=392

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            KVK  ++ G D R GEW   +++ LNT QL+TAKPVVYLVN+ EK Y +KK+K+LPKI  
Sbjct  188  KVKDFVETGVDVRFGEWNLKEVDFLNTVQLITAKPVVYLVNLTEKAYIKKKSKWLPKIFE  247

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            WV+EHGGE IIPFS  LE  L DMP DE A Y +EN+   ALPKII TGF +I LIYFFT
Sbjct  248  WVKEHGGEPIIPFSGVLESKLFDMPDDEKATYLKENEAMCALPKIITTGFKSIQLIYFFT  307

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
            AG DEVKCWQIR+ TKAPQAAGAIHTD ERGFICAEVM +++L ELG+E A +A GKYRQ
Sbjct  308  AGEDEVKCWQIRKGTKAPQAAGAIHTDFERGFICAEVMHYDELHELGTESAARAAGKYRQ  367

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            EGK YVV DGDVI+FKFNV+  GKK
Sbjct  368  EGKNYVVLDGDVIYFKFNVTASGKK  392



>ref|XP_003064009.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51631.1| predicted protein [Micromonas pusilla CCMP1545]
Length=400

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E E   KV   L++GK+ R G  +W   D++ LNT+QLLT+KPV+YLVN+ EKDY RK
Sbjct  186  KTELECVEKVIAWLEDGKEIRNGMEQWSTTDVDFLNTYQLLTSKPVIYLVNLTEKDYARK  245

Query  569  KNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            KNK+L KIHAWV EHGG  IIPFS A E  L D+P DE A++ ++ ++ + LPKIIKT F
Sbjct  246  KNKWLAKIHAWVMEHGGGTIIPFSGAFECELQDVPEDEKAQFQKDKEMTTILPKIIKTAF  305

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
            S I+LIYFFTAGPDEVK W IR+  KAPQAAGAIHTD ERGFICAEVM FE LKELGSE 
Sbjct  306  STIHLIYFFTAGPDEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFETLKELGSEQ  365

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             VKA GKY+QEGKTY+V DGDVIFFKFNV+  GKK
Sbjct  366  EVKAKGKYKQEGKTYLVNDGDVIFFKFNVTAKGKK  400



>ref|XP_011395756.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
 gb|KFM22890.1| Obg-like ATPase 1 [Auxenochlorella protothecoides]
Length=348

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 161/205 (79%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            KV   + EGKD R G+W A ++E LN  Q ++AKPV+YLVN++EKDY RKKNK+LPK+  
Sbjct  144  KVLAWVQEGKDIRSGDWTAIEVEFLNNHQFISAKPVIYLVNLSEKDYIRKKNKWLPKLFE  203

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            W+Q HGG  +IPFS ALE  L DMP DE   YC+E+   SALPKII  GF A++LIYFFT
Sbjct  204  WIQAHGGAQLIPFSGALEAKLFDMPDDEKEAYCKEHGCTSALPKIIVAGFKAVHLIYFFT  263

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
             GP EV+CWQIR+ +KAPQAAGAIH+D ERGFICAEVM +++LKELG+E AVKA GKYRQ
Sbjct  264  CGPGEVRCWQIRKNSKAPQAAGAIHSDFERGFICAEVMHYDELKELGNENAVKAAGKYRQ  323

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            EGKTYV+QDGD+  FKFNV+   KK
Sbjct  324  EGKTYVMQDGDICHFKFNVTAEKKK  348



>ref|XP_001421839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00133.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=400

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E E   KV   L+ GK+ R G  +W + D+  LN +QLLTAKPV+YLVN++ KD++RK
Sbjct  185  KQELETICKVVDWLESGKEVRHGMEQWTSNDVMYLNKYQLLTAKPVIYLVNLSRKDFERK  244

Query  569  KNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            KNKFL KIH WVQ HGG  IIPFSA +E  L  +  ++ A++C++  VQ+ LPKII T F
Sbjct  245  KNKFLVKIHEWVQAHGGGTIIPFSAEVESELQHVAEEDKAQWCKDRGVQTMLPKIITTAF  304

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
            S ++LIYFFTAGPDEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELGSE 
Sbjct  305  STVHLIYFFTAGPDEVKAWCIRKGYKAPQAAGAIHTDFERGFICAEVMAFDDLKELGSEQ  364

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            AVK  GKYRQEGKTY VQD DVIFFKFNVSG  KK
Sbjct  365  AVKTAGKYRQEGKTYTVQDADVIFFKFNVSGAAKK  399



>ref|XP_006845996.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
 gb|ERN07671.1| hypothetical protein AMTR_s00155p00052120 [Amborella trichopoda]
Length=146

 Score =   274 bits (701),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  536  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  357
            VQEHGGE IIPFS  LE+SL DMP DEAAKYC+ENK+QSA+PKIIKTGFSAINLIYFFTA
Sbjct  3    VQEHGGEPIIPFSCVLEKSLVDMPEDEAAKYCDENKIQSAIPKIIKTGFSAINLIYFFTA  62

Query  356  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  177
            GPDEVKCWQIRRQTKAPQAAGAIHTD ERGFICAEVMKFEDLKELGSE A+KA GKYRQE
Sbjct  63   GPDEVKCWQIRRQTKAPQAAGAIHTDFERGFICAEVMKFEDLKELGSEAALKAAGKYRQE  122

Query  176  GKTYVVQDGDVIFFKFNVSGGGKK  105
            GKTYVVQDGD+IFFKFNVSGGGKK
Sbjct  123  GKTYVVQDGDIIFFKFNVSGGGKK  146



>ref|XP_002502254.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63512.1| predicted protein [Micromonas sp. RCC299]
Length=400

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -1

Query  719  KVKTSLDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKI  546
            KV   L++GK+ R G  EW   DI+ LN +QLLTAKPV+Y+VN+ +KDY RK NK+L KI
Sbjct  194  KVIKWLEDGKEVRNGMDEWSTTDIDFLNKYQLLTAKPVIYVVNLTKKDYARKANKWLKKI  253

Query  545  HAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYF  366
            H WV  HGG +IIPFS A E  L D+P +  A+Y +E  + S LPKIIKTGFS I+LIYF
Sbjct  254  HEWVMGHGGGVIIPFSGAFEAELQDVPEEGKAEYEKEQGMTSVLPKIIKTGFSTIHLIYF  313

Query  365  FTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKY  186
            FTAGPDEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+ LKELG+E  VKA GKY
Sbjct  314  FTAGPDEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMGFDTLKELGTEAEVKAKGKY  373

Query  185  RQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            RQEGKTY V+DGD+IFFKFNV+   KK
Sbjct  374  RQEGKTYTVEDGDIIFFKFNVTAAKKK  400



>ref|XP_003388006.1| PREDICTED: obg-like ATPase 1 [Amphimedon queenslandica]
Length=434

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 161/212 (76%), Gaps = 2/212 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++L  KV++ L D+ K  R G W AADIE+LN    LTAKPVVYL+N++EKDY RKK
Sbjct  216  KPEYDLLCKVQSLLVDDKKSVRFGTWNAADIELLNKHLFLTAKPVVYLINLSEKDYTRKK  275

Query  566  NKFLPKIHAWVQEH-GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L  I  W+  H  G ++IPFS   E+ L DMP DEAA+YC ENKV S+LPKII  G+
Sbjct  276  NKWLKDIKEWIDAHDAGAIVIPFSGVFEQKLLDMPEDEAARYCTENKVTSSLPKIIVNGY  335

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+NL YFFT+GPDEV+ W +++ TKAPQAAG IHTD E+GFI AEVMK+ED KELGSE 
Sbjct  336  KALNLQYFFTSGPDEVRAWTVQKGTKAPQAAGRIHTDFEKGFIMAEVMKYEDYKELGSES  395

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  114
            AVKA GKYRQ+G+ Y+V+DGD+I FKFN   G
Sbjct  396  AVKAAGKYRQQGRNYIVEDGDIILFKFNAGAG  427



>emb|CEG00523.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=398

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 159/214 (74%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K+E     KV   L EG + R G  +W   D+  LN +QLLTAKPV+YLVN++ KD++RK
Sbjct  185  KLELATVDKVLEWLQEGNEVRNGMEKWNTNDVMYLNKYQLLTAKPVIYLVNLSRKDFERK  244

Query  569  KNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            KNKFL KIH WV+ HGG  IIP SA +E  L  +P +E  ++C++  V S LPKIIKT F
Sbjct  245  KNKFLVKIHEWVKSHGGGTIIPVSAEVEGELQHVPAEEKEQWCKDQGVTSCLPKIIKTAF  304

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
            S I+LIYFFTAGPDEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELG+E 
Sbjct  305  STIHLIYFFTAGPDEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFDDLKELGTES  364

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVK  GKYRQEGK Y+VQDGD+ FFKFNV+   K
Sbjct  365  AVKTAGKYRQEGKNYLVQDGDICFFKFNVTSSKK  398



>gb|EPY26360.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 155/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            K+K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++NK+L K+  
Sbjct  4    KIKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKD  63

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            W+ E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FT
Sbjct  64   WIDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFT  123

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
            AGPDEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ED   L SE A +  GK  Q
Sbjct  124  AGPDEVKCWTIQRHTKAPQAAGRIHTDMEKGFICAEVIEWEDFDRLESEAACRDEGKQHQ  183

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            +G+ Y V+DGD+I+FKFN + GGKK
Sbjct  184  QGRNYEVKDGDIIYFKFNAAKGGKK  208



>ref|XP_005703761.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME27241.1| GTP-binding protein [Galdieria sulphuraria]
Length=398

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 164/217 (76%), Gaps = 4/217 (2%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEG-KDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            ++E E   KVK+ L+E  K  R GEW  ++IE+LN    LTAKP V+LVN++EKDY RKK
Sbjct  182  RLELETLKKVKSFLEETRKPIRSGEWSNSEIEVLNRHLFLTAKPQVFLVNLSEKDYIRKK  241

Query  566  NKFLPKIHAWVQEHGGELIIPFSAALERSLADMP---PDEAAKYCEENKVQSALPKIIKT  396
            NK+LPKI  WV    GE+IIPFSA LE  L D+    P+ A +Y EENK  SALPKIIK 
Sbjct  242  NKWLPKIKEWVDSRTGEMIIPFSADLESKLLDLESQGPELAQQYLEENKTTSALPKIIKA  301

Query  395  GFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGS  216
            G+ A++LIYFFTAG DEVKCW I++ T APQAAG IH+D E+GFICAEVMK+++LKE GS
Sbjct  302  GYQALHLIYFFTAGEDEVKCWTIQKGTLAPQAAGTIHSDFEKGFICAEVMKYDELKEYGS  361

Query  215  EPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            E A+KA GKYRQ+GK Y+V+DGD+I FKFNV+   KK
Sbjct  362  ESALKAAGKYRQQGKNYMVEDGDIILFKFNVTSSKKK  398



>gb|EPY39657.1| GTP binding protein [Angomonas deanei]
 gb|EPY42446.1| GTP binding protein [Angomonas deanei]
Length=392

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 159/213 (75%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+  K+K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++N
Sbjct  180  KADLEMLQKIKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRN  239

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L K+  W+ E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  
Sbjct  240  KWLKKLKDWIDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGI  299

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI++FTAGPDEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ED   L SE A 
Sbjct  300  INLIHYFTAGPDEVKCWTIQRHTKAPQAAGRIHTDMEKGFICAEVIEWEDFDRLESEAAC  359

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  Q+G+ Y V+DGD+IFFKFN + GGKK
Sbjct  360  RDEGKQHQQGRNYEVKDGDIIFFKFNAAKGGKK  392



>gb|EPY25232.1| GTP binding protein [Angomonas deanei]
Length=208

 Score =   258 bits (660),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 154/205 (75%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            K+K  L+E K  R G+W A +I+ LNT QL+TAKP ++LVNM+E DY R++NK+L K+  
Sbjct  4    KIKEHLEENKQVRCGQWNAKEIDFLNTLQLITAKPAMFLVNMSENDYTRQRNKWLKKLKD  63

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            W+ E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI++FT
Sbjct  64   WIDEQTGEPMIPFSAELESNFVNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLIHYFT  123

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
            AGP EV+CW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE A +  GK  Q
Sbjct  124  AGPGEVRCWTIQRHTKAPQAAGCIHSDMEKGFICADVIEWEDFDRLESEAACRDEGKQHQ  183

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            +G+ Y V+DGD+I+FKFN + GGKK
Sbjct  184  QGRNYEVKDGDIIYFKFNAAKGGKK  208



>ref|XP_004220982.1| GTP-binding protein [Plasmodium cynomolgi strain B]
 dbj|GAB64851.1| GTP-binding protein [Plasmodium cynomolgi strain B]
Length=392

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V + L E K  + G WK++++E++N F  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  181  EHDVLTTVLSYLKEHKWIKDGNWKSSEVEVINEFNFLTAKPVVYLVNMSESDFIRQKNKY  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+ A +E  L  M  DE  KY EEN + QS L KI+KTG+  I
Sbjct  241  LAKIYNWVQEKNKGTIIPYCADMELKLLSMSEDEKKKYFEENNIKQSMLSKIVKTGYYEI  300

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT GPDEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  301  NLIHFFTCGPDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSEGEVK  360

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD++FFKFNVS  GKK
Sbjct  361  ANGKYLQKGKDYVVEDGDIVFFKFNVSSSGKK  392



>ref|XP_003083821.1| GTP-binding protein (ISS) [Ostreococcus tauri]
Length=817

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 159/214 (74%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLG--EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K+E     KV   L EG + R G  +W   D+  LN +QLLTAKPV+YLVN++ KD++RK
Sbjct  604  KLELATVDKVLEWLQEGNEVRNGMEKWNTNDVMYLNKYQLLTAKPVIYLVNLSRKDFERK  663

Query  569  KNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            KNKFL KIH WV+ HGG  IIP SA +E  L  +P +E  ++C++  V S LPKIIKT F
Sbjct  664  KNKFLVKIHEWVKSHGGGTIIPVSAEVEGELQHVPAEEKEQWCKDQGVTSCLPKIIKTAF  723

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
            S I+LIYFFTAGPDEVK W IR+  KAPQAAGAIHTD ERGFICAEVM F+DLKELG+E 
Sbjct  724  STIHLIYFFTAGPDEVKAWCIRKGFKAPQAAGAIHTDFERGFICAEVMAFDDLKELGTES  783

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVK  GKYRQEGK Y+VQDGD+ FFKFNV+   K
Sbjct  784  AVKTAGKYRQEGKNYLVQDGDICFFKFNVTSSKK  817



>ref|XP_010736093.1| PREDICTED: obg-like ATPase 1 isoform X2 [Larimichthys crocea]
Length=238

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  LDE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  22   KPEYDVMCKIKSWVLDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIKTG
Sbjct  82   KNKWLVKIKEWVDSHDPGALVIPFSGGLENKLQDKSEEETQKYCTEHKTQSALSKIIKTG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE
Sbjct  142  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  237



>gb|EPS62769.1| hypothetical protein M569_12020, partial [Genlisea aurea]
Length=146

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -1

Query  536  VQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTA  357
            VQEHGGE IIP S ALE  LADM P+EAAKYCEEN+VQSAL K+IKTGFSAINLIYFFTA
Sbjct  1    VQEHGGETIIPVSCALENKLADMSPEEAAKYCEENQVQSALSKVIKTGFSAINLIYFFTA  60

Query  356  GPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQE  177
            GPDEVKCWQIRR +KAPQAAG IH+D ERGFICAEVMKFEDLKELGSE AVKA GKY+QE
Sbjct  61   GPDEVKCWQIRRLSKAPQAAGTIHSDFERGFICAEVMKFEDLKELGSEAAVKACGKYKQE  120

Query  176  GKTYVVQDGDVIFFKFNV--SGGGKK  105
            GK YVVQDGD+IFFKFNV  SGG KK
Sbjct  121  GKGYVVQDGDIIFFKFNVSSSGGAKK  146



>gb|EPY23726.1| GTP binding protein [Strigomonas culicis]
Length=270

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+ +KVK  L+EGK  R   W   +I+ LNT QLLTAKP ++L+NM+E D+ R++N
Sbjct  58   KADLEVLVKVKEHLEEGKQIRCCHWNGKEIDYLNTIQLLTAKPAMFLINMSENDFCRQRN  117

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L K+  W+ E  GE +IPFSA LE S  +M P+E   YCEE+K +S + KII T ++ 
Sbjct  118  KWLKKLKDWIDEQTGEPMIPFSAELESSFLNMSPEEVHAYCEEHKTKSQIHKIINTAYNV  177

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI++FTAGPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED + L SE A 
Sbjct  178  INLIHYFTAGPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIEWEDFERLKSESAC  237

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  Q G+TY V+DGD+IFFKFN + GGKK
Sbjct  238  RDEGKQHQHGRTYEVKDGDIIFFKFNAAKGGKK  270



>ref|XP_008818190.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
 gb|EUD65256.1| GTP-binding protein YchF [Plasmodium inui San Antonio 1]
Length=392

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V + L E K  + G WK+++IE++N F  LTAKPVVYLVNM+E D+ R+KNK 
Sbjct  181  EHDVLTAVLSFLKEHKWIKDGNWKSSEIEVINEFNFLTAKPVVYLVNMSESDFIRQKNKH  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+ A LE  L  M  DE   Y EENK+ QS L KI+KTG+  I
Sbjct  241  LAKIYNWVQEKNKGTIIPYCADLELKLLSMSEDEKKTYFEENKIKQSMLNKIVKTGYYEI  300

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT GPDEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  301  NLIHFFTCGPDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSEGEVK  360

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD++FFKFNVS  GKK
Sbjct  361  ANGKYLQKGKDYVVEDGDIVFFKFNVSSSGKK  392



>ref|XP_005452977.1| PREDICTED: obg-like ATPase 1-like isoform X8 [Oreochromis niloticus]
Length=252

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  36   KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  95

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  96   KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  155

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  156  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  215

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  216  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  251



>ref|XP_005019763.1| PREDICTED: obg-like ATPase 1 [Anas platyrhynchos]
Length=236

 Score =   254 bits (650),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  20   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  79

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  80   KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  139

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  140  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  199

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  200  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  235



>ref|XP_009490257.1| PREDICTED: obg-like ATPase 1 [Pelecanus crispus]
 ref|XP_009966012.1| PREDICTED: obg-like ATPase 1 [Tyto alba]
Length=236

 Score =   254 bits (649),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  20   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  79

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  80   KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  139

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  140  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  199

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  200  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  235



>ref|XP_005519867.1| PREDICTED: obg-like ATPase 1 isoform X4 [Pseudopodoces humilis]
 ref|XP_008632972.1| PREDICTED: obg-like ATPase 1 isoform X2 [Corvus brachyrhynchos]
 ref|XP_010307801.1| PREDICTED: obg-like ATPase 1 [Balearica regulorum gibbericeps]
 ref|XP_010405059.1| PREDICTED: obg-like ATPase 1 [Corvus cornix cornix]
Length=273

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  272



>ref|XP_009581765.1| PREDICTED: obg-like ATPase 1 [Fulmarus glacialis]
Length=273

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>gb|EPY30421.1| GTP binding protein [Angomonas deanei]
Length=392

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 157/209 (75%), Gaps = 0/209 (0%)
 Frame = -1

Query  731  ELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLP  552
            E+  KVK  L+EGK  R G+W   +I++LNT QL+TAKP ++LVNM+E DY R++NK+L 
Sbjct  184  EILQKVKEHLEEGKQVRCGQWSGKEIDLLNTIQLITAKPAMFLVNMSENDYARQRNKWLK  243

Query  551  KIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLI  372
            K+  W+ E  GE +IPFSA LE +  +M P+E AKYCEENK +S + KII T +  INLI
Sbjct  244  KLKDWIDEQTGEPMIPFSAELETNFLNMSPEEVAKYCEENKTKSQIHKIITTAYGIINLI  303

Query  371  YFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGG  192
            ++FTAGP EV+CW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE A +  G
Sbjct  304  HYFTAGPGEVRCWTIQRHTKAPQAAGCIHSDMEKGFICADVIEWEDFDRLESEAACRDEG  363

Query  191  KYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  Q+G+ Y V+DGD+I+FKFN + GGKK
Sbjct  364  KQHQQGRNYEVKDGDIIYFKFNAAKGGKK  392



>ref|XP_005452976.1| PREDICTED: obg-like ATPase 1-like isoform X7 [Oreochromis niloticus]
Length=283

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  67   KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  126

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  127  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  186

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  187  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  246

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  247  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  282



>ref|XP_010162756.1| PREDICTED: obg-like ATPase 1 [Caprimulgus carolinensis]
Length=273

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>gb|EWC89308.1| GTP-binding protein YchF [Plasmodium falciparum NF54]
Length=363

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  152  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  211

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  212  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  271

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  272  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  331

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  332  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  363



>ref|XP_004601224.1| PREDICTED: obg-like ATPase 1 isoform X3 [Sorex araneus]
 ref|XP_007105933.1| PREDICTED: obg-like ATPase 1-like [Physeter catodon]
Length=238

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN +  LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKYLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>gb|ETW39419.1| GTP-binding protein YchF, partial [Plasmodium falciparum NF135/5.C10]
Length=364

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  153  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  212

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  213  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  272

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  273  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  332

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  333  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  364



>gb|ETW37410.1| GTP-binding protein YchF [Plasmodium falciparum Tanzania (2000708)]
Length=364

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  153  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  212

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  213  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  272

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  273  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  332

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  333  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  364



>ref|XP_009086253.1| PREDICTED: obg-like ATPase 1 isoform X2 [Serinus canaria]
 ref|XP_009806156.1| PREDICTED: obg-like ATPase 1 [Gavia stellata]
 ref|XP_009892842.1| PREDICTED: obg-like ATPase 1 [Charadrius vociferus]
 ref|XP_010015190.1| PREDICTED: obg-like ATPase 1 [Nestor notabilis]
Length=273

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_010073941.1| PREDICTED: obg-like ATPase 1 [Pterocles gutturalis]
Length=273

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>gb|ETW50152.1| GTP-binding protein YchF [Plasmodium falciparum MaliPS096_E11]
Length=368

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  157  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  216

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  217  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  276

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  277  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  336

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  337  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  368



>ref|XP_005442958.1| PREDICTED: obg-like ATPase 1 [Falco cherrug]
Length=273

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_010116935.1| PREDICTED: obg-like ATPase 1 [Chlamydotis macqueenii]
Length=273

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>gb|KFP49878.1| Obg-like ATPase 1, partial [Cathartes aura]
 gb|KFQ57717.1| Obg-like ATPase 1, partial [Pelecanus crispus]
 gb|KFV51903.1| Obg-like ATPase 1, partial [Tyto alba]
Length=274

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  58   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  117

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  118  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  177

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  178  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  237

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  238  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  273



>ref|XP_004703789.1| PREDICTED: obg-like ATPase 1 isoform X3 [Echinops telfairi]
Length=238

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVVDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            FSA+ L YFFTAGPDEV+ W +R+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FSALQLEYFFTAGPDEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGDVIFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQQPKK  237



>gb|ETW28438.1| GTP-binding protein YchF [Plasmodium falciparum FCH/4]
Length=391

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  180  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  239

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  240  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  299

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  300  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  359

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  360  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  391



>gb|KFV04274.1| Obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=276

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  60   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  119

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  120  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  179

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  180  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  239

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  240  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  275



>ref|XP_009276861.1| PREDICTED: obg-like ATPase 1 [Aptenodytes forsteri]
Length=294

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  78   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  137

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  138  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  197

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  198  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  257

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  258  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  293



>ref|XP_001466463.1| putative GTP binding protein [Leishmania infantum JPCM5]
 ref|XP_003862077.1| GTP binding protein, putative [Leishmania donovani]
 emb|CAM69183.1| putative GTP binding protein [Leishmania infantum JPCM5]
 emb|CBZ35383.1| GTP binding protein, putative [Leishmania donovani]
Length=392

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 152/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            KVK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L K+  
Sbjct  188  KVKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYMRQRNKWLKKLKD  247

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            W+ EH GE +IPFSA LE +   M PDE  KYCEE K +S + KI+KT +S INLI++FT
Sbjct  248  WIDEHTGEPMIPFSAELETTFVAMSPDEVDKYCEEKKTRSQIHKIVKTAYSIINLIHYFT  307

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
            AG DEVKCW I+R TKAPQAAG IHTD+E+GFICA+V+++ D   L SE A +  GK  Q
Sbjct  308  AGADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICADVIEWADFDRLESEAACRDEGKQHQ  367

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            +G+ Y VQDGD+IFFKFN + GGKK
Sbjct  368  QGRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_008929287.1| PREDICTED: obg-like ATPase 1 [Manacus vitellinus]
Length=273

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K++T  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIRTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_011488091.1| PREDICTED: obg-like ATPase 1 [Oryzias latipes]
Length=245

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -1

Query  704  LDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQE  528
            +DE K  R   +W   +IE+LN F  LT+KP++YLVN++E+DY R+KNK+L KI  WV  
Sbjct  43   VDEKKHVRYYPDWNDKEIEVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDS  102

Query  527  HG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGP  351
            H  G L+IPFS  LE  L DM  +E  KYC E K QSAL KIIKTG++A+ L YFFT GP
Sbjct  103  HDPGALVIPFSGNLESKLQDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGP  162

Query  350  DEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGK  171
            DEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVKA GKYRQ+G+
Sbjct  163  DEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGR  222

Query  170  TYVVQDGDVIFFKFNVSGGGKK  105
             Y+V+DGD+IFFKFN     KK
Sbjct  223  NYIVEDGDIIFFKFNAPNAPKK  244



>ref|XP_004092018.1| PREDICTED: obg-like ATPase 1 isoform 2 [Nomascus leucogenys]
Length=238

 Score =   252 bits (643),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  237



>ref|XP_003961956.1| PREDICTED: obg-like ATPase 1-like [Takifugu rubripes]
Length=398

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+ L DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  182  KPEYDVMCKIKSWLVDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE SL DM  +E  KYC E+K QSAL +IIK G
Sbjct  242  KNKWLVKIKEWVDGHDPGALVIPFSGGLENSLQDMSEEEMQKYCVEHKTQSALSRIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE
Sbjct  302  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  362  SAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPNAPKK  397



>ref|XP_008116321.1| PREDICTED: obg-like ATPase 1 isoform X3 [Anolis carolinensis]
Length=238

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ +K++   + E K  R   +W   +I++LN +  LT+KP++YLVN++EKDY RK
Sbjct  22   KPEYDIMVKIRNWVIGEKKPIRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KN++L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  82   KNRWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IH+D E+GFI AEVMKFED KE G+E
Sbjct  142  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHSDFEKGFIMAEVMKFEDFKEGGTE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_004426695.1| PREDICTED: obg-like ATPase 1 isoform 3 [Ceratotherium simum simum]
 ref|XP_004674580.1| PREDICTED: obg-like ATPase 1 isoform X3 [Condylura cristata]
 ref|XP_005324666.1| PREDICTED: obg-like ATPase 1 isoform X3 [Ictidomys tridecemlineatus]
Length=238

 Score =   251 bits (642),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVMDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_009977093.1| PREDICTED: obg-like ATPase 1, partial [Tauraco erythrolophus]
Length=283

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  67   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  126

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  127  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  186

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  187  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  246

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  247  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  282



>ref|XP_010192575.1| PREDICTED: obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFQ29053.1| Obg-like ATPase 1, partial [Mesitornis unicolor]
 gb|KFZ56885.1| Obg-like ATPase 1, partial [Podiceps cristatus]
Length=213

 Score =   251 bits (640),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 155/212 (73%), Gaps = 3/212 (1%)
 Frame = -1

Query  731  ELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            ++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RKKNK+
Sbjct  1    DVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKW  60

Query  557  LPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G++A+
Sbjct  61   LIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAGYAAL  120

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
             L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVK
Sbjct  121  QLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVK  180

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  181  AAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  212



>ref|XP_005452975.1| PREDICTED: obg-like ATPase 1-like isoform X6 [Oreochromis niloticus]
Length=332

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  116  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  175

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  176  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  235

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  236  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  295

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  296  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  331



>ref|XP_001349125.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 emb|CAD50971.1| conserved GTP-binding protein, putative [Plasmodium falciparum 
3D7]
 gb|ETW57156.1| GTP-binding protein YchF [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60067.1| GTP-binding protein YchF [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR73781.1| GTP-binding protein YchF [Plasmodium falciparum 7G8]
 gb|EUT88305.1| GTP-binding protein YchF [Plasmodium falciparum Santa Lucia]
 gb|EWC77445.1| GTP-binding protein YchF [Plasmodium falciparum UGT5.1]
Length=393

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  182  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  241

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y E N + QS L KIIKTG+  I
Sbjct  242  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFETNNIKQSMLNKIIKTGYYEI  301

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  302  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  361

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  362  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  393



>ref|XP_001515633.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669441.1| PREDICTED: obg-like ATPase 1 isoform X1 [Ornithorhynchus anatinus]
 ref|XP_007669442.1| PREDICTED: obg-like ATPase 1 isoform X2 [Ornithorhynchus anatinus]
Length=396

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  LDE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RK
Sbjct  180  KPEYDIMCKIKTWVLDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  TAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>emb|CEG70465.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
 emb|CEI95966.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K E  +  KV   + +GKD R G W   + E++N   LLTAKPV+YL N++EKDY RKKN
Sbjct  184  KEEAVIVTKVLEWVQQGKDVRHGNWSNKEAEVINGLHLLTAKPVIYLANLSEKDYLRKKN  243

Query  563  KFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
            K+LPKI AW+ E+  G+++IP+S A E  L     +E  +  +EN   S LPKII  G++
Sbjct  244  KWLPKIKAWIDENSPGDMMIPYSGAYEYRLTLASAEEKEQIQKENNAPSVLPKIIVNGYA  303

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            A+ LIYFFT GPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMK+EDLKELGSE A
Sbjct  304  ALQLIYFFTGGPDEVRAWTIRKNTKAPQAAGVIHTDFERGFIMAEVMKYEDLKELGSESA  363

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            VKA GKY Q+GK YVV+DGD+I+FKFNV+   KK
Sbjct  364  VKAAGKYMQKGKEYVVEDGDIIYFKFNVTAPAKK  397



>ref|XP_002261143.1| GTP-binding protein [Plasmodium knowlesi strain H]
 emb|CAQ38331.1| GTP-binding protein, putative [Plasmodium knowlesi strain H]
Length=392

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 153/212 (72%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V + L E K  + G WK++++E++N +  LTAKPVVYLVNM+E D+ R+KNK 
Sbjct  181  EHDVLTTVLSFLKEHKWIKDGNWKSSEVEVINEYNFLTAKPVVYLVNMSETDFIRQKNKH  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+ A +E  L  M  DE   Y EENK+ QS L KI+KTG+  I
Sbjct  241  LAKIYNWVQEKNKGTIIPYCADMELKLLSMSEDEKKTYFEENKIKQSMLSKIVKTGYYEI  300

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  301  NLIHFFTCGADEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEFKSESEVK  360

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A G+Y Q+GK YVV+DGD+IFFKFNVS  GKK
Sbjct  361  ANGRYLQKGKDYVVEDGDIIFFKFNVSSSGKK  392



>ref|XP_004878683.1| PREDICTED: obg-like ATPase 1-like [Heterocephalus glaber]
Length=238

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>ref|NP_001011708.1| obg-like ATPase 1 isoform 2 [Homo sapiens]
 ref|XP_001928832.2| PREDICTED: Obg-like ATPase 1 [Sus scrofa]
 ref|XP_003824290.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan paniscus]
 ref|XP_003949968.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pan troglodytes]
 ref|XP_004032862.1| PREDICTED: obg-like ATPase 1-like isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004409048.1| PREDICTED: obg-like ATPase 1 isoform 3 [Odobenus rosmarus divergens]
 ref|XP_004577109.1| PREDICTED: obg-like ATPase 1 isoform X4 [Ochotona princeps]
 ref|XP_006213992.1| PREDICTED: obg-like ATPase 1-like [Vicugna pacos]
 ref|XP_006744649.1| PREDICTED: obg-like ATPase 1 isoform X3 [Leptonychotes weddellii]
 ref|XP_011283607.1| PREDICTED: obg-like ATPase 1 isoform X2 [Felis catus]
 ref|XP_011355676.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pteropus vampyrus]
 dbj|BAC11153.1| unnamed protein product [Homo sapiens]
 gb|EAX11150.1| GTP-binding protein PTD004, isoform CRA_b [Homo sapiens]
Length=238

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>gb|AAF71123.1|AF116721_103 PRO2455 [Homo sapiens]
Length=238

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPRQPKK  237



>ref|XP_007431000.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Python bivittatus]
Length=353

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RK
Sbjct  137  KPEYDIMCKIKSWVIDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRK  196

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  197  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  256

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  257  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  316

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGDVIFFKFN     KK
Sbjct  317  AAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQQPKK  352



>ref|XP_005484131.1| PREDICTED: obg-like ATPase 1 [Zonotrichia albicollis]
Length=273

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED K  GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKGEGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  272



>ref|XP_007527278.1| PREDICTED: obg-like ATPase 1 isoform X2 [Erinaceus europaeus]
Length=238

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  +  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDNYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>emb|CCC89543.1| putative GTP binding protein [Trypanosoma congolense IL3000]
Length=394

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -1

Query  731  ELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLP  552
            E+  KVK+ L+EG   R  +W   +I+ LNT QLLTAKP ++L NM+E+D+ R+++K+LP
Sbjct  186  EILQKVKSHLEEGNQIRCFQWNNKEIDFLNTLQLLTAKPAIFLANMSERDFIRQRSKWLP  245

Query  551  KIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLI  372
            K+  WV +H GEL+IP SA LE +L +M   EA  Y +ENK +S +PKII + + AINLI
Sbjct  246  KLKEWVDQHTGELLIPVSAELEANLLNMTAQEAEDYLKENKTKSQVPKIITSAYHAINLI  305

Query  371  YFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGG  192
            ++FTAGPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+ +ED ++L SE A +  G
Sbjct  306  HYFTAGPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIHWEDYEKLESESACRDAG  365

Query  191  KYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  QEG+ Y V+DGD+IFFKFN + GGKK
Sbjct  366  KQHQEGRNYEVKDGDIIFFKFNAAKGGKK  394



>ref|XP_003722043.1| putative GTP binding protein [Leishmania major strain Friedlin]
 emb|CBZ12304.1| putative GTP binding protein [Leishmania major strain Friedlin]
Length=392

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 0/209 (0%)
 Frame = -1

Query  731  ELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLP  552
            E   KVK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L 
Sbjct  184  ETLHKVKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYIRQRNKWLK  243

Query  551  KIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLI  372
            K+  W+ EH GE +IPFSA LE +   M PDE  KYCEE K +S + KI+KT +S IN I
Sbjct  244  KLKDWIDEHTGEPMIPFSAELETAFVAMSPDEVDKYCEEKKTRSQIHKIVKTAYSIINFI  303

Query  371  YFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGG  192
            ++FTAG DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ D   L SE A +  G
Sbjct  304  HYFTAGADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIEWADFDRLESEAACRDEG  363

Query  191  KYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  Q+G+ Y VQDGD+IFFKFN + GGKK
Sbjct  364  KQHQQGRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_007938961.1| PREDICTED: obg-like ATPase 1 isoform X2 [Orycteropus afer afer]
Length=238

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVVDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>gb|EPY37092.1| GTP binding protein [Strigomonas culicis]
Length=392

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+ +KVK  L+EGK  R   W   +I+ LNT QLLTAKP ++L+NM+E D+ R++N
Sbjct  180  KADLEVLVKVKEHLEEGKQIRCCHWNGKEIDYLNTIQLLTAKPAMFLINMSENDFCRQRN  239

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L K+  W+ E  GE +IPFSA LE S  +M P+E   YCEE+K +S + KII T ++ 
Sbjct  240  KWLKKLKDWIDEQTGEPMIPFSAELESSFLNMSPEEVHAYCEEHKTKSQIHKIINTAYNV  299

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI++FTAGPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED + L SE A 
Sbjct  300  INLIHYFTAGPDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICAEVIEWEDFERLKSESAC  359

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  Q G+TY V+DGD+IFFKFN + GGKK
Sbjct  360  RDEGKQHQHGRTYEVKDGDIIFFKFNAAKGGKK  392



>gb|ESL11226.1| GTP-binding protein [Trypanosoma rangeli SC58]
Length=270

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+ LKVK  L+ G+  R   W   +I+ LNT QLLTAKP ++L NM+EK + R++ 
Sbjct  58   KADLEILLKVKEHLENGEQVRCCHWNGKEIDYLNTLQLLTAKPAIFLANMSEKSFIRQRG  117

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L K+  W+ +H GE +IP SA +E    DM P+E  +YC+ NK +S + K++ T + A
Sbjct  118  KWLAKLKEWIDQHTGEPLIPVSAEMEAKFVDMSPEEVEEYCKANKTKSQVNKVVTTSYHA  177

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI++FTAG DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+ +ED  +L SE A 
Sbjct  178  INLIHYFTAGADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIHWEDYDKLESEAAC  237

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  QEG+ Y VQDGD+IFFKFNVS GGKK
Sbjct  238  REAGKQHQEGRNYEVQDGDIIFFKFNVSKGGKK  270



>ref|XP_001612801.1| GTP-binding protein [Plasmodium vivax Sal-1]
 gb|EDL43074.1| GTP-binding protein, putative [Plasmodium vivax]
Length=392

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 152/212 (72%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WKA++IE++N F  LTAKPVVYLVNM+E D+ R+KNK 
Sbjct  181  EHDVLTVVLNFLKEHKWIKDGNWKASEIEVINEFNFLTAKPVVYLVNMSEADFIRQKNKH  240

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+ A +E  L  M  +E   Y +EN V QS L KIIKTG+  I
Sbjct  241  LAKIYNWVQEKNKGTIIPYCADMELKLLSMSEEEKNAYFKENNVKQSMLSKIIKTGYYEI  300

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT GPDEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  301  NLIHFFTCGPDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYADLVEFKSEGEVK  360

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD++FFKFNVS  GKK
Sbjct  361  ANGKYLQKGKDYVVEDGDIVFFKFNVSSSGKK  392



>ref|XP_004267373.1| PREDICTED: obg-like ATPase 1 isoform 2 [Orcinus orca]
 ref|XP_004320700.1| PREDICTED: obg-like ATPase 1-like [Tursiops truncatus]
Length=238

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFCHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>gb|KFZ54967.1| Obg-like ATPase 1, partial [Caprimulgus carolinensis]
Length=315

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  99   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  158

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  159  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  218

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  219  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  278

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  279  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  314



>ref|XP_001368232.1| PREDICTED: Obg-like ATPase 1 [Monodelphis domestica]
Length=396

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RK
Sbjct  180  KPEYDIMCKIKTWVIDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_005921550.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Haplochromis burtoni]
Length=283

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  67   KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  126

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G
Sbjct  127  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAG  186

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  187  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  246

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  247  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  282



>emb|CDO63681.1| GTP-binding protein, putative [Plasmodium reichenowi]
Length=393

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 154/212 (73%), Gaps = 1/212 (0%)
 Frame = -1

Query  737  EHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            EH++   V   L E K  + G WK+ +IE+LN +  LTAKPVVYLVNM+E D+ R+KNK+
Sbjct  182  EHDVLTSVLNYLKEHKWIKDGTWKSNEIEVLNEYNFLTAKPVVYLVNMSEADFIRQKNKY  241

Query  557  LPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKV-QSALPKIIKTGFSAI  381
            L KI+ WVQE     IIP+SA +E+ +  M  +E  +Y + N + QS L KIIKTG+  I
Sbjct  242  LAKIYNWVQEKNKGTIIPYSAEVEQKILSMDEEEKKQYFQTNNIKQSMLNKIIKTGYYEI  301

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
            NLI+FFT G DEVKCW IR+ TKAPQAAG IHTD E+GFICAEV K+ DL E  SE  VK
Sbjct  302  NLIHFFTCGHDEVKCWTIRKGTKAPQAAGVIHTDFEKGFICAEVYKYTDLVEYKSEGEVK  361

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKY Q+GK YVV+DGD+IFFKFNVS GGKK
Sbjct  362  ANGKYLQKGKDYVVEDGDIIFFKFNVSSGGKK  393



>ref|XP_007451127.1| PREDICTED: obg-like ATPase 1 isoform X2 [Lipotes vexillifer]
Length=238

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFCHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPQQPKK  237



>ref|XP_003876812.1| putative GTP binding protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ28340.1| putative GTP binding protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=392

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 153/209 (73%), Gaps = 0/209 (0%)
 Frame = -1

Query  731  ELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLP  552
            E   KVK  L+EGK  R  +W   +I+ LNT QLLTAKP ++LVNM+E DY R++NK+L 
Sbjct  184  ETLHKVKGVLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLVNMSEDDYMRQRNKWLK  243

Query  551  KIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLI  372
            K+  W+ EH GE +IPFSA +E +   M P+E  KYCEE K +S + KI+KT +S INLI
Sbjct  244  KLKDWIDEHTGEPMIPFSAEVETTFVAMSPEEVDKYCEEKKTKSQIQKIVKTAYSIINLI  303

Query  371  YFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGG  192
            ++FTAG DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+++ D   L SE A +  G
Sbjct  304  HYFTAGADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIEWADFDRLESEAACRDEG  363

Query  191  KYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  Q+G+ Y VQDGD+IFFKFN + GGKK
Sbjct  364  KQHQQGRNYEVQDGDIIFFKFNAAKGGKK  392



>ref|XP_009932339.1| PREDICTED: obg-like ATPase 1 [Opisthocomus hoazin]
Length=273

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT + DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  57   KPEYDVMCKIKTWVTDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRK  116

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  +SAL KIIK G
Sbjct  117  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMKESALAKIIKAG  176

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  177  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  236

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  237  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  272



>ref|XP_009330922.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pygoscelis adeliae]
Length=294

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  78   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  137

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN   SAL KIIK G
Sbjct  138  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTDSALAKIIKAG  197

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  198  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  257

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  258  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  293



>gb|EHA99193.1| Obg-like ATPase 1, partial [Heterocephalus glaber]
Length=271

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  55   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  114

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  115  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  174

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  175  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  234

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  235  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  270



>ref|XP_010736092.1| PREDICTED: obg-like ATPase 1 isoform X1 [Larimichthys crocea]
Length=398

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  LDE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  182  KPEYDVMCKIKSWVLDEKKHVRYYHDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIKTG
Sbjct  242  KNKWLVKIKEWVDSHDPGALVIPFSGGLENKLQDKSEEETQKYCTEHKTQSALSKIIKTG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE
Sbjct  302  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  362  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  397



>ref|XP_008533775.1| PREDICTED: obg-like ATPase 1, partial [Equus przewalskii]
Length=213

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 156/212 (74%), Gaps = 3/212 (1%)
 Frame = -1

Query  731  ELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            ++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+
Sbjct  1    DIMCKVKSWVMDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKW  60

Query  557  LPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+
Sbjct  61   LIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAAL  120

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
             L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVK
Sbjct  121  QLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVK  180

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  181  AAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  212



>ref|XP_003764019.1| PREDICTED: obg-like ATPase 1 [Sarcophilus harrisii]
Length=396

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +IE+LN    LT+KP++YLVN++EKDY RK
Sbjct  180  KPEYDIMCKIKTWVIDEKKPVRFYHDWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>emb|CEI96573.1| Putative Obg-like ATPase 1 [Rhizopus microsporus]
Length=398

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K E  +  KV   + +GKD R G W   ++E++N   LLTAKPV+YL N++EKDY RKKN
Sbjct  184  KEEAAIVTKVLEWVQQGKDVRHGNWSNKEVEVINGLHLLTAKPVIYLANLSEKDYIRKKN  243

Query  563  KFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
            K+LPKI AW+ E+  G+++IP+S A E  L     +E  +  +EN   S L KII  G++
Sbjct  244  KWLPKIKAWIDENSPGDMMIPYSGAYEYRLTLASAEEKEQIQKENNAPSVLSKIIVNGYA  303

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            A+ LIYFFT GPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMK+EDLKELGSE A
Sbjct  304  ALQLIYFFTGGPDEVRAWTIRKNTKAPQAAGVIHTDFERGFIMAEVMKYEDLKELGSESA  363

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            VKA GKY Q+GK Y+V+DGD+I+FKFNV+   KK
Sbjct  364  VKAAGKYMQKGKDYIVEDGDIIYFKFNVTAPAKK  397



>ref|XP_008136766.1| PREDICTED: obg-like ATPase 1 isoform X2 [Eptesicus fuscus]
Length=238

 Score =   249 bits (637),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN +  LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKYLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +   G L+IPFS ALE  L ++  +E  +Y E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKSDPGALVIPFSGALELKLQELSAEERQQYLEANTTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK++D KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_010878192.1| PREDICTED: obg-like ATPase 1 isoform X4 [Esox lucius]
Length=398

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  + DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  181  KPEYDVMLKIKNWVADEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  240

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G
Sbjct  241  KNKWLVKIKDWVDIHDPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAG  300

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            + A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  301  YGALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  360

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  123
             AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  361  NAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  390



>gb|AAY14876.1| unknown [Homo sapiens]
Length=213

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 156/212 (74%), Gaps = 3/212 (1%)
 Frame = -1

Query  731  ELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            ++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RKKNK+
Sbjct  1    DIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKW  60

Query  557  LPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK GF+A+
Sbjct  61   LIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAAL  120

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
             L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE AVK
Sbjct  121  QLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVK  180

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  181  AAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  212



>ref|XP_010878191.1| PREDICTED: obg-like ATPase 1 isoform X3 [Esox lucius]
Length=399

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  + DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  182  KPEYDVMLKIKNWVADEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G
Sbjct  242  KNKWLVKIKDWVDIHDPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            + A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  302  YGALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  123
             AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  362  NAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  391



>gb|EYC24730.1| hypothetical protein Y032_0013g2079 [Ancylostoma ceylanicum]
Length=396

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 157/218 (72%), Gaps = 5/218 (2%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K++++  L+VK  LDE K  RL  W   +IE+LN    LTAKP+VYLVN++EKDY RKKN
Sbjct  179  KVDYDTLLRVKKDLDEKKPIRLDTWNEKEIEVLNKHLFLTAKPIVYLVNLSEKDYIRKKN  238

Query  563  KFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
            K+LPKI  W+ ++  G ++IPFS   E  L DMP DE  K+C+EN+  S L KI+ TG+ 
Sbjct  239  KWLPKIKEWIDKNDPGAVLIPFSGVFENKLIDMPEDEREKFCKENQTSSNLDKIVHTGYK  298

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            A+ L YFFTAG DEVK W I++ T AP+AAG IHTD E+GFI AEVMK  DL ELG E  
Sbjct  299  ALQLEYFFTAGKDEVKAWTIQKGTLAPKAAGRIHTDFEKGFIMAEVMKVADLMELGEENK  358

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFN----VSGGGKK  105
            VKA GKYRQ+GKTYVV+DGDVI FKFN    ++GG KK
Sbjct  359  VKAAGKYRQQGKTYVVEDGDVILFKFNAGAGLTGGKKK  396



>ref|XP_009236113.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pongo abelii]
Length=238

 Score =   249 bits (637),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGP+EV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPEEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>ref|XP_007430999.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Python bivittatus]
Length=396

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RK
Sbjct  180  KPEYDIMCKIKSWVIDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGDVIFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQQPKK  395



>ref|XP_010878190.1| PREDICTED: obg-like ATPase 1 isoform X2 [Esox lucius]
Length=432

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  + DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  215  KPEYDVMLKIKNWVADEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  274

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G
Sbjct  275  KNKWLVKIKDWVDIHDPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAG  334

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            + A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  335  YGALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  394

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  123
             AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  395  NAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  424



>ref|XP_010605332.1| PREDICTED: obg-like ATPase 1 isoform X2 [Fukomys damarensis]
Length=294

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  78   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  137

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  138  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  197

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  198  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  257

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  258  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  293



>ref|XP_005452974.1| PREDICTED: obg-like ATPase 1-like isoform X5 [Oreochromis niloticus]
Length=350

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  134  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  193

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  194  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  253

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  254  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  313

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  314  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  349



>ref|XP_010878189.1| PREDICTED: obg-like ATPase 1 isoform X1 [Esox lucius]
Length=433

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  + DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  216  KPEYDVMLKIKNWVADEKKHVRFCRDWNDKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  275

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LER L DM  +E  KYC+E+K QS L +IIK G
Sbjct  276  KNKWLVKIKDWVDIHDPGALVIPFSGGLERILQDMSEEEIQKYCKEHKTQSVLTRIIKAG  335

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            + A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  336  YGALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  395

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  123
             AVKA GKYRQ+GKTYVV+DGD+IFF+FN 
Sbjct  396  NAVKAAGKYRQQGKTYVVEDGDIIFFRFNT  425



>ref|NP_001026425.1| obg-like ATPase 1 [Gallus gallus]
 sp|Q5ZM25.1|OLA1_CHICK RecName: Full=Obg-like ATPase 1 [Gallus gallus]
 emb|CAG31218.1| hypothetical protein RCJMB04_3f20 [Gallus gallus]
Length=396

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSALPKIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALPKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_007430998.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Python bivittatus]
Length=401

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +I++LN    LT+KP++YL+N++EKDY RK
Sbjct  185  KPEYDIMCKIKSWVIDEKKPVRFYHDWNDKEIDVLNKHLFLTSKPMIYLINLSEKDYIRK  244

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L +M  +E  KY EEN  QSALPKIIK G
Sbjct  245  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQEMSAEEKQKYLEENMTQSALPKIIKAG  304

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  305  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  364

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGDVIFFKFN     KK
Sbjct  365  AAVKAAGKYRQQGRNYVVEDGDVIFFKFNTPQQPKK  400



>gb|ADD38665.1| GTP-binding protein CG1354 [Lepeophtheirus salmonis]
Length=398

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 2/212 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K+E++   KVK +L +E K  R G W   DIE LN    +TAKP++YLVN++EKDY RKK
Sbjct  180  KLEYDTFCKVKKTLIEEEKHIRFGTWSGNDIEFLNKHLFITAKPMIYLVNLSEKDYIRKK  239

Query  566  NKFLPKIHAWVQEHGGE-LIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+LPKI  +V +H    ++IPFS A E++L DMP DE AKY ++ K  SAL KII   +
Sbjct  240  NKWLPKIKEYVDKHDPRGIVIPFSGAFEQTLVDMPEDECAKYMDDVKCTSALEKIIIQAY  299

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAGPDEVK W I + TKAPQAAG IHTD E+GFI AEVMKFED KE GSE 
Sbjct  300  KALQLEYFFTAGPDEVKAWTILKHTKAPQAAGRIHTDFEKGFIMAEVMKFEDFKEEGSEN  359

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  114
            A KA GKYRQ+G+ YVV+DGD+IFFKFN   G
Sbjct  360  AAKAAGKYRQQGRNYVVEDGDIIFFKFNAGAG  391



>gb|ETN73871.1| GTP-binding protein YchF [Necator americanus]
Length=396

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 157/218 (72%), Gaps = 5/218 (2%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K++++  L+VK  L+E K  RL  W   +IE+LN    LTAKP+VYLVN++EKDY RKKN
Sbjct  179  KVDYDTLLRVKKDLEEKKPVRLDTWNEKEIEVLNKHLFLTAKPIVYLVNLSEKDYIRKKN  238

Query  563  KFLPKIHAWV-QEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
            K+LPKI  W+ +E  G  +IPFS A E  L DMP DE  K+C+EN+  S L KII TG+ 
Sbjct  239  KWLPKIKEWIDKEDPGASLIPFSGAFENKLLDMPEDEREKFCKENQTSSNLDKIIHTGYK  298

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            A+ L YFFTAG DEVK W I++ T AP+AAG IHTD E+GFI AEVMK  DL ELG E  
Sbjct  299  ALQLEYFFTAGKDEVKAWTIQKGTLAPKAAGRIHTDFEKGFIMAEVMKVADLMELGEENK  358

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFN----VSGGGKK  105
            VKA GKYRQ+GKTYVV+DGD+I FKFN    ++GG KK
Sbjct  359  VKAAGKYRQQGKTYVVEDGDIILFKFNAGAGLTGGKKK  396



>ref|XP_009952424.1| PREDICTED: obg-like ATPase 1, partial [Leptosomus discolor]
Length=277

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  61   KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  120

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN   SAL KIIK G
Sbjct  121  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMXXSALAKIIKAG  180

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  181  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  240

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  241  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  276



>gb|AEB61109.1| obg-like ATPase 1-like protein, partial [Equus caballus]
Length=291

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  75   KPEYDIMCKVKSWVMDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  134

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  135  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  194

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  195  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  254

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  255  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  290



>ref|XP_005510535.1| PREDICTED: obg-like ATPase 1-like, partial [Columba livia]
Length=362

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K++T  +DE K  R   +W   +I++LN +   T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIRTWVIDEKKAVRFCHDWNDKEIDVLNKYLFFTSKPMIYLVNLSEKDYIRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  361



>gb|ACO12256.1| Obg-like ATPase 1 [Lepeophtheirus salmonis]
Length=398

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 154/212 (73%), Gaps = 2/212 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K+E++   KVK +L +E K  R G W   DIE LN    +TAKP++YLVN++EKDY RKK
Sbjct  180  KLEYDTFCKVKKTLIEEEKHIRFGTWSGNDIEFLNKHLFITAKPMIYLVNLSEKDYIRKK  239

Query  566  NKFLPKIHAWVQEHGGE-LIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+LPKI  +V +H    ++IPFS A E++L DMP DE AKY ++ K  SAL KII   +
Sbjct  240  NKWLPKIKEYVDKHDPRGIVIPFSGAFEQTLVDMPEDECAKYMDDVKCTSALEKIIIQAY  299

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAGPDEVK W I + TKAPQAAG IHTD E+GFI AEVMKFED KE GSE 
Sbjct  300  KALQLEYFFTAGPDEVKAWTILKHTKAPQAAGRIHTDFEKGFIMAEVMKFEDFKEEGSEN  359

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  114
            A KA GKYRQ+G+ YVV+DGD+IFFKFN   G
Sbjct  360  AAKAAGKYRQQGRNYVVEDGDIIFFKFNAGAG  391



>ref|XP_008275154.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=395

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 156/216 (72%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K   +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIILKIKNWVVDEKKHVRFYNDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IP S ALE  L DM  +E  KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGALVIPLSGALESKLFDMEEEERNKYCEELKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+  KAPQAAG IHTD E+GFI AEVMK+ D KE GSE
Sbjct  299  YAALQLEYFFTAGPDEVRAWTIRKGAKAPQAAGKIHTDFEKGFIMAEVMKYSDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  359  SAAKAAGKYRQQGRNYVVEDGDIIFFKFNTPNAPKK  394



>ref|XP_006866714.1| PREDICTED: obg-like ATPase 1 isoform X2 [Chrysochloris asiatica]
Length=238

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  22   KPEYDIMCKVKSWVVDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  81

Query  569  KNKFLPKIHAWVQE-HGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +   G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  82   KNKWLIKIKEWVDKCDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  141

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  142  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  201

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  202  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  237



>gb|KCW75747.1| hypothetical protein EUGRSUZ_D00127 [Eucalyptus grandis]
Length=322

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIEHE CLKVK  L++GKD RLGEWKAAD+EILNTFQLLTAKPVVYLVNMNEKDYQRKKN
Sbjct  182  KIEHECCLKVKAWLEDGKDVRLGEWKAADVEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            KFLPKIHAWVQEHGGE IIPFS ALER+LAD+  DEAAKYCEENKVQSALPKIIKTGFSA
Sbjct  242  KFLPKIHAWVQEHGGETIIPFSCALERNLADISADEAAKYCEENKVQSALPKIIKTGFSA  301

Query  383  INLIYFFTAGPDEV  342
            INLIYFFTAGPDEV
Sbjct  302  INLIYFFTAGPDEV  315



>gb|EFN78354.1| Obg-like ATPase 1 [Harpegnathos saltator]
Length=308

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK  L +E K  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKK
Sbjct  90   KPEYDTLLKVKGVLMEEKKHIRFADWSANDIEVLNKYLFLTSKPIIYLVNLSEKDYIRKK  149

Query  566  NKFLPKIHAWVQEH-GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS   E  + DM   E AKY EE+KV SAL KII  G+
Sbjct  150  NKWLIKIKEWVDKNDAGAILIPFSGIFENKVLDMDEAERAKYFEEHKVTSALDKIIVQGY  209

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAG DEVK W I++ TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE 
Sbjct  210  KALQLQYFFTAGHDEVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEA  269

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  270  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  303



>ref|XP_005798398.1| PREDICTED: obg-like ATPase 1-like [Xiphophorus maculatus]
Length=395

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LKVK   ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIILKVKNWVVEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S A+E  L +M  +E+ KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKLQEMEEEESTKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++ + L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  359  SAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNAPKK  394



>ref|XP_003442972.1| PREDICTED: obg-like ATPase 1-like [Oreochromis niloticus]
 ref|XP_004540365.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Maylandia zebra]
 ref|XP_004540366.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=395

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K   ++E K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIMLKIKNWVVEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S ALE  L DM  +E  KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  359  TAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNAPKK  394



>gb|KFO14346.1| Obg-like ATPase 1, partial [Balearica regulorum gibbericeps]
Length=362

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  361



>ref|XP_003695060.1| PREDICTED: GTP-binding protein CG1354-like [Apis florea]
Length=397

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 154/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVK-TSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK   +DE +  R  +W A DIE+LN +  LT+KPV+YL+N++EKDY RKK
Sbjct  179  KPEYDTLLKVKGVMVDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLINLSEKDYVRKK  238

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS   E  L DM   E  KY EENKV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDPGAILIPFSGVFENKLLDMNEAERGKYLEENKVTSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAG DEVK W I+R TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE 
Sbjct  299  KALQLQYFFTAGHDEVKAWTIQRGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEA  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  359  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  392



>emb|CAG09966.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=346

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = -1

Query  731  ELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKF  558
            ++  K+K+ L DE K  R   +W   ++E+LN +  LT+KP++YLVN++EKDY R+KNK+
Sbjct  134  DVMCKIKSWLVDEKKHVRYYHDWNDKEVEVLNKYLFLTSKPMIYLVNLSEKDYVRRKNKW  193

Query  557  LPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAI  381
            L KI  WV  H  G L+IPFS  LE SL +M  +E  KYC E+K QSAL +IIK G++A+
Sbjct  194  LVKIKEWVDGHDPGALVIPFSGGLESSLQEMSEEEMLKYCTEHKTQSALSRIIKAGYAAL  253

Query  380  NLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVK  201
             L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE AVK
Sbjct  254  QLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVK  313

Query  200  AGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            A GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  314  AAGKYRQQGRNYVVEDGDIIFFKFNTPNAPKK  345



>ref|XP_003447358.1| PREDICTED: obg-like ATPase 1-like isoform X1 [Oreochromis niloticus]
Length=396

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  180  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  240  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  395



>gb|KFW10028.1| Obg-like ATPase 1, partial [Fulmarus glacialis]
Length=362

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYVRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  361



>ref|XP_668381.1| GTP-binding protein [Cryptosporidium hominis TU502]
Length=397

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  674  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  495
            +WK++++E+LN  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA
Sbjct  206  DWKSSEVELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSA  265

Query  494  ALERSLADMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  321
              E +LA++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR 
Sbjct  266  EFETALAELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRS  325

Query  320  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  141
             TKAPQAAG IHTD ERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+I
Sbjct  326  GTKAPQAAGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDII  385

Query  140  FFKFNVSGGGKK  105
            FFKFNV+  GKK
Sbjct  386  FFKFNVTNSGKK  397



>emb|CCW63611.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=393

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 150/205 (73%), Gaps = 0/205 (0%)
 Frame = -1

Query  719  KVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHA  540
            KVK  L+EGK  R  +W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L K+  
Sbjct  189  KVKLFLEEGKQVRCCQWNGKEIDFLNTIQLLTAKPAMFLINMSENDFVRQRNKWLKKLKD  248

Query  539  WVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            W+ E   E +IPFSA LE     M P+E  +YCEE K +S LPKIIKT +S INLI++FT
Sbjct  249  WIDERTAEPMIPFSAELEAQFLTMTPEEVTRYCEEKKTKSQLPKIIKTAYSIINLIHYFT  308

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
            AGPDEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+++ED   L +E A +  GK  Q
Sbjct  309  AGPDEVKCWTIQRGTKAPQAAGKIHSDMEKGFICAEVIEWEDFNRLENEAACREEGKQHQ  368

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            +G+ Y VQDGD+IFFKFN    GKK
Sbjct  369  QGRNYEVQDGDIIFFKFNAGKAGKK  393



>gb|KFM07037.1| Obg-like ATPase 1, partial [Aptenodytes forsteri]
 gb|KFQ51755.1| Obg-like ATPase 1, partial [Nestor notabilis]
 gb|KFV50449.1| Obg-like ATPase 1, partial [Gavia stellata]
Length=362

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  361



>gb|KFP41102.1| Obg-like ATPase 1, partial [Chlamydotis macqueenii]
Length=362

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  361



>gb|EFN60681.1| Obg-like ATPase 1 [Camponotus floridanus]
Length=330

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E+E  LKVK  L D+ K  R  +W + D+E+LN +  LT+KP++YLVN++EKDY RKK
Sbjct  112  KPEYETLLKVKGVLTDDKKHIRFADWSSNDVEVLNKYLFLTSKPILYLVNLSEKDYIRKK  171

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS   E  + DM   E  KY EE+KV SAL KII  G+
Sbjct  172  NKWLIKIKEWVDKNDPGAVLIPFSGIFENKILDMDEAERTKYFEEHKVTSALDKIIVQGY  231

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+NL YFFTAG DEVK W I++ T+APQAAG IHTD E+GFI AEVMKFED K  GSE 
Sbjct  232  KALNLQYFFTAGHDEVKAWTIQKGTRAPQAAGKIHTDFEKGFIMAEVMKFEDFKNEGSEA  291

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  292  AVKAAGKYRQQGRAYVVEDGDIIFFKFNAGAGLK  325



>gb|KFV08740.1| Obg-like ATPase 1, partial [Pterocles gutturalis]
Length=362

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  146  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  205

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  206  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  265

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  266  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  325

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  326  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  361



>ref|XP_007576845.1| PREDICTED: obg-like ATPase 1 [Poecilia formosa]
Length=395

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 156/216 (72%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LKVK   ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIMLKVKNWVVEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S A+E  L +M  +E  KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKLQEMEEEERTKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++ + L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  359  SAAKAAGKYRQQGRNYVVEDGDIIFFKFNTPNAPKK  394



>ref|XP_006744648.1| PREDICTED: obg-like ATPase 1 isoform X2 [Leptonychotes weddellii]
Length=308

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  92   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  151

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  152  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  211

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  212  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  271

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  272  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  307



>ref|XP_005723778.1| PREDICTED: obg-like ATPase 1-like [Pundamilia nyererei]
 ref|XP_005934395.1| PREDICTED: obg-like ATPase 1-like [Haplochromis burtoni]
Length=395

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDE-GKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  ++E  K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIMLKIKNWVEEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S ALE  L DM  +E  KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  359  TAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNAPKK  394



>emb|CCW70456.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=393

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 151/209 (72%), Gaps = 0/209 (0%)
 Frame = -1

Query  731  ELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLP  552
            E  LKVK+ L+EGK  R  +W   +I+ LNT QLLTAKP ++L+NM+E D+ R++NK+L 
Sbjct  185  ETLLKVKSFLEEGKQIRCCQWNGKEIDFLNTIQLLTAKPAMFLINMSENDFVRQRNKWLK  244

Query  551  KIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLI  372
            K+  W+ E   E +IPFSA LE     M P+E  KYCEE K +S LPKIIKT +S INLI
Sbjct  245  KLKDWIDEQTAEPMIPFSAELETEFLSMTPEEITKYCEEKKTKSQLPKIIKTAYSIINLI  304

Query  371  YFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGG  192
            ++FTAG DEVKCW I+R TKAPQAAG IH+D+E+GFICA+V+++ED   L SE   +  G
Sbjct  305  HYFTAGSDEVKCWTIQRGTKAPQAAGRIHSDMEKGFICADVIEWEDFNRLESEAVCREEG  364

Query  191  KYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            K  Q+G+ Y VQDGD+IFFKFN S   KK
Sbjct  365  KQHQQGRNYEVQDGDIIFFKFNTSKASKK  393



>ref|XP_008297045.1| PREDICTED: obg-like ATPase 1 [Stegastes partitus]
Length=398

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K+ R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  182  KPEYDVMCKIKSWVVDEKKNVRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  242  KNKWLVKIKEWVDSHDPGALVIPFSGGLESQLQDSSEEERQKYCTEHKTQSALSKIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF+D KE GSE
Sbjct  302  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  362  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  397



>ref|XP_006798459.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=395

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K   ++E K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIMLKIKNWVVEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMLYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S ALE  L DM  +E  KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  359  TAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNAPKK  394



>gb|EGI59771.1| GTP-binding protein [Acromyrmex echinatior]
Length=349

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK  L DE K  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKK
Sbjct  131  KPEYDTLLKVKGVLTDEKKHIRFADWSANDIEVLNKYLFLTSKPIIYLVNLSEKDYIRKK  190

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS   E  + DM   E AKY EE+KV SAL KII  G+
Sbjct  191  NKWLIKIKEWVDKNDPGAVLIPFSGVFENKIFDMDEAERAKYFEEHKVTSALDKIIVQGY  250

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFT+G DEVK W I++ TKAPQAAG IHTD E+GFI AEVMKFED K  GSE 
Sbjct  251  KALQLQYFFTSGHDEVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKNEGSEA  310

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  311  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  344



>emb|CBK21211.2| unnamed protein product [Blastocystis hominis]
Length=414

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K E+E   K+  ++ EGKD R   W AA+IE++NT+QLL+AKP+VYL N++EK+Y  +K+
Sbjct  200  KEEYETLKKILETMQEGKDIRAVRWNAAEIEVINTYQLLSAKPIVYLCNLSEKNYILRKD  259

Query  563  KFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
              + K+   V   G GE +IPFSA  E  L +M  +EA  YCE+   +S LP+II TG+ 
Sbjct  260  PLMDKVREKVAAMGLGEQVIPFSARFETKLLNMSEEEAKAYCEKYHTKSQLPRIITTGYH  319

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
             +NLI+FFTAG DEVKCW IR+ T APQAAG IHTD E+GFICAEV KFED KEL +E A
Sbjct  320  VLNLIHFFTAGADEVKCWTIRKGTLAPQAAGVIHTDFEKGFICAEVYKFEDFKELKTEAA  379

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +KA GK +QEG+ Y VQDGDVIFFKFNV   GKK
Sbjct  380  IKAAGKLKQEGRNYEVQDGDVIFFKFNVGTEGKK  413



>ref|XP_005452973.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Oreochromis niloticus]
Length=398

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  182  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  242  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  302  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  362  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  397



>ref|XP_628099.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
 gb|EAK88561.1| yyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA binding domain 
TGS [Cryptosporidium parvum Iowa II]
Length=398

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  674  EWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWVQEHGGELIIPFSA  495
            +WK++++E+LN  Q LTAKPVVYLVN++EKDY R+KNKFLPKI  WV+EH   +IIP+SA
Sbjct  207  DWKSSEVELLNEHQFLTAKPVVYLVNLSEKDYIRQKNKFLPKIAEWVKEHIDGVIIPYSA  266

Query  494  ALERSLADMPPDE--AAKYCEENKVQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRR  321
              E +LA++  +E   A   E+   +S + KII TG+SA+NL+++FTAG DEVKCW IR 
Sbjct  267  EFEAALAELHTEEEKMAYIKEKGASKSMIDKIINTGYSALNLLHYFTAGEDEVKCWTIRS  326

Query  320  QTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQEGKTYVVQDGDVI  141
             TKAPQAAG IHTD ERGFICAEV KF DL ELGSE A+KA GKY Q+GK YVV+DGD+I
Sbjct  327  GTKAPQAAGIIHTDFERGFICAEVYKFTDLMELGSEAAIKAAGKYLQKGKDYVVEDGDII  386

Query  140  FFKFNVSGGGKK  105
            FFKFNV+  GKK
Sbjct  387  FFKFNVTNSGKK  398



>ref|XP_005452972.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Oreochromis niloticus]
Length=423

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  207  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  266

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSAL KIIK G
Sbjct  267  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSALSKIIKAG  326

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  327  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  386

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  387  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  422



>ref|XP_008397950.1| PREDICTED: obg-like ATPase 1 [Poecilia reticulata]
Length=395

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 156/216 (72%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LKVK   ++E K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  179  KPEYDIILKVKNWVVEEKKHVRFYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IP S A+E  L +M  +E+ KYCEE K QS L KIIKTG
Sbjct  239  KNKWLAKIKEWVDAHDPGAMVIPLSGAVEAKLQEMEEEESTKYCEEQKTQSVLTKIIKTG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++ + L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  299  YAGLQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFNDFKEEGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ G+ YVV+DGD+IFFKFN     KK
Sbjct  359  SAAKAAGKYRQLGRNYVVEDGDIIFFKFNTPNAPKK  394



>emb|CDQ57167.1| unnamed protein product [Oncorhynchus mykiss]
Length=399

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 156/210 (74%), Gaps = 3/210 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++ LK+K  + DE K  R   +W   +IE+LN +  LT+KP++YL+N++EKDY R+
Sbjct  182  KPEYDVMLKIKNWVADEKKHVRYCRDWTEKEIEVLNKYLFLTSKPMIYLINLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  +E  L DM  +E  KYC E+K QS L +IIK G
Sbjct  242  KNKWLVKIKEWVDSHDPGALVIPFSGGVESLLQDMSEEEIQKYCTEHKAQSVLTRIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            + A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMKFED KE GSE
Sbjct  302  YGALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFEDFKEGGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNV  123
             AVKA GKYRQ+GKTY+V+DGDVIFFKFN 
Sbjct  362  NAVKAAGKYRQQGKTYIVEDGDVIFFKFNT  391



>ref|XP_396711.3| PREDICTED: obg-like ATPase 1-like isoformX1 [Apis mellifera]
 ref|XP_006557926.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Apis mellifera]
Length=397

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 154/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVK-TSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK   +DE +  R  +W A DIE+LN +  LT+KPV+YL+N++EKDY RKK
Sbjct  179  KPEYDTLLKVKGVMVDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLINLSEKDYVRKK  238

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS A E  L DM   E  KY EE KV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDPGAILIPFSGAFENKLLDMNEAERGKYLEEGKVTSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAG DEVK W I+R TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE 
Sbjct  299  KALQLQYFFTAGHDEVKAWTIQRGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEA  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  359  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  392



>ref|XP_005237197.1| PREDICTED: obg-like ATPase 1 [Falco peregrinus]
Length=395

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  179  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  238

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  239  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  298

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  299  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  358

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  359  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  394



>ref|XP_003400207.1| PREDICTED: GTP-binding protein CG1354-like [Bombus terrestris]
Length=397

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVK-TSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK   +DE +  R  +W A DIE+LN +  LT+KPV+YLVN++EKDY RKK
Sbjct  179  KPEYDTLLKVKGIMVDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLVNLSEKDYIRKK  238

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS   E  L DM   E AKY EENKV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDPGAILIPFSGTFENKLFDMDDAERAKYQEENKVTSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAG DEVK W I++ TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE 
Sbjct  299  KALQLQYFFTAGHDEVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEA  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD++FFKFN   G K
Sbjct  359  AVKAAGKYRQQGRNYVVEDGDIVFFKFNAGAGLK  392



>gb|ESL05473.1| GTP-binding protein [Trypanosoma rangeli SC58]
Length=361

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 153/213 (72%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+ LKVK  L+ G+  R   W   +I+ LNT QLLTAKP ++L NM+EK + R++ 
Sbjct  149  KADLEILLKVKEHLENGEQVRCCHWNGKEIDYLNTLQLLTAKPAIFLANMSEKSFIRQRG  208

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+L K+  W+ +H GE +IP SA +E    DM P+E  +YC+ NK +S + K++ T + A
Sbjct  209  KWLAKLKEWIDQHTGEPLIPVSAEMEAKFVDMSPEEVEEYCKANKTKSQVNKVVTTSYHA  268

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI++FTAG DEVKCW I+R TKAPQAAG IHTD+E+GFICAEV+ +ED  +L SE A 
Sbjct  269  INLIHYFTAGADEVKCWTIQRGTKAPQAAGKIHTDMEKGFICAEVIHWEDYDKLESEAAC  328

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  QEG+ Y VQDGD+IFFKFNVS GGKK
Sbjct  329  REAGKQHQEGRNYEVQDGDIIFFKFNVSKGGKK  361



>ref|XP_006788528.1| PREDICTED: obg-like ATPase 1-like [Neolamprologus brichardi]
Length=398

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  182  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  241

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KYC E+K QSA+ KIIK G
Sbjct  242  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYCTEHKTQSAVSKIIKAG  301

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  302  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  361

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  362  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  397



>gb|KFW86891.1| Obg-like ATPase 1, partial [Manacus vitellinus]
Length=370

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K++T  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  154  KPEYDVMCKIRTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  213

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  214  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  273

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  274  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  333

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  334  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  369



>ref|XP_002646525.1| C. briggsae CBR-TAG-210 protein [Caenorhabditis briggsae]
 emb|CAP37396.1| Protein CBR-TAG-210 [Caenorhabditis briggsae]
Length=395

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            KIE++  ++VK  L+E K  R   W   +IEILN +  LTAKP+VYLVN++EKDY RKKN
Sbjct  179  KIEYDTLVRVKKCLEEKKPVRQEIWNEKEIEILNKYLFLTAKPIVYLVNLSEKDYIRKKN  238

Query  563  KFLPKIHAWV-QEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFS  387
            K+LPKI AW+ Q   G ++IPFS A E  L DMP DE AKY +E  V S L KI+ TG+ 
Sbjct  239  KWLPKIKAWIDQNDAGAVLIPFSGAFELKLLDMPEDERAKYLKEQGVTSNLDKIVHTGYK  298

Query  386  AINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPA  207
            A+ L YFFTAG DEVK W I+  T AP+AAG IHTD E+GFI AEVMK  DL ELG E  
Sbjct  299  ALQLEYFFTAGEDEVKAWTIQVGTPAPKAAGRIHTDFEKGFIMAEVMKVADLIELGDESK  358

Query  206  VKAGGKYRQEGKTYVVQDGDVIFFKFNVSGG  114
             K  GKYRQ+GKTY+VQDGDVIFFKFN   G
Sbjct  359  CKGAGKYRQQGKTYIVQDGDVIFFKFNAGAG  389



>ref|XP_004557802.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Maylandia zebra]
Length=350

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  134  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  193

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G
Sbjct  194  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAG  253

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  254  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  313

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  314  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  349



>ref|XP_005519864.1| PREDICTED: obg-like ATPase 1 isoform X1 [Pseudopodoces humilis]
 ref|XP_005519865.1| PREDICTED: obg-like ATPase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_005519866.1| PREDICTED: obg-like ATPase 1 isoform X3 [Pseudopodoces humilis]
 ref|XP_008632970.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 ref|XP_008632971.1| PREDICTED: obg-like ATPase 1 isoform X1 [Corvus brachyrhynchos]
 gb|KFO59967.1| Obg-like ATPase 1 [Corvus brachyrhynchos]
Length=396

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_005049114.1| PREDICTED: obg-like ATPase 1 [Ficedula albicollis]
Length=396

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_005723547.1| PREDICTED: obg-like ATPase 1-like isoform X4 [Pundamilia nyererei]
 ref|XP_005921549.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Haplochromis burtoni]
Length=348

 Score =   250 bits (639),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  132  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  191

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G
Sbjct  192  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAG  251

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  252  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  311

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  312  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  347



>ref|XP_002198993.1| PREDICTED: obg-like ATPase 1 isoform 1 [Taeniopygia guttata]
 ref|XP_004176777.1| PREDICTED: obg-like ATPase 1 isoform 2 [Taeniopygia guttata]
Length=396

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  395



>ref|XP_009070315.1| PREDICTED: obg-like ATPase 1 [Acanthisitta chloris]
Length=396

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ YVV+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYVVEDGDIIFFKFNTPQQPKK  395



>gb|KFH65596.1| GTP-binding protein YchF [Mortierella verticillata NRRL 6337]
Length=399

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = -1

Query  716  VKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAW  537
            +K  +++ KD R G+W   ++E++N   LLTAKPV+YLVN++E DY RKKNK+L KIHAW
Sbjct  194  LKHVVEDHKDVRCGDWNNKEVEVINPLMLLTAKPVIYLVNLSEADYIRKKNKWLAKIHAW  253

Query  536  VQ-EHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSAINLIYFFT  360
            VQ  + G+++IPFS ALE  ++DM   E  +  ++   QSALPKII +G+ A+NLIY+FT
Sbjct  254  VQTNNAGDMLIPFSGALESRISDMSEAEREEELKKIATQSALPKIIVSGYQALNLIYYFT  313

Query  359  AGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAVKAGGKYRQ  180
             GP EV+CW IR+ TKAPQAAG IH+D ERGFI AE M+++DLKELG+E AVK  GKY Q
Sbjct  314  CGPQEVRCWSIRKGTKAPQAAGVIHSDFERGFIMAETMRYDDLKELGTEAAVKGAGKYMQ  373

Query  179  EGKTYVVQDGDVIFFKFNVSGGGKK  105
            +G+ Y V DGD+I FKFNV+   KK
Sbjct  374  KGRDYTVGDGDIIHFKFNVTAQPKK  398



>gb|EDL27121.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
 gb|EDL27122.1| RIKEN cDNA 2810409H07, isoform CRA_a [Mus musculus]
Length=309

 Score =   249 bits (635),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  93   KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  152

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  153  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  212

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED K+ GSE
Sbjct  213  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKDEGSE  272

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  273  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  308



>ref|XP_003704224.1| PREDICTED: GTP-binding protein CG1354-like [Megachile rotundata]
Length=397

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVK-TSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK   +DE +  R  +W A DIE+LN +  LT+KPV+YLVN++EKDY RKK
Sbjct  179  KPEYDTLLKVKGVMVDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLVNLSEKDYIRKK  238

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS A E  L DM   E AKY EENKV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDPGAVLIPFSGAFENKLLDMDEVERAKYLEENKVTSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFTAG DEVK W I++ TKAPQAAG IHTD E+GFI AEVMK++D K  GSE 
Sbjct  299  KALQLQYFFTAGHDEVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKNEGSEA  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
             VKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  359  GVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  392



>ref|XP_005723546.1| PREDICTED: obg-like ATPase 1-like isoform X3 [Pundamilia nyererei]
Length=350

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K+  +DE K  R   +W   +IE+LN +  LT+KP++YLVN++EKDY R+
Sbjct  134  KPEYDIMCKIKSWVVDEKKHIRYYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRR  193

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IPFS  LE  L D   +E  KY  E+K QSAL KIIK G
Sbjct  194  KNKWLVKIKEWVDSHDPGALVIPFSGGLESLLQDKSEEERQKYSTEHKTQSALSKIIKAG  253

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD ERGFI AEVMKF+D KE GSE
Sbjct  254  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFERGFIMAEVMKFQDFKEEGSE  313

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  314  SAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKK  349



>ref|XP_008216612.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216613.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216614.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
 ref|XP_008216615.1| PREDICTED: obg-like ATPase 1 [Nasonia vitripennis]
Length=397

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKD-ARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK  L E K+  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKK
Sbjct  179  KPEYDCLLKVKQVLVEDKNHIRFADWSANDIEVLNKYLFLTSKPMIYLVNLSEKDYIRKK  238

Query  566  NKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G  +IPFS A E    DM   E AKY EE+KV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDPGAALIPFSGAFENKFIDMDEGERAKYVEESKVSSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L+YFFTAG DEVK W I++ TKAPQAAG IHTD E+GFI AEVMKFED K  GSE 
Sbjct  299  KALQLMYFFTAGHDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMKFEDFKNEGSES  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  359  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  392



>ref|XP_006636567.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Lepisosteus oculatus]
Length=348

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 157/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+K  + DE K  R   EW   +IE+LN +  LT+KP++YLVN++EKDY RK
Sbjct  132  KPEYDIMCKIKNWVEDEKKHVRYCHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRK  191

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G ++IPFS  LE  L DM  +E  KY EE+K QS L KIIK+G
Sbjct  192  KNKWLVKIKEWVDSHDPGAMVIPFSGGLELKLQDMSDEEKEKYTEEHKTQSVLTKIIKSG  251

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IH+D E+GFI AEVMKF+D KE GSE
Sbjct  252  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHSDFEKGFIMAEVMKFQDFKEEGSE  311

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y V+DGD+IFFKFN     KK
Sbjct  312  SAVKAAGKYRQQGRNYTVEDGDIIFFKFNTPNQPKK  347



>ref|NP_001268915.1| obg-like ATPase 1 isoform 2 [Danio rerio]
Length=348

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +DE K  R   EW   +IE+LN    LT+KP++YLVN++EKDY RK
Sbjct  132  KPEYDIMCKVKSWVVDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRK  191

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV  H  G L+IP S   E    DM  +E  KYCEENK QS L KIIK+G
Sbjct  192  KNKWLVKIKEWVDAHDPGALVIPLSGGFESKYQDMSDEEKQKYCEENKTQSILTKIIKSG  251

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            +SA+ L YFFTAGPDEV+ W +R+ TKAPQAAG IHTD E+GFI AEVMKF D KE GSE
Sbjct  252  YSALQLEYFFTAGPDEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSE  311

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             A KA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  312  NAAKAAGKYRQQGRNYIVEDGDIIFFKFNTPNQPKK  347



>ref|XP_009311370.1| GTP-binding protein [Trypanosoma grayi]
 gb|KEG10404.1| GTP-binding protein [Trypanosoma grayi]
Length=394

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 157/213 (74%), Gaps = 0/213 (0%)
 Frame = -1

Query  743  KIEHELCLKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKN  564
            K + E+ LKVK  L++ +  R  +W   +I+ LNT QLLTAKP ++L NM+EKD+ R+++
Sbjct  182  KADLEILLKVKEHLEKDEQIRCCQWNGKEIDYLNTLQLLTAKPAIFLANMSEKDFIRQRS  241

Query  563  KFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGFSA  384
            K+LPK+  W+ +H GE +IP SA LE +L +M P++  ++C  NK +S + KII T + A
Sbjct  242  KWLPKLKEWIDQHTGEPLIPVSAELESNLLNMSPEQVEEHCTANKTKSQVSKIITTAYHA  301

Query  383  INLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEPAV  204
            INLI+FFTAG DEVKCW I+R TKAPQAAG IH+D+E+GFICAEV+ +ED  +L +E A 
Sbjct  302  INLIHFFTAGSDEVKCWTIQRGTKAPQAAGKIHSDMEKGFICAEVIHWEDYDKLENEAAC  361

Query  203  KAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
            +  GK  QEG+ Y VQDGD+IFFKFN S GGKK
Sbjct  362  REAGKQHQEGRNYEVQDGDIIFFKFNTSKGGKK  394



>gb|KFH16391.1| putative GTP-binding protein, partial [Toxoplasma gondii MAS]
Length=223

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 159/221 (72%), Gaps = 18/221 (8%)
 Frame = -1

Query  740  IEHELC-------LKVKTSLDEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKD  582
            +EH +C       L++ +S+D         WKA+++E+LN +Q LTAK VVYLVNM+EKD
Sbjct  12   LEHCICFCFGCVFLRISSSVD---------WKASEVEVLNEYQFLTAKQVVYLVNMSEKD  62

Query  581  YQRKKNKFLPKIHAWVQEHGGELIIPFSAALERSLADMPPDEA-AKYCEE-NKVQSALPK  408
            + R+KNK+L KIH WV+ +    IIP+SA  E  LA++P D A  KY ++    +S L K
Sbjct  63   FIRQKNKWLAKIHGWVEANVSGPIIPYSAQFESKLAELPDDAAREKYIKDVGASRSQLDK  122

Query  407  IIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLK  228
            I+ TG+ A++LI+FFT G DEVKCW IR+ TKAPQAAG IHTD ERGFICAEV K+EDL 
Sbjct  123  IVTTGYHALHLIHFFTCGEDEVKCWTIRQGTKAPQAAGVIHTDFERGFICAEVYKYEDLV  182

Query  227  ELGSEPAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
              GSE AVKA GKY Q+GK YVV+DGD+IFFKFNV+  GKK
Sbjct  183  AAGSENAVKAAGKYLQKGKDYVVEDGDIIFFKFNVTNSGKK  223



>ref|XP_008933239.1| PREDICTED: obg-like ATPase 1 [Merops nubicus]
 gb|KFQ24822.1| Obg-like ATPase 1 [Merops nubicus]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_009680050.1| PREDICTED: obg-like ATPase 1 [Struthio camelus australis]
 gb|KFV84859.1| Obg-like ATPase 1 [Struthio camelus australis]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_009639084.1| PREDICTED: obg-like ATPase 1 [Egretta garzetta]
 gb|KFP17586.1| Obg-like ATPase 1 [Egretta garzetta]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_005152654.1| PREDICTED: obg-like ATPase 1 [Melopsittacus undulatus]
 ref|XP_009086251.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009086252.1| PREDICTED: obg-like ATPase 1 isoform X1 [Serinus canaria]
 ref|XP_009460338.1| PREDICTED: obg-like ATPase 1 [Nipponia nippon]
 ref|XP_009703255.1| PREDICTED: obg-like ATPase 1 [Cariama cristata]
 ref|XP_009863599.1| PREDICTED: obg-like ATPase 1 [Apaloderma vittatum]
 ref|XP_009904955.1| PREDICTED: obg-like ATPase 1 [Picoides pubescens]
 ref|XP_009994461.1| PREDICTED: obg-like ATPase 1 [Chaetura pelagica]
 gb|KFP67376.1| Obg-like ATPase 1 [Cariama cristata]
 gb|KFP84928.1| Obg-like ATPase 1 [Apaloderma vittatum]
 gb|KFQ94658.1| Obg-like ATPase 1 [Nipponia nippon]
 gb|KFU88570.1| Obg-like ATPase 1 [Chaetura pelagica]
 gb|KFV72142.1| Obg-like ATPase 1 [Picoides pubescens]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_010564826.1| PREDICTED: obg-like ATPase 1 [Haliaeetus leucocephalus]
Length=396

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  K+KT  +DE K  R   +W   +I++LN     T+KP++YLVN++EKDY RK
Sbjct  180  KPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRK  239

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV +H  G L+IPFS ALE  L DM  +E  KY EEN  QSAL KIIK G
Sbjct  240  KNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALAKIIKAG  299

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            ++A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  300  YAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSE  359

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  360  AAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  395



>ref|XP_004774421.1| PREDICTED: obg-like ATPase 1-like isoform X2 [Mustela putorius 
furo]
 ref|XP_004790976.1| PREDICTED: obg-like ATPase 1 isoform X2 [Mustela putorius furo]
Length=363

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = -1

Query  743  KIEHELCLKVKT-SLDEGKDARL-GEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRK  570
            K E+++  KVK+  +D+ K  R   +W   +IE+LN    LT+KP+VYLVN++EKDY RK
Sbjct  147  KPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRK  206

Query  569  KNKFLPKIHAWVQEHG-GELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTG  393
            KNK+L KI  WV ++  G L+IPFS ALE  L ++  +E  KY E N  QSALPKIIK G
Sbjct  207  KNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAG  266

Query  392  FSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSE  213
            F+A+ L YFFTAGPDEV+ W IR+ TKAPQAAG IHTD E+GFI AEVMK+ED KE GSE
Sbjct  267  FAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSE  326

Query  212  PAVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGKK  105
             AVKA GKYRQ+G+ Y+V+DGD+IFFKFN     KK
Sbjct  327  NAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKK  362



>ref|XP_011329428.1| PREDICTED: obg-like ATPase 1 [Cerapachys biroi]
Length=397

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = -1

Query  743  KIEHELCLKVKTSL-DEGKDARLGEWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKK  567
            K E++  LKVK+ L D+ K  R  +W A DIE+LN +  LT+KP++YLVN++EKDY RKK
Sbjct  179  KPEYDTLLKVKSVLLDDKKHIRFADWSANDIEVLNKYLFLTSKPIIYLVNLSEKDYIRKK  238

Query  566  NKFLPKIHAWVQEH-GGELIIPFSAALERSLADMPPDEAAKYCEENKVQSALPKIIKTGF  390
            NK+L KI  WV ++  G ++IPFS A E  + DM   E AKY EE+KV SAL KII  G+
Sbjct  239  NKWLIKIKEWVDKNDSGAVLIPFSGACENKILDMDEAERAKYFEEHKVTSALDKIIVQGY  298

Query  389  SAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGAIHTDLERGFICAEVMKFEDLKELGSEP  210
             A+ L YFFT+G DEVK W I++ TKAPQAAG IHTD E+GFI AEVMKF+D K  GSE 
Sbjct  299  KALQLHYFFTSGHDEVKAWTIQKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEA  358

Query  209  AVKAGGKYRQEGKTYVVQDGDVIFFKFNVSGGGK  108
            AVKA GKYRQ+G+ YVV+DGD+IFFKFN   G K
Sbjct  359  AVKAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLK  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210