BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF017B02

Length=771
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  378   9e-126   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  374   4e-124   Nicotiana tomentosiformis
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    363   4e-120   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   352   1e-115   
gb|KDO80590.1|  hypothetical protein CISIN_1g011107mg                   341   4e-114   Citrus sinensis [apfelsine]
gb|KDO80588.1|  hypothetical protein CISIN_1g011107mg                   342   7e-114   Citrus sinensis [apfelsine]
gb|KDO80587.1|  hypothetical protein CISIN_1g011107mg                   343   2e-113   Citrus sinensis [apfelsine]
gb|KDO80586.1|  hypothetical protein CISIN_1g011107mg                   343   2e-113   Citrus sinensis [apfelsine]
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    344   9e-113   Solanum tuberosum [potatoes]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   345   1e-112   Citrus sinensis [apfelsine]
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    345   1e-112   Cicer arietinum [garbanzo]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    344   2e-112   Citrus sinensis [apfelsine]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             344   2e-112   Citrus clementina [clementine]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    345   3e-112   
gb|AFK46379.1|  unknown                                                 335   6e-112   Medicago truncatula
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     342   7e-112   Medicago truncatula
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    342   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    342   1e-111   Populus euphratica
gb|KGN54555.1|  hypothetical protein Csa_4G361890                       338   2e-111   Cucumis sativus [cucumbers]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     341   2e-111   Medicago truncatula
gb|KJB59283.1|  hypothetical protein B456_009G247000                    334   3e-111   Gossypium raimondii
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             341   4e-111   Phaseolus vulgaris [French bean]
gb|ACJ85852.1|  unknown                                                 340   4e-111   Medicago truncatula
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    340   1e-110   Cucumis sativus [cucumbers]
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    342   1e-110   
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    339   1e-110   Fragaria vesca subsp. vesca
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    339   1e-110   
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    339   1e-110   Fragaria vesca subsp. vesca
gb|KHN21716.1|  Aldehyde dehydrogenase family 3 member H1               337   1e-110   Glycine soja [wild soybean]
gb|KJB59281.1|  hypothetical protein B456_009G247000                    336   2e-110   Gossypium raimondii
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    339   2e-110   
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    342   2e-110   Nelumbo nucifera [Indian lotus]
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   4e-110   Glycine max [soybeans]
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               338   5e-110   Gossypium arboreum [tree cotton]
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   9e-110   Populus euphratica
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   1e-109   Nelumbo nucifera [Indian lotus]
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   1e-109   Glycine max [soybeans]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    337   1e-109   Gossypium raimondii
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    336   2e-109   Glycine max [soybeans]
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    336   3e-109   Elaeis guineensis
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    336   4e-109   Glycine max [soybeans]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               336   4e-109   Glycine soja [wild soybean]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   5e-109   
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            335   6e-109   Simmondsia chinensis [goatnut]
gb|EYU23873.1|  hypothetical protein MIMGU_mgv1a005640mg                332   8e-109   Erythranthe guttata [common monkey flower]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               334   1e-108   Gossypium arboreum [tree cotton]
gb|KDP32847.1|  hypothetical protein JCGZ_12139                         334   2e-108   Jatropha curcas
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               338   2e-108   Glycine soja [wild soybean]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                333   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    333   3e-108   Cucumis melo [Oriental melon]
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             333   4e-108   Phaseolus vulgaris [French bean]
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    333   5e-108   Phoenix dactylifera
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               333   6e-108   
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    332   1e-107   Eucalyptus grandis [rose gum]
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    332   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    330   2e-107   
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               332   2e-107   
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          331   2e-107   
gb|KGN54554.1|  hypothetical protein Csa_4G361880                       330   3e-107   Cucumis sativus [cucumbers]
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             330   3e-107   Sesamum indicum [beniseed]
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    330   4e-107   
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    329   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    326   2e-106   
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          328   2e-106   
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     328   2e-106   Medicago truncatula
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             328   4e-106   Prunus persica
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    328   4e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   1e-105   Prunus mume [ume]
ref|XP_006847205.1|  hypothetical protein AMTR_s00017p00253390          324   1e-105   
gb|EYU31773.1|  hypothetical protein MIMGU_mgv1a018415mg                323   1e-105   Erythranthe guttata [common monkey flower]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   1e-105   Cucumis melo [Oriental melon]
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    326   2e-105   Cucumis melo [Oriental melon]
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    326   3e-105   Populus euphratica
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  325   4e-105   Sesamum indicum [beniseed]
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               325   4e-105   Gossypium arboreum [tree cotton]
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   6e-105   Tarenaya hassleriana [spider flower]
ref|NP_001077676.1|  aldehyde dehydrogenase 3H1                         322   9e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   1e-104   
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    324   1e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   2e-104   Pyrus x bretschneideri [bai li]
gb|KJB29202.1|  hypothetical protein B456_005G089100                    323   2e-104   Gossypium raimondii
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   2e-104   Vitis vinifera
gb|KJB29203.1|  hypothetical protein B456_005G089100                    322   2e-104   Gossypium raimondii
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    322   7e-104   Malus domestica [apple tree]
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        322   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             320   9e-104   
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            322   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    322   9e-104   
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    323   1e-103   Prunus mume [ume]
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                320   2e-103   Erythranthe guttata [common monkey flower]
emb|CBI19000.3|  unnamed protein product                                323   2e-103   Vitis vinifera
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   3e-102   
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     317   3e-102   Eucalyptus grandis [rose gum]
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   4e-102   
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   318   4e-102   Citrus sinensis [apfelsine]
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   5e-102   Pyrus x bretschneideri [bai li]
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             317   8e-102   Capsella rubella
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             318   9e-102   Citrus clementina [clementine]
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   318   9e-102   Citrus sinensis [apfelsine]
ref|NP_001065921.1|  Os11g0186200                                       316   1e-101   
ref|XP_002888606.1|  ALDH3H1                                            316   1e-101   
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     317   1e-101   Eucalyptus grandis [rose gum]
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        316   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    318   2e-101   Vitis vinifera
emb|CBI21614.3|  unnamed protein product                                318   2e-101   Vitis vinifera
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             318   2e-101   Phaseolus vulgaris [French bean]
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    315   4e-101   Brachypodium distachyon [annual false brome]
ref|XP_006662790.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    311   6e-101   
gb|KJB64495.1|  hypothetical protein B456_010G051500                    313   7e-101   Gossypium raimondii
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    316   1e-100   Eucalyptus grandis [rose gum]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    314   1e-100   
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    315   1e-100   Eucalyptus grandis [rose gum]
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    313   1e-100   Cicer arietinum [garbanzo]
emb|CAE51203.1|  putative aldehyde dehydrogenase                        313   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KJB64493.1|  hypothetical protein B456_010G051500                    313   2e-100   Gossypium raimondii
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    315   3e-100   Populus euphratica
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    312   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    312   4e-100   Oryza brachyantha
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    312   5e-100   Camelina sativa [gold-of-pleasure]
emb|CDY36336.1|  BnaC08g05150D                                          311   9e-100   Brassica napus [oilseed rape]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    311   1e-99    Camelina sativa [gold-of-pleasure]
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    311   1e-99    Craterostigma plantagineum
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    310   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    312   2e-99    
emb|CAN73659.1|  hypothetical protein VITISV_044129                     312   2e-99    Vitis vinifera
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    310   3e-99    Brassica rapa
emb|CDY36018.1|  BnaA08g04430D                                          310   3e-99    Brassica napus [oilseed rape]
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             310   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_009350139.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    308   9e-99    
ref|XP_010437649.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010444975.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    301   1e-98    
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    310   2e-98    Fragaria vesca subsp. vesca
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    308   2e-98    Brassica rapa
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    309   2e-98    Vitis vinifera
gb|ABR16899.1|  unknown                                                 309   4e-98    Picea sitchensis
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    309   4e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    309   5e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          306   7e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EAY82454.1|  hypothetical protein OsI_37671                          306   7e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    306   9e-98    Cicer arietinum [garbanzo]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        306   9e-98    Oryza sativa Japonica Group [Japonica rice]
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     308   1e-97    Medicago truncatula
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               305   2e-97    Arabis alpina [alpine rockcress]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             305   3e-97    Eutrema salsugineum [saltwater cress]
ref|NP_001168661.1|  hypothetical protein                               305   4e-97    Zea mays [maize]
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    311   7e-97    Populus euphratica
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   7e-97    
emb|CAC84903.1|  aldehyde dehydrogenase                                 305   2e-96    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01937.1|  predicted protein                                      303   2e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   2e-96    Cicer arietinum [garbanzo]
emb|CAB36701.1|  putative aldehyde dehydrogenase                        304   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   3e-96    Cicer arietinum [garbanzo]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   4e-96    Camelina sativa [gold-of-pleasure]
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            304   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    304   5e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    303   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          301   8e-96    
ref|XP_002869163.1|  ALDH3I1                                            302   2e-95    Arabidopsis lyrata subsp. lyrata
gb|KHG17901.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    296   3e-95    Gossypium arboreum [tree cotton]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               300   3e-95    
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    300   3e-95    Tarenaya hassleriana [spider flower]
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          301   5e-95    
gb|KJB75337.1|  hypothetical protein B456_012G037500                    298   5e-95    Gossypium raimondii
gb|KJB75341.1|  hypothetical protein B456_012G037500                    298   1e-94    Gossypium raimondii
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               300   2e-94    
emb|CDX69039.1|  BnaC01g04140D                                          300   2e-94    
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                    296   2e-94    
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               299   3e-94    
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         297   3e-94    Zea mays [maize]
gb|ACF85700.1|  unknown                                                 296   5e-94    Zea mays [maize]
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             298   6e-94    Eutrema salsugineum [saltwater cress]
gb|KJB75338.1|  hypothetical protein B456_012G037500                    298   8e-94    Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                    298   1e-93    Gossypium raimondii
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             297   1e-93    Capsella rubella
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    297   2e-93    
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    297   2e-93    Arabis alpina [alpine rockcress]
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    297   2e-93    
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    297   3e-93    Brassica rapa
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    295   3e-93    
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               293   3e-93    Triticum urartu
gb|AID60136.1|  aldehyde dehydrogenase 3                                296   4e-93    Brassica napus [oilseed rape]
emb|CDX75414.1|  BnaA01g02880D                                          296   4e-93    
gb|ABK24239.1|  unknown                                                 293   7e-93    Picea sitchensis
gb|EMT24757.1|  Aldehyde dehydrogenase family 3 member H1               287   3e-92    
gb|EPS67421.1|  aldehyde dehydrogenase                                  283   7e-92    Genlisea aurea
gb|EMS67813.1|  Aldehyde dehydrogenase family 3 member H1               285   2e-91    Triticum urartu
ref|XP_002893982.1|  ALDH3H1                                            290   2e-91    
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               290   7e-91    
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          288   2e-90    Sorghum bicolor [broomcorn]
gb|KJB75339.1|  hypothetical protein B456_012G037500                    287   2e-89    Gossypium raimondii
gb|AFW56225.1|  hypothetical protein ZEAMMB73_146423                    280   4e-88    
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    280   1e-87    Brachypodium distachyon [annual false brome]
gb|ACL53721.1|  unknown                                                 279   3e-87    Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    279   4e-87    Zea mays [maize]
ref|XP_010093107.1|  Aldehyde dehydrogenase family 3 member I1          274   5e-84    
ref|XP_001780129.1|  variable substrate                                 270   2e-83    
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    269   2e-83    Setaria italica
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    267   4e-83    Tarenaya hassleriana [spider flower]
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    268   4e-82    Tarenaya hassleriana [spider flower]
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             264   1e-81    
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             264   2e-81    
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             262   2e-80    
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             261   2e-80    
ref|XP_001764841.1|  variable substrate                                 257   1e-78    
ref|XP_001757163.1|  variable substrate                                 253   4e-77    
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    251   4e-76    
gb|KHN21904.1|  Aldehyde dehydrogenase family 3 member F1               244   3e-74    Glycine soja [wild soybean]
gb|EPS67391.1|  aldehyde dehydrogenase                                  243   7e-74    Genlisea aurea
ref|XP_003539064.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    244   8e-74    Glycine max [soybeans]
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    242   8e-73    
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g             239   8e-72    Phaseolus vulgaris [French bean]
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                   236   3e-71    Citrus sinensis [apfelsine]
ref|XP_001767194.1|  variable substrate                                 237   5e-71    
gb|AFK41010.1|  unknown                                                 226   8e-69    Lotus japonicus
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g             231   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_001770374.1|  variable substrate                                 230   1e-68    
ref|XP_010045018.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   6e-68    Eucalyptus grandis [rose gum]
gb|KDO71077.1|  hypothetical protein CISIN_1g0386172mg                  225   1e-67    Citrus sinensis [apfelsine]
ref|XP_010031796.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    227   4e-67    Eucalyptus grandis [rose gum]
gb|KCW87154.1|  hypothetical protein EUGRSUZ_B03682                     226   5e-67    Eucalyptus grandis [rose gum]
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             226   6e-67    Citrus clementina [clementine]
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    226   7e-67    Cicer arietinum [garbanzo]
ref|XP_011006203.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    226   8e-67    Populus euphratica
ref|XP_011006204.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    226   8e-67    Populus euphratica
gb|KJB29204.1|  hypothetical protein B456_005G089100                    224   8e-67    Gossypium raimondii
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    225   2e-66    Citrus sinensis [apfelsine]
ref|XP_010045016.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    225   2e-66    Eucalyptus grandis [rose gum]
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   3e-66    Nicotiana sylvestris
dbj|BAJ96457.1|  predicted protein                                      224   4e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   6e-66    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   7e-66    Cicer arietinum [garbanzo]
ref|XP_010045013.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   9e-66    
ref|XP_006345274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   1e-65    
gb|KCW87152.1|  hypothetical protein EUGRSUZ_B03680                     223   2e-65    Eucalyptus grandis [rose gum]
gb|KJE97385.1|  aldehyde dehydrogenase type III-PG                      222   4e-65    Capsaspora owczarzaki ATCC 30864
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   4e-65    Cucumis melo [Oriental melon]
gb|EAZ31491.1|  hypothetical protein OsJ_15627                          218   5e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   5e-65    Nelumbo nucifera [Indian lotus]
ref|XP_007150367.1|  hypothetical protein PHAVU_005G147600g             221   6e-65    Phaseolus vulgaris [French bean]
ref|XP_004343114.1|  aldehyde dehydrogenase type III-PG                 222   1e-64    Capsaspora owczarzaki ATCC 30864
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1          221   1e-64    Morus notabilis
gb|KFM72617.1|  Aldehyde dehydrogenase, dimeric NADP-preferring         221   2e-64    Stegodyphus mimosarum
ref|XP_010555061.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    220   2e-64    Tarenaya hassleriana [spider flower]
gb|KCW51186.1|  hypothetical protein EUGRSUZ_J00772                     220   2e-64    Eucalyptus grandis [rose gum]
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          220   2e-64    Medicago truncatula
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   2e-64    
ref|XP_010034106.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    220   3e-64    
ref|XP_003547154.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   3e-64    
gb|KHN33348.1|  Aldehyde dehydrogenase family 3 member F1               219   3e-64    Glycine soja [wild soybean]
ref|XP_003547955.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   4e-64    
ref|XP_003543533.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   4e-64    Glycine max [soybeans]
gb|KCW56679.1|  hypothetical protein EUGRSUZ_I02377                     214   4e-64    Eucalyptus grandis [rose gum]
gb|AFK48458.1|  unknown                                                 219   4e-64    Medicago truncatula
gb|KHN41688.1|  Aldehyde dehydrogenase family 3 member F1               219   5e-64    Glycine soja [wild soybean]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   6e-64    
ref|XP_010536078.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   9e-64    Tarenaya hassleriana [spider flower]
gb|KJB55349.1|  hypothetical protein B456_009G072900                    218   9e-64    Gossypium raimondii
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   1e-63    Cucumis melo [Oriental melon]
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   1e-63    Oryza brachyantha
ref|NP_001053442.1|  Os04g0540600                                       218   1e-63    
gb|KHN30135.1|  Aldehyde dehydrogenase family 3 member F1               218   2e-63    Glycine soja [wild soybean]
gb|KHG24071.1|  Aldehyde dehydrogenase family 3 member F1               218   2e-63    Gossypium arboreum [tree cotton]
ref|XP_002273358.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   2e-63    Vitis vinifera
emb|CBI17422.3|  unnamed protein product                                217   2e-63    Vitis vinifera
ref|XP_006829153.1|  hypothetical protein AMTR_s00001p00269720          217   3e-63    Amborella trichopoda
ref|XP_010029722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   3e-63    Eucalyptus grandis [rose gum]
ref|WP_018397546.1|  hypothetical protein                               216   3e-63    filamentous cyanobacterium ESFC-1
ref|WP_012163534.1|  aldehyde dehydrogenase                             216   5e-63    Acaryochloris marina
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   6e-63    
ref|WP_006527043.1|  NAD-dependent aldehyde dehydrogenase               215   9e-63    Gloeocapsa sp. PCC 73106
gb|KEH30216.1|  NAD-dependent aldehyde dehydrogenase family protein     215   1e-62    Medicago truncatula
ref|XP_002448250.1|  hypothetical protein SORBIDRAFT_06g023975          211   1e-62    
ref|XP_010034275.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   1e-62    
ref|XP_007015039.1|  Aldehyde dehydrogenase family 3 member F1          220   1e-62    
emb|CAE48163.1|  putative aldehyde dehydrogenase                        215   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KCW51189.1|  hypothetical protein EUGRSUZ_J00776                     215   2e-62    Eucalyptus grandis [rose gum]
gb|KGN54173.1|  hypothetical protein Csa_4G291370                       214   2e-62    Cucumis sativus [cucumbers]
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            214   2e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AFW59012.1|  hypothetical protein ZEAMMB73_052021                    210   2e-62    
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    214   3e-62    
ref|XP_005811793.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   3e-62    
gb|KJB55351.1|  hypothetical protein B456_009G072900                    214   3e-62    
gb|EYU31156.1|  hypothetical protein MIMGU_mgv1a0038971mg               211   4e-62    
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg             214   5e-62    
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   6e-62    
gb|EPS59682.1|  aldehyde dehydrogenase                                  213   6e-62    
emb|CDX75566.1|  BnaA01g01360D                                          212   6e-62    
ref|WP_010474036.1|  aldehyde dehydrogenase                             213   6e-62    
ref|XP_003520274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   6e-62    
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   7e-62    
gb|KHN00502.1|  Aldehyde dehydrogenase family 3 member F1               213   8e-62    
dbj|BAJ86301.1|  predicted protein                                      213   1e-61    
ref|XP_009590099.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   1e-61    
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   2e-61    
ref|XP_002869039.1|  ALDH3F1                                            212   2e-61    
emb|CDX77447.1|  BnaA07g05850D                                          212   2e-61    
ref|XP_009346294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   2e-61    
ref|XP_009781320.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   2e-61    
ref|NP_001047575.1|  Os02g0646500                                       212   2e-61    
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   2e-61    
emb|CDP01945.1|  unnamed protein product                                212   3e-61    
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg             211   3e-61    
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   3e-61    
ref|XP_007575678.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   3e-61    
ref|XP_010113456.1|  Aldehyde dehydrogenase family 3 member F1          211   4e-61    
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       211   4e-61    
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   4e-61    
gb|AFW59014.1|  hypothetical protein ZEAMMB73_052021                    210   5e-61    
ref|XP_010446811.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   5e-61    
ref|WP_041235482.1|  aldehyde dehydrogenase                             210   6e-61    
gb|AFZ51141.1|  NAD-dependent aldehyde dehydrogenase                    210   6e-61    
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    211   6e-61    
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   6e-61    
ref|WP_040008058.1|  aldehyde dehydrogenase                             210   7e-61    
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   8e-61    
gb|EFA71109.1|  Aldehyde dehydrogenase                                  210   8e-61    
emb|CDX69216.1|  BnaC01g02370D                                          210   8e-61    
ref|XP_009781319.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   9e-61    
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   1e-60    
ref|XP_004953284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   1e-60    
ref|XP_010437362.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    210   1e-60    
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    209   1e-60    
ref|XP_008844512.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    209   2e-60    
gb|ABN13589.1|  aldehyde dehydrogenase                                  202   2e-60    
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          210   2e-60    
ref|WP_035405643.1|  aldehyde dehydrogenase                             209   2e-60    
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1         211   2e-60    
gb|ACR38486.1|  unknown                                                 209   2e-60    
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-60    
gb|KFO94567.1|  Fatty aldehyde dehydrogenase                            208   3e-60    
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                    209   3e-60    
ref|XP_001688503.1|  AGAP005124-PA                                      209   3e-60    
gb|KDP32663.1|  hypothetical protein JCGZ_13661                         209   3e-60    
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    209   3e-60    
ref|XP_010142170.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    208   3e-60    
gb|AGI96739.1|  aldehyde dehydrogenase 3-1 variant B                    209   3e-60    
ref|NP_001147083.1|  LOC100280692                                       209   3e-60    
ref|WP_016878575.1|  aldehyde dehydrogenase                             208   3e-60    
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          209   3e-60    
ref|NP_001151141.1|  aldehyde dehydrogenase 3B1                         209   3e-60    
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          209   3e-60    
gb|KFM06810.1|  Fatty aldehyde dehydrogenase                            209   4e-60    
ref|XP_009276469.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    209   4e-60    
ref|XP_010316396.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    209   4e-60    
gb|KDP22085.1|  hypothetical protein JCGZ_25916                         208   4e-60    
ref|WP_007619784.1|  aldehyde dehydrogenase                             207   6e-60    
ref|XP_009276470.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    208   6e-60    
ref|XP_011285423.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   6e-60    
gb|EMT10079.1|  Aldehyde dehydrogenase family 3 member F1               204   7e-60    
ref|WP_017292666.1|  hypothetical protein                               207   7e-60    
ref|WP_039727975.1|  MULTISPECIES: aldehyde dehydrogenase               207   8e-60    
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    208   8e-60    
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    208   9e-60    
ref|XP_008413291.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-59    
emb|CDY35463.1|  BnaC03g61970D                                          207   1e-59    
ref|WP_017306063.1|  hypothetical protein                               207   1e-59    
ref|WP_009326028.1|  aldehyde dehydrogenase                             207   1e-59    
gb|KIE11140.1|  aldehyde dehydrogenase                                  204   1e-59    
ref|WP_023072260.1|  aldehyde dehydrogenase                             207   1e-59    
ref|WP_036006670.1|  aldehyde dehydrogenase                             206   1e-59    
ref|XP_001362651.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   1e-59    
gb|ERL90558.1|  hypothetical protein D910_07906                         201   1e-59    
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-59    
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-59    
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-59    
ref|XP_005056938.1|  PREDICTED: fatty aldehyde dehydrogenase-like       204   2e-59    
ref|XP_004713785.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   2e-59    
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    207   2e-59    
ref|WP_015186936.1|  Aldehyde Dehydrogenase                             206   2e-59    
emb|CDY59717.1|  BnaA03g59170D                                          207   2e-59    
ref|XP_010778363.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   2e-59    
ref|XP_004598282.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   2e-59    
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    206   3e-59    
ref|WP_017316439.1|  aldehyde dehydrogenase                             206   3e-59    
ref|XP_006033466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   3e-59    
gb|KJB17711.1|  hypothetical protein B456_003G011600                    201   4e-59    
ref|XP_008928730.1|  PREDICTED: fatty aldehyde dehydrogenase-like       206   4e-59    
gb|KFW86502.1|  Fatty aldehyde dehydrogenase                            206   4e-59    
ref|WP_015160249.1|  NAD-dependent aldehyde dehydrogenase               205   4e-59    
ref|XP_009556787.1|  PREDICTED: fatty aldehyde dehydrogenase            206   4e-59    
gb|KFO74386.1|  Fatty aldehyde dehydrogenase                            206   5e-59    
ref|XP_001653928.1|  AAEL009664-PA                                      205   5e-59    
ref|XP_004598281.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   5e-59    
gb|KFQ29190.1|  Fatty aldehyde dehydrogenase                            206   5e-59    
ref|WP_015203433.1|  aldehyde dehydrogenase                             205   5e-59    
emb|CDY24790.1|  BnaA08g15200D                                          206   6e-59    
ref|XP_004627191.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   6e-59    
ref|WP_006519525.1|  NAD-dependent aldehyde dehydrogenase               205   6e-59    
ref|XP_006033465.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   6e-59    
ref|XP_010263855.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   7e-59    
ref|XP_010835976.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   7e-59    
ref|XP_010192700.1|  PREDICTED: fatty aldehyde dehydrogenase            206   7e-59    
ref|XP_003468358.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   7e-59    
ref|XP_004522592.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    206   8e-59    
gb|KFP52086.1|  Fatty aldehyde dehydrogenase                            204   8e-59    
ref|XP_010548304.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    205   9e-59    
ref|XP_005333387.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   9e-59    
ref|XP_010709095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   9e-59    
ref|XP_010819373.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    199   9e-59    
ref|XP_010597294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   9e-59    
ref|WP_017654159.1|  aldehyde dehydrogenase                             204   9e-59    
gb|AGI96742.1|  aldehyde dehydrogenase 3-2                              205   1e-58    
ref|XP_003419438.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   1e-58    
ref|XP_001655925.1|  AAEL012162-PA                                      205   1e-58    
ref|NP_001276988.1|  aldehyde dehydrogenase family 3 member B1 is...    199   1e-58    
ref|XP_004627190.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   1e-58    
ref|XP_004522591.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    206   1e-58    
ref|XP_004522588.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    206   2e-58    
emb|CDX72584.1|  BnaC07g46060D                                          204   2e-58    
ref|XP_009081631.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    197   2e-58    
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg             204   2e-58    
ref|WP_017321468.1|  hypothetical protein                               204   2e-58    
ref|XP_005333386.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   2e-58    
gb|KFM66996.1|  Aldehyde dehydrogenase family 3 member B1               204   2e-58    
ref|WP_044480861.1|  aldehyde dehydrogenase                             203   2e-58    
ref|XP_007156099.1|  hypothetical protein PHAVU_003G258500g             204   2e-58    
ref|XP_010634077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   2e-58    
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        204   2e-58    
ref|XP_005384347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    204   2e-58    
ref|NP_001047578.1|  Os02g0647900                                       204   2e-58    
ref|XP_010709092.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    205   2e-58    
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              205   2e-58    
ref|XP_010634073.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   3e-58    
ref|XP_006173634.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   3e-58    
ref|WP_015220115.1|  aldehyde dehydrogenase                             203   4e-58    
gb|KJB17710.1|  hypothetical protein B456_003G011600                    201   4e-58    
gb|KFP68902.1|  Fatty aldehyde dehydrogenase                            204   4e-58    
ref|XP_011285421.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   4e-58    
ref|XP_006033158.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    203   4e-58    
ref|XP_009706334.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    204   4e-58    
ref|XP_004852263.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   5e-58    
ref|XP_011080288.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   5e-58    
ref|XP_006173633.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   5e-58    
ref|XP_008200006.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    197   5e-58    
ref|XP_004900048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   5e-58    
ref|XP_004656828.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   5e-58    
ref|XP_010437648.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    193   5e-58    
gb|EEC73696.1|  hypothetical protein OsI_08280                          203   5e-58    
gb|KGL91398.1|  Fatty aldehyde dehydrogenase                            202   6e-58    
ref|XP_010634072.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   6e-58    
ref|XP_010634071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    203   6e-58    
ref|XP_007046778.1|  Aldehyde dehydrogenase 3F1 isoform 1               202   6e-58    
ref|XP_006278584.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   6e-58    
ref|XP_009977281.1|  PREDICTED: fatty aldehyde dehydrogenase            201   6e-58    
ref|XP_006033155.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    203   7e-58    
ref|XP_011285420.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   7e-58    
ref|XP_003569985.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   8e-58    
gb|AEE62197.1|  unknown                                                 203   8e-58    
ref|XP_008145077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   9e-58    
ref|XP_001688504.1|  AGAP005124-PB                                      202   9e-58    
ref|XP_005864401.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   9e-58    
ref|XP_004656827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   9e-58    
ref|XP_010350240.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   1e-57    
gb|AGI96741.1|  aldehyde dehydrogenase 3-1 varian D                     202   1e-57    
ref|XP_010317521.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    200   1e-57    
ref|XP_010364620.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   1e-57    
ref|XP_004071943.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   1e-57    
ref|XP_004618543.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   1e-57    
ref|XP_009857901.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    201   1e-57    
ref|XP_001843954.1|  conserved hypothetical protein                     203   1e-57    
ref|XP_010364618.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   1e-57    
ref|XP_010216864.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    197   1e-57    
ref|WP_010301979.1|  aldehyde dehydrogenase                             201   1e-57    
gb|KFR05497.1|  Fatty aldehyde dehydrogenase                            202   1e-57    
ref|XP_011285418.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   1e-57    
ref|WP_038287602.1|  aldehyde dehydrogenase                             201   1e-57    
gb|KFV10145.1|  Fatty aldehyde dehydrogenase                            201   1e-57    
ref|WP_012407600.1|  aldehyde dehydrogenase                             201   1e-57    
ref|XP_009881041.1|  PREDICTED: fatty aldehyde dehydrogenase-like       202   1e-57    
ref|XP_005945730.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   1e-57    
ref|XP_002587582.1|  hypothetical protein BRAFLDRAFT_230530             202   1e-57    
ref|WP_006456928.1|  aldehyde dehydrogenase                             201   1e-57    
ref|WP_010997816.1|  aldehyde dehydrogenase                             201   1e-57    
gb|EYU46263.1|  hypothetical protein MIMGU_mgv1a0057251mg               198   2e-57    
ref|XP_314005.4|  AGAP005124-PC                                         202   2e-57    
ref|XP_006265533.1|  PREDICTED: fatty aldehyde dehydrogenase            202   2e-57    
ref|XP_009944126.1|  PREDICTED: fatty aldehyde dehydrogenase            202   2e-57    
ref|XP_005747342.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    200   2e-57    
ref|XP_010572041.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    200   2e-57    
ref|WP_026376419.1|  aldehyde dehydrogenase                             201   2e-57    
gb|KJB17706.1|  hypothetical protein B456_003G011600                    201   2e-57    
ref|XP_004383705.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    200   2e-57    
ref|WP_009203343.1|  aldehyde dehydrogenase family protein              201   2e-57    
gb|KGL85122.1|  Fatty aldehyde dehydrogenase                            197   2e-57    
ref|XP_006102547.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-57    
ref|XP_008580123.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-57    
ref|WP_029286271.1|  aldehyde dehydrogenase                             201   2e-57    
ref|XP_011190641.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    201   2e-57    
ref|XP_004568665.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-57    
ref|WP_012597585.1|  aldehyde dehydrogenase                             201   3e-57    
ref|WP_029566320.1|  aldehyde dehydrogenase                             201   3e-57    
ref|XP_004618542.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    
gb|KFB46898.1|  AGAP005124-PC-like protein                              201   3e-57    
ref|XP_011190639.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    201   3e-57    
ref|XP_003941230.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    
gb|KFP11933.1|  Fatty aldehyde dehydrogenase                            201   3e-57    
ref|XP_005945729.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    
ref|WP_022091489.1|  aldehyde dehydrogenase                             200   3e-57    
ref|XP_004383704.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   3e-57    



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   378 bits (970),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKEN  +LLDAMK+EL+KFYG DPL S D+SRIVN+NHF RL+KLLDD+KV
Sbjct  247  CISPDYIITTKENVPKLLDAMKLELEKFYGNDPLKSGDISRIVNANHFHRLSKLLDDNKV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              K+VHGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLLPILTVNKVED I+ INAR+
Sbjct  307  VDKVVHGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLPILTVNKVEDSIEFINARE  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKLE+EFV N+SAGGLLINDT LH+A  TLPFGGVGESG GSYHG+FSF
Sbjct  367  KPLAAYLFTGNKKLEEEFVRNISAGGLLINDTTLHLATSTLPFGGVGESGMGSYHGRFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++GN++ +IRALLG 
Sbjct  427  EAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGNILGLIRALLGW  477



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKENA +LLDAMK+EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD+KV
Sbjct  247  CISPDYIITTKENAPKLLDAMKLELEKFYGKDPLKSGDLSRIVNANHFHRLSKLLDDNKV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              K+VHGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLL ILTVNKVE+ I+ INAR+
Sbjct  307  VDKVVHGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLLILTVNKVEESIQFINARE  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKLE+EFV N+SAGGLLINDT LH+A  TLPFGGVGESG GSYHG+FSF
Sbjct  367  KPLAAYLFTGDKKLEEEFVRNISAGGLLINDTTLHIATSTLPFGGVGESGMGSYHGRFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++G+++ +IRALLG 
Sbjct  427  EAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGDILGLIRALLGW  477



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 202/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE+  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD+KV
Sbjct  244  CISPDYIITTKESVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHFQRLSKLLDDNKV  303

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              K+VHGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNKVED I+ I AR+
Sbjct  304  VDKVVHGGQRDENNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNKVEDSIQFIKARE  363

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPFGGVGESG GS HGKFSF
Sbjct  364  KPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSF  423

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G++I +IRAL+G 
Sbjct  424  DTFSHKKAVLRRSFAGDVPARYPPYTAGKARFLKALLNGDIIGLIRALIGW  474



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL++FYG++PL SKDLSRIVNSNHFSRL KLLD+DKV
Sbjct  262  CISPDYIITTKDYAPKLVDALKQELERFYGENPLVSKDLSRIVNSNHFSRLIKLLDEDKV  321

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERDE  LKIAPTILMDVP+D+LIM EEIFGPLLPI+ VNK+E+   +IN+R 
Sbjct  322  SGKIVHGGERDEANLKIAPTILMDVPQDSLIMNEEIFGPLLPIVMVNKIEESFDLINSRT  381

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL+Q+FVT +SAGGL++NDT +H+AVHTLPFGGVGESGTG+YHGKFSF
Sbjct  382  KPLAAYLFTNKKKLKQQFVTCVSAGGLVVNDTTVHLAVHTLPFGGVGESGTGAYHGKFSF  441

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K RL++AL+ G +  II AL G 
Sbjct  442  DAFSHKKAVLYRSFTGDAAIRYPPYTKGKLRLMKALIGGGIWSIISALFGW  492



>gb|KDO80590.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=282

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  49   CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  108

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  109  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  168

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  169  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  228

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  229  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  279



>gb|KDO80588.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
 gb|KDO80589.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=321

 Score =   342 bits (877),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  88   CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  147

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  148  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  207

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  208  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  267

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  268  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  318



>gb|KDO80587.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=398

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  165  CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  224

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  225  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  284

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  285  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  344

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG
Sbjct  345  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLG  394



>gb|KDO80586.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=397

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  164  CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  223

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  224  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  283

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  284  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  343

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  344  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  394



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKEN  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF RL+KLLDD KV
Sbjct  244  CISPDYIITTKENVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHFQRLSKLLDDKKV  303

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              K+VHGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNKVED I+ INAR+
Sbjct  304  VDKVVHGGQRDEDNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNKVEDSIQFINARE  363

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPFGGVGESG GS HGKFSF
Sbjct  364  KPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSF  423

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G+++ +IRAL+G 
Sbjct  424  DSFSHKKAVLRRSFAGDVPARYPPYTTGKARFLKALLNGDILGLIRALIGW  474



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  254  CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  314  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  374  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  434  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  484



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKV
Sbjct  257  CISPDYIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+E+   +IN+  
Sbjct  317  SGKIVYGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLEESFDVINSGS  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NK L+++FV N+SAGG++INDT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+LG+
Sbjct  437  DAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAILGM  487



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  260  CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  320  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  380  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  440  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  490



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  260  CISPDHIITTKDFAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  320  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV ESG G+YHGKFSF
Sbjct  380  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRALLG 
Sbjct  440  DVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  490



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKV
Sbjct  295  CISPDYIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDDDKV  354

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+E+   +IN+  
Sbjct  355  SGKIVYGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLEESFDVINSGS  414

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NK L+++FV N+SAGG++INDT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  415  KPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSF  474

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+LG+
Sbjct  475  DAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAILGM  525



>gb|AFK46379.1| unknown [Medicago truncatula]
Length=280

 Score =   335 bits (860),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKV
Sbjct  49   CISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKV  108

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  
Sbjct  109  SGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAP  168

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  169  KPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSF  228

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  229  DAFSHKKAVLYRSFFGDAFIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  278



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   342 bits (878),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKV
Sbjct  257  CISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  
Sbjct  317  SGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAP  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  437  DAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHFSRLTKLLD+DKV
Sbjct  257  CISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHFSRLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  
Sbjct  317  SGKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGESG GSYHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GN+  I+R LLG+
Sbjct  437  DAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNVWTILRTLLGM  487



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF+RLTKLLD+DKV
Sbjct  257  CISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHFARLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  
Sbjct  317  SGKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGESG GSYHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R LLG+
Sbjct  437  DAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTLLGM  487



>gb|KGN54555.1| hypothetical protein Csa_4G361890 [Cucumis sativus]
Length=395

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+
Sbjct  164  CIAPDYVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKI  223

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  
Sbjct  224  SGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGT  283

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGESG G+YHGKFSF
Sbjct  284  KPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSF  343

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  344  DAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRALLGW  394



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKV
Sbjct  257  CISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  
Sbjct  317  SGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAP  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  437  DAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>gb|KJB59283.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=283

 Score =   334 bits (856),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KV
Sbjct  49   CISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKV  108

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            S KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++  
Sbjct  109  SSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSG  168

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVGESG GSYHGKFS
Sbjct  169  GKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFS  228

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  229  FDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  280



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTKE A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RL KLLDDDKV
Sbjct  262  CISPDYVITTKEYAAKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLKKLLDDDKV  321

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+  ++IN+  
Sbjct  322  SGKIVYGGEKDESKLKISPTVLLDVPRDSLIMSEEIFGPLLPILTVDKLEESFQVINSGP  381

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL++ FV N+SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  382  KPLAAYIFTNNKKLKELFVMNISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSF  441

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  442  DAFSHKKAVLYRSFIGDASVRYPPYTTTKQRLLKALIGGGILGIIRALFGW  492



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   340 bits (873),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF RL +LLDDDKV
Sbjct  257  CISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHFDRLIRLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K+++   +IN+  
Sbjct  317  SGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDKLDESFDVINSAP  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL G
Sbjct  437  DAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRALFG  486



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+
Sbjct  253  CIAPDYVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKI  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  
Sbjct  313  SGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  433  DAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRALLGW  483



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFSRL KLLD+DKV
Sbjct  331  CIAPDYIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFSRLAKLLDEDKV  390

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED   II +R 
Sbjct  391  SGKIVHGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSFDIIKSRS  450

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPFGGVGESG GSYHGKFSF
Sbjct  451  KPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSF  510

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+G 
Sbjct  511  DAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALIGF  561



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ D+IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+ RLTKLLD+DK+
Sbjct  253  CVSPDHIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHYDRLTKLLDEDKI  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGK++HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K+ED   +I +  
Sbjct  313  SGKVIHGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDKIEDSFDLITSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL G 
Sbjct  433  EAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRALFGW  483



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKV
Sbjct  257  CVSPDYIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERDE  LKI+PTIL+DVP D+LIMKEEIFGPLLPIL V+K+ED   +IN+  
Sbjct  317  SRKIVYGGERDEANLKISPTILVDVPCDSLIMKEEIFGPLLPILIVSKIEDSFDMINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPFGGVGESGTGSYHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKEQFVMSVSAGGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RAL G
Sbjct  437  DAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWTILRALFG  486



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ D+IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+ RLTKLLD+DK+
Sbjct  256  CVSPDHIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHYDRLTKLLDEDKI  315

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGK++HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K+ED   +I +  
Sbjct  316  SGKVIHGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDKIEDSFDLITSGT  375

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPFGGVGESG G+YHGKFSF
Sbjct  376  KPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSF  435

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL G 
Sbjct  436  EAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRALFGW  486



>gb|KHN21716.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=411

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF+RL+KLLDDDKV
Sbjct  180  CISPDYVITTKDCAPELVDALKTELEKCYGKNPLESEDLSRIVTSNHFARLSKLLDDDKV  239

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +GKIV+GGE+DEK+L+IAPT+L+DVP D+LIM +EIFGPLLPI+TVNKVE+ I +IN+  
Sbjct  240  AGKIVYGGEKDEKKLRIAPTLLLDVPRDSLIMGDEIFGPLLPIITVNKVEESIDLINSGT  299

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPFGGVGESG G+YHGKFSF
Sbjct  300  KPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSF  359

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL G 
Sbjct  360  DAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRALFGW  410



>gb|KJB59281.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
 gb|KJB59282.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=402

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KV
Sbjct  168  CISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKV  227

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            S KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++  
Sbjct  228  SSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSG  287

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVGESG GSYHGKFS
Sbjct  288  GKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFS  347

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  348  FDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  399



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF+RL+KLLDDDKV
Sbjct  260  CISPDYVITTKDCAPKLVDALKTELEKCYGKNPLESEDLSRIVTSNHFARLSKLLDDDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +GKIV+GGE+DEK+L+IAPT+L+DVP D+LIM EEIFGPLLPI+TVNKVE+ I +IN+  
Sbjct  320  AGKIVYGGEKDEKKLRIAPTLLLDVPRDSLIMGEEIFGPLLPIITVNKVEESIDLINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPFGGVGESG G+YHGKFSF
Sbjct  380  KPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL G 
Sbjct  440  DAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRALFGW  490



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFSRL KLLD+DKV
Sbjct  332  CIAPDYIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFSRLAKLLDEDKV  391

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED   II +R 
Sbjct  392  SGKIVHGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSFDIIKSRS  451

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPFGGVGESG GSYHGKFSF
Sbjct  452  KPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSF  511

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+G 
Sbjct  512  DAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALIGF  562



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   338 bits (868),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF+RLTKLLDDDKV
Sbjct  266  CISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHFNRLTKLLDDDKV  325

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  
Sbjct  326  SGKIVYGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDVINSGP  385

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  386  KPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSF  445

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL G 
Sbjct  446  EAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRALFGW  496



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 200/232 (86%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KV
Sbjct  259  CVSPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKV  318

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            S KIVHGG+R+EK L+IAPTIL+DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++  
Sbjct  319  SSKIVHGGQRNEKNLQIAPTILLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSG  378

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVGESG GSYHGKFS
Sbjct  379  GKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFS  438

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  439  FDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  490



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   337 bits (865),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKV
Sbjct  257  CISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K+ED   II +  
Sbjct  317  SRKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSKIEDSFDIIKSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGESG GSYHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R LLG+
Sbjct  437  DAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTLLGM  487



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 198/231 (86%), Gaps = 1/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYIITTK  A +L+DA+K  L++F+GKDPL SKDLSRIVNS+HFSRLTKLLD+DKV
Sbjct  256  CVSPDYIITTKTFATKLIDALKHVLEEFFGKDPLQSKDLSRIVNSSHFSRLTKLLDEDKV  315

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GG+RDE +LKIAPTIL+DVPED+LIM EEIFGPLLPI+TV+KVED + IIN+R 
Sbjct  316  SGKIVYGGQRDETQLKIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKVEDSLNIINSRS  375

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTS+KKLE+EFV  +SAGG+LINDT LH+   +LPFGGVGESG GSYHGKFSF
Sbjct  376  KPLAAYLFTSSKKLEKEFVEKISAGGMLINDTVLHLTNPSLPFGGVGESGFGSYHGKFSF  435

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKA+L R F GD+  RYPPYTP+K RLL AL+  +   +I AL+GL
Sbjct  436  DAFSHKKAILYRPFIGDVTVRYPPYTPRKIRLLDALLHHS-TGVIPALIGL  485



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKV
Sbjct  192  CISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKV  251

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  
Sbjct  252  SGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGS  311

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKF+F
Sbjct  312  KPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTF  371

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  372  EAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  422



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 199/232 (86%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF RL+KL+D++KV
Sbjct  259  CISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHFDRLSKLMDEEKV  318

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            S KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+KVE    +I++  
Sbjct  319  SSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDKVEQSFDLIHSSG  378

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVGESG GSYHGKFS
Sbjct  379  GKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFS  438

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRALLG 
Sbjct  439  FDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRALLGW  490



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKV
Sbjct  257  CISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  
Sbjct  317  SGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGS  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKF+F
Sbjct  377  KPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  437  EAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  487



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A  L+D++K  L+KFYGKD   SKDLSRIVN+NHF RLT LLDD+KV
Sbjct  261  CIAPDYIITTKSFAPILVDSLKRTLEKFYGKDASESKDLSRIVNANHFKRLTSLLDDEKV  320

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RDEKRL IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED   +IN++ 
Sbjct  321  SGKIVHGGQRDEKRLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVEDSFDLINSKT  380

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKLE++FV  +SAGG+LIND ALH+A H LPFGGVGESG GSYHGKFSF
Sbjct  381  KPLAAYLFTKDKKLEEKFVNTVSAGGMLINDIALHLANHYLPFGGVGESGFGSYHGKFSF  440

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F G+  ARYPPYTP+K +L+R L++G++I +  ALLG 
Sbjct  441  DAFSHKKAVLSRGFFGEARARYPPYTPRKQKLVRQLLNGSIIAMFFALLGW  491



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF+RLTKLLDDDKV
Sbjct  266  CISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHFNRLTKLLDDDKV  325

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  
Sbjct  326  SGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKIEESFDVINSGS  385

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKF+F
Sbjct  386  KPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTF  445

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  446  EAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRALFGW  496



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF+RL+KLL+DDKV
Sbjct  260  CISPDYVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHFARLSKLLNDDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK+E+ I +IN+  
Sbjct  320  SGKIVYGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNKLEESIDVINSGA  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT++ K +++FV N+SAGGLL+NDTALH+ V TLPFGGVGESG G+YHGKFSF
Sbjct  380  KPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL G 
Sbjct  440  DAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRALFGW  490



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF+RL+KLL+DDKV
Sbjct  257  CISPDYVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHFARLSKLLNDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK+E+ I +IN+  
Sbjct  317  SGKIVYGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNKLEESIDVINSGA  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT++ K +++FV N+SAGGLL+NDTALH+ V TLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL G 
Sbjct  437  DAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRALFGW  487



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D +K EL++ YG +PL SKDLSRIVNSNHF RLT+LLD+DKV
Sbjct  252  CISPDYIITTKDFAPKLIDTLKRELERCYGTEPLESKDLSRIVNSNHFDRLTRLLDEDKV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG+IV GG+RD  +L+IAPT+L  VP+D+LIM EEIFGPLLP++TV+++E+   +IN+R 
Sbjct  312  SGRIVCGGQRDRDKLRIAPTVLQGVPQDSLIMSEEIFGPLLPVITVDRLEESFDLINSRT  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL+ EFV+N+SAGGL+IND+ALH+AVHTLPFGGV ESG GSYHGKFSF
Sbjct  372  KPLAAYLFTNRKKLKHEFVSNVSAGGLVINDSALHLAVHTLPFGGVAESGMGSYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD  ARYPPYT  K RLL+AL+SG+++ II+AL+G 
Sbjct  432  DVFSHKKAVLYRSFMGDAAARYPPYTQGKLRLLKALLSGSILGIIKALMGW  482



>gb|EYU23873.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=394

 Score =   332 bits (850),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF RL KL+DD+KV
Sbjct  164  CISPDYILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHFDRLEKLMDDEKV  223

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK+ED    INA+ 
Sbjct  224  SGKIVHGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNKIEDSFGAINAKG  283

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++K L++EFV ++SAG + IN+TALH     LPFGGVGESG GSYHGKFSF
Sbjct  284  KPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSF  343

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RALLG 
Sbjct  344  DAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRALLGW  394



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A++L+D+ K EL++FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKV
Sbjct  257  CISPDYIITTKDYAVELVDSFKCELERFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +IN+  
Sbjct  317  SSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G+++ IIRAL+G 
Sbjct  437  DTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIIRALMGW  487



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+++ K EL++FYGK+PL SKDLSRIVN NHFSRLTKLLD+DKV
Sbjct  260  CISPDYMITTKDYATKLVESFKKELERFYGKNPLESKDLSRIVNFNHFSRLTKLLDEDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERDE  LKIAPT+L+DVP+++LIMKEEIFGPLLPI+ V+K+E+   +IN+  
Sbjct  320  SGKIVHGGERDEVNLKIAPTLLLDVPQNSLIMKEEIFGPLLPIVMVDKIEESFDLINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+Q+FV ++SAGG+++NDTA+H+AV TLPFGGVGESGTG+YHGKFSF
Sbjct  380  KPLAAYLFTNNKKLKQQFVISVSAGGVVVNDTAVHLAVPTLPFGGVGESGTGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD   RYPPY+  K RLL+ L+ G +  IIRAL G 
Sbjct  440  DTFSHKKAVLYRGFAGDAPVRYPPYSSGKIRLLKVLLGGGIWDIIRALFGW  490



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF+RLTKLLDDDKV
Sbjct  384  CISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHFNRLTKLLDDDKV  443

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K+E+   +IN+  
Sbjct  444  SGKIVYGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDVINSGP  503

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGESG G+YHGKFSF
Sbjct  504  KPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSF  563

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL G 
Sbjct  564  EAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRALFGW  614



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF RL KL+DD+KV
Sbjct  246  CISPDYILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHFDRLEKLMDDEKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK+ED    INA+ 
Sbjct  306  SGKIVHGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNKIEDSFGAINAKG  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++K L++EFV ++SAG + IN+TALH     LPFGGVGESG GSYHGKFSF
Sbjct  366  KPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RALLG 
Sbjct  426  DAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRALLGW  476



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DYIITTKE A +L++++K EL++FYGK+PL SKD+SRIVN+NHF+R+TKLLDDD+V
Sbjct  253  CVAPDYIITTKEFAPKLVESLKQELERFYGKNPLESKDISRIVNANHFNRVTKLLDDDEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGG++D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  
Sbjct  313  SSKIVHGGQKDKTKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRALLG 
Sbjct  433  DAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRALLGW  483



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A  L+D +K EL + YGK+PL S+DLSRIV+SNHF+RL+KLL+DDKV
Sbjct  259  CISPDYVITTKDYAPTLVDTLKTELQECYGKNPLESEDLSRIVSSNHFARLSKLLNDDKV  318

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+ + +IN+ +
Sbjct  319  SGKIVYGGEKDENKLRIAPTILLDVPRDSLIMGEEIFGPLLPIITVNKLEESLDVINSGE  378

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+++K ++ FV N+SAGGLL+NDT LH+ V TLPFGGVGESG G+YHGKFSF
Sbjct  379  KPLAAYVFTTDEKFKELFVRNVSAGGLLVNDTTLHLLVDTLPFGGVGESGMGAYHGKFSF  438

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+HKKAVL RSF GD  ARYPPYT  K RL++AL++G ++ IIRALLG 
Sbjct  439  DAFTHKKAVLYRSFAGDSSARYPPYTDTKQRLMKALVAGTVLGIIRALLGW  489



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   333 bits (854),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A  L+D+++  L+KFYG+D   SKDLSRIVN+NHF RLT LLDD+KV
Sbjct  261  CIAPDYIITTKSFAPILVDSLRRTLEKFYGEDASESKDLSRIVNANHFKRLTSLLDDEKV  320

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGG+RDEK L IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED   +IN++ 
Sbjct  321  SGKIVHGGQRDEKHLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVEDSFDVINSKS  380

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKLE++FV  +SAGG+LINDT LH+A   LPFGGVGESG GSYHGKFSF
Sbjct  381  KPLAAYLFTKDKKLEEKFVKIVSAGGMLINDTVLHLANPYLPFGGVGESGFGSYHGKFSF  440

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R FGG+  ARYPPYTP+K +LLR L++G++I +  AL+G 
Sbjct  441  EAFSHKKAVLSRGFGGETSARYPPYTPQKQKLLRQLLNGSIIALFLALIGW  491



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   333 bits (853),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 196/232 (84%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  257  CISPDYIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            SGKIVHGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+KVED   +IN+  
Sbjct  317  SGKIVHGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDKVEDSFDVINSSG  376

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPFGGVG+SG G+YHGKFS
Sbjct  377  TKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFS  436

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRALLG 
Sbjct  437  FDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRALLGW  488



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK+ A +L+D +K EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKV
Sbjct  257  CIASDYIITTKDLAPKLVDVLKNELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S K+V+GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  
Sbjct  317  SKKVVYGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGA  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT++KKL++ FV N+SAGGL++NDT +H+AVH LPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL G
Sbjct  437  DAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRALFG  486



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+DA+K+ L+KFYGKDPL S DLSRIVNSNHF RL  LLDD+KV
Sbjct  251  CIAPDYIITTKSFAPKLVDALKITLEKFYGKDPLESADLSRIVNSNHFKRLMNLLDDEKV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG IVHGG+R+EKRL+IAPTIL+DVP D+LIMKEE+FGPLLPI+TV+++ +G  +IN++ 
Sbjct  311  SGTIVHGGQRNEKRLRIAPTILLDVPSDSLIMKEEVFGPLLPIVTVDELREGFGLINSKG  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT ++KLE++FV ++SAGG++INDT L V    LPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTKDRKLEEKFVKSVSAGGMVINDTILQVTNPRLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R FGGD+  RYPPYT  K ++LR L++GN+I +  AL+G 
Sbjct  431  DAFSHKKAVLSRGFGGDVSMRYPPYTAHKQKILRGLITGNIIAVFLALIGW  481



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DYIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+V
Sbjct  231  CVAPDYIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEV  290

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  
Sbjct  291  SSKIVHGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGT  350

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGESG G+YHGKFSF
Sbjct  351  KPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSF  410

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  411  DAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  461



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 196/232 (84%), Gaps = 1/232 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  283  CISPDYIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKV  342

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            SGKIVHGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+KVED   +IN+  
Sbjct  343  SGKIVHGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDKVEDSFDVINSSG  402

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
             KPLAA LFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPFGGVG+SG G+YHGKFS
Sbjct  403  TKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFS  462

Query  233  FEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            F+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRALLG 
Sbjct  463  FDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRALLGW  514



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D++K  L+KFYGK+PL SKDLSRIVNSNHF+RL KLLD++KV
Sbjct  266  CISPDYIITTKDFAPKLVDSLKEVLEKFYGKNPLESKDLSRIVNSNHFARLMKLLDEEKV  325

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGK+VHGGER+E  LKIAPTIL+DVP D+LIM EEIFGPLLPI+TV KVE+   IIN+  
Sbjct  326  SGKVVHGGERNETDLKIAPTILLDVPRDSLIMTEEIFGPLLPIITVEKVEESYDIINSGP  385

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTSN+KL+++FV  +SAGG+++NDT +H+AV TLPFGGVGESG G+YHGKFSF
Sbjct  386  KPLAAYLFTSNEKLKKQFVMTISAGGVVVNDTTIHLAVVTLPFGGVGESGMGAYHGKFSF  445

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAV+ RSF  D   RYPPYT  K  LL+AL+ G+++ IIRAL G 
Sbjct  446  EAFSHKKAVVYRSFVADAAVRYPPYTKGKLSLLKALVGGSILGIIRALFGW  496



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DYIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+V
Sbjct  253  CVAPDYIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  
Sbjct  313  SSKIVHGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  433  DAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  483



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY ITTKE A  L+DA+  EL+KFYGKDP+ S DLS I+NS HF RLTKLLDD+KV
Sbjct  246  CISADYAITTKEYASTLVDALSSELEKFYGKDPVKSNDLSSIINSYHFDRLTKLLDDEKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GG+RD+  LKIAPTI++D PED+LI+ EEIFGPLLPI+TVNK+ED I +I A++
Sbjct  306  SGKIVLGGQRDKANLKIAPTIVLDAPEDSLILNEEIFGPLLPIVTVNKIEDSITLIKAKE  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++KKL++EF+ ++SAGG+ IN+ ALH    TLPFGGVGESG GSYHGKFSF
Sbjct  366  KPLAAYLFTNDKKLKEEFIRSVSAGGIAINEIALHALEPTLPFGGVGESGMGSYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKK+VL+R F GD  ARYPPYTP K + L+A++SG++I I+RAL+G 
Sbjct  426  DAFSHKKSVLQRGFSGDPAARYPPYTPGKLKFLQAMLSGSIIRILRALIGW  476



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DYIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF+R++KLLDDD+V
Sbjct  253  CVAPDYIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHFNRVSKLLDDDEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K+ED  +I+N+  
Sbjct  313  SSKIVHGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDKLEDSFEIVNSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+LG 
Sbjct  433  DAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAILGW  483



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DYI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVN+ HF RLT LLDD+KV
Sbjct  260  CVAPDYILTTKSFAPTLVDAMKKTLEKFYGKDPLESPDLSRIVNAKHFRRLTSLLDDEKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG IV+GG++DEK LKIAPT+L+DVP D+LIMKEEIFGPLLPI+T N+VED +  IN++ 
Sbjct  320  SGTIVYGGQQDEKHLKIAPTLLLDVPHDSLIMKEEIFGPLLPIITFNEVEDCLDFINSKA  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +K+LE+ FV  +SAGG+LINDTALH+A   LPFGGVGESG G+YHGKFSF
Sbjct  380  KPLAAYLFTKDKRLEERFVKTVSAGGMLINDTALHLANPHLPFGGVGESGIGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSHKKAVL R FGG+  ARYPPYTP+K ++LR L++G++I ++ A+LG 
Sbjct  440  DSFSHKKAVLSRGFGGEAPARYPPYTPQKQKILRGLINGSIIALLLAILGW  490



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF+RLTKLLD+DKV
Sbjct  180  CISPDYIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHFARLTKLLDEDKV  239

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  
Sbjct  240  SGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGT  299

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  300  KPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSF  359

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  360  DAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  410



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF+RL K+LDDDKV
Sbjct  264  CISPDYVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHFARLIKMLDDDKV  323

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK+E+   +INA  
Sbjct  324  SGKIVYGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNKLEESFDVINAGT  383

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ K +++FV N+SAGGLLINDT LH+ VHTLPFGGVG+SG G+YHGKFSF
Sbjct  384  KPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSF  443

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL G 
Sbjct  444  DAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRALFGW  494



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF+RL K+LDDDKV
Sbjct  259  CISPDYVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHFARLIKMLDDDKV  318

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK+E+   +INA  
Sbjct  319  SGKIVYGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNKLEESFDVINAGT  378

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ K +++FV N+SAGGLLINDT LH+ VHTLPFGGVG+SG G+YHGKFSF
Sbjct  379  KPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSF  438

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL G 
Sbjct  439  DAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRALFGW  489



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF+RL KLLD+DKV
Sbjct  260  CISPDYIVTTKDFAPKLVDSLKCELENFYGKNPLESKDLSRIVNSNHFARLIKLLDEDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  
Sbjct  320  SGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  380  KPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  440  DAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  490



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVNSNHF RL  LLDD+ V
Sbjct  260  CIAPDYILTTKSFAPTLVDAMKRTLEKFYGKDPLESADLSRIVNSNHFKRLMSLLDDENV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG IV+GG+RDE+ LKIAPT+L+DVP D+ IMKEEIFGP LPI+T ++VED I  IN++ 
Sbjct  320  SGTIVYGGQRDEQHLKIAPTLLLDVPHDSSIMKEEIFGPFLPIVTFDEVEDCIDFINSKS  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT ++K+E +FV N+SAGG+L+ND ALH+A   LPFGGVGESG G+YHGKFSF
Sbjct  380  KPLAAYLFTKDRKIEDQFVKNVSAGGILVNDVALHLANPHLPFGGVGESGIGAYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R FGG+  ARYPPYTP+K R+LR L++G++I ++ A+LG 
Sbjct  440  DAFSHKKAVLSRGFGGEAPARYPPYTPQKQRILRGLINGSIIALVLAILGF  490



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF+RLTKLLD+DKV
Sbjct  258  CISPDYIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHFARLTKLLDEDKV  317

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++VE+   +IN+  
Sbjct  318  SGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDRVEESFDLINSGT  377

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  378  KPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSF  437

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL G 
Sbjct  438  DAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRALFGW  488



>ref|XP_006847205.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
 gb|ERN08786.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
Length=416

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIIT K NA +++++ K  L+KFYGKDP  SKDLSRIVNSNHF+RL+ +LDD+KV
Sbjct  183  CIAPDYIITEKSNAPKVVESFKSTLEKFYGKDPFESKDLSRIVNSNHFARLSNMLDDEKV  242

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIVHGG+RDEK L IAPT++ D P D+L+M +EIFGPLLPI++V+K+++  ++IN+R 
Sbjct  243  CDKIVHGGQRDEKHLMIAPTLIQDAPMDSLVMSDEIFGPLLPIISVDKIDESFELINSRA  302

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFTS+KKLE++FV ++SAGGLL+NDT LH+ + +LPFGGVG+SG G+YHGKFSF
Sbjct  303  KPLAAYLFTSDKKLEEKFVKSISAGGLLVNDTCLHLTISSLPFGGVGDSGIGAYHGKFSF  362

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL+RSFGGDL ARYPPYTP+K + L++L++ +++ I+  L+G 
Sbjct  363  DIFSHKKAVLRRSFGGDLSARYPPYTPRKQQFLKSLLALDILGILLVLIGW  413



>gb|EYU31773.1| hypothetical protein MIMGU_mgv1a018415mg [Erythranthe guttata]
Length=386

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY+ITTKE A +L+DA+  E++ FYGKDPL S DLS IVNS HF RL  LLDD+ V
Sbjct  156  CVSPDYVITTKEYASKLVDALSCEIENFYGKDPLQSNDLSSIVNSRHFDRLINLLDDETV  215

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GG+RD+ +LKIAPT+++D P+D+ IM EEIFGPLLPI+TVNK+ED I++I++++
Sbjct  216  SGKIVLGGQRDKVKLKIAPTVVLDAPKDSPIMNEEIFGPLLPIITVNKIEDSIRLISSKE  275

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+++KKL++EF+T++SAGG++INDT LH+    LPFGGVGESGTGSYHG+FSF
Sbjct  276  KPLAAYLFSNDKKLKEEFITSVSAGGMVINDTNLHLVEPNLPFGGVGESGTGSYHGRFSF  335

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL+R F GD+ ARYPPY   K   L++L SGNLI ++RAL G 
Sbjct  336  DAFSHKKAVLQRGFTGDIAARYPPYANWKIDFLKSLFSGNLIGVLRALFGW  386



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+
Sbjct  257  CIAPDYIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKI  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  
Sbjct  317  SGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGESG G+YHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  437  DAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRALLGW  487



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 195/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF RLT+LLDDDK+
Sbjct  253  CIAPDYIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKI  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+KVED   I+N+  
Sbjct  313  SGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGT  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRALLG 
Sbjct  433  DAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRALLGW  483



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 196/230 (85%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HFSRLTKLLD+DKV
Sbjct  257  CVSPDYIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHFSRLTKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERDE  LKI PTIL+DVP D+LIMKEEIFGPLLPIL V+K+ED   +IN+  
Sbjct  317  SRKIVYGGERDEANLKICPTILVDVPCDSLIMKEEIFGPLLPILIVSKIEDSFDMINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPFGGVGESGTGSYHGKFSF
Sbjct  377  KPLAAYLFTNNKKLKEQFVVSVSAGGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RALLG
Sbjct  437  DAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWNILRALLG  486



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY+ITTKE A +L+D +  EL+ FYGKDPL SKDLS I+N++HF R+TKLLDD+KV
Sbjct  246  CVSPDYVITTKEYASKLVDVLSAELENFYGKDPLQSKDLSSIINAHHFDRVTKLLDDEKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GG++D+  LKIAPTI++DVP+D+LIM EEIFGPLLPI+TVNK+++   +INA+ 
Sbjct  306  SGKIVFGGQQDKTNLKIAPTIILDVPDDSLIMNEEIFGPLLPIVTVNKIKESFDVINAKG  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+++KL+ EF+ ++SAGG+ IND ALH A   LPFGGVGESG G+YHGKFSF
Sbjct  366  KPLAAYLFTNDQKLKAEFIGSVSAGGITINDVALHFAEAGLPFGGVGESGMGAYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL+R FGGD+ ARYPPY P K + L+AL+ G+++ ++RALLG 
Sbjct  426  DTFSHKKAVLQRGFGGDVAARYPPYAPWKLQFLKALLRGSILGVLRALLGW  476



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT K+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  257  CISPDYIITMKDYAQKLIDSFKCELERFYGKDPLESKDLSRIVNSNHFARLSKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  
Sbjct  317  SSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG 
Sbjct  437  DAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLGW  487



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK+ A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF RL K+LD++KV
Sbjct  251  CISPDYILTTKDYAPKVIDVLKHELEAFYGKNPIESKDLSRIVNSNHFDRLAKMLDEEKV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV+GG++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT++K+E+  +++N+R 
Sbjct  311  SGKIVYGGQKDRANLKIAPTILLDVPRDSLIMSEEIFGPLLPILTLDKLEECFEVVNSRS  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++KKL++ F  N+SAGG+++ND A+H+A+HTLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTNDKKLKERFAMNVSAGGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPY+  K RLL+AL++ NL+ +++A+ GL
Sbjct  431  DAFSHKKAVLYRSFLGDASMRYPPYSRGKLRLLKALVNSNLMDLLKAIFGL  481



>ref|NP_001077676.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32027.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=421

 Score =   322 bits (825),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +V
Sbjct  190  CVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEV  249

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  250  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRP  309

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  310  KPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  369

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  370  DAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  420



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D++K EL+ FYGK+ L SKDLSRIVN +HF+RLTKLLD+DKV
Sbjct  263  CISPDYIITTKDFAPKLVDSLKQELENFYGKNQLESKDLSRIVNPHHFARLTKLLDEDKV  322

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE D+  L+IAPTIL+DVP+D+LIM EEIFGPLLPILTV K+ED   +IN+  
Sbjct  323  SGKIVHGGETDKTNLRIAPTILLDVPQDSLIMSEEIFGPLLPILTVEKMEDSFDLINSGT  382

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  383  KPLAAYLFTNKKKLKEHFVNTVSAGGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSF  442

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K R+L+AL+SG +  IIRAL G 
Sbjct  443  DAFSHKKAVVYRGFFGDASIRYPPYTKGKLRILKALISGGISSIIRALFGW  493



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITT+E A +L+D +K EL++FYG +PL S DLSRIVNSNHF RL +LLD+DKV
Sbjct  246  CISPDYIITTREFAPRLIDTLKRELERFYGSEPLQSNDLSRIVNSNHFDRLARLLDEDKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +GKIV+GG++D+ +LKIAPT+L DVP D+LIMKEEIFGPLLPI+TV K+E+   II +R 
Sbjct  306  AGKIVYGGQKDKAQLKIAPTLLRDVPLDSLIMKEEIFGPLLPIITVEKLEESYDIITSRT  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ K L+ +FV  +SAGGL+IND+A+H+AVHTLPFGGV ESG G+YHGKFSF
Sbjct  366  KPLAAYLFTNRKNLKDQFVRTVSAGGLVINDSAIHLAVHTLPFGGVEESGMGAYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL RSF GD   RYPPYT  K +LL+AL+ G+++ I++AL+G 
Sbjct  426  EAFSHKKAVLYRSFIGDASVRYPPYTHGKMKLLKALIGGSILGILQALVGW  476



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKV
Sbjct  253  CVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K+ED   +IN+  
Sbjct  313  SGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDKLEDSFDLINSGA  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  433  DAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  483



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  257  CISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  
Sbjct  317  SSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG 
Sbjct  437  DAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLGW  487



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKV
Sbjct  257  CIAPDYIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKI+HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R 
Sbjct  317  SGKIIHGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRG  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++FV  +SAGGL+INDT LH A  TLPFGGVGESG GSYHGKFS+
Sbjct  377  KPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSY  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G 
Sbjct  437  EAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIGW  487



>gb|KJB29203.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=457

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  224  CISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKV  283

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  
Sbjct  284  SSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGT  343

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  344  KPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  403

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRALLG
Sbjct  404  DAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRALLG  453



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKV
Sbjct  258  CVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKV  317

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K+ED   +IN+  
Sbjct  318  SGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDKLEDSFDLINSGA  377

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPFGGVGESG G+YHGKFSF
Sbjct  378  KPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSF  437

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  438  DAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  488



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKV
Sbjct  253  CVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K+ED   +IN+  
Sbjct  313  SGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDKLEDSFDLINSGA  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  433  DAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  483



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +V
Sbjct  253  CVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  313  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRP  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTHNKKLKERFTATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  433  DAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  483



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SR+V+S  F RL K+LD+DKV
Sbjct  219  CIGVDYIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRVVSSTQFKRLAKMLDEDKV  278

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV  +ED   +IN+R 
Sbjct  279  SDKIVLGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVETIEDSFDVINSRP  338

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  339  KPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSITGLPFGGVGESGMGSYHGKFSF  398

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL+G 
Sbjct  399  DGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILALIGW  449



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF RL+KLLD+ +V
Sbjct  253  CVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  313  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRP  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  433  DAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  483



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   322 bits (825),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF+RLTKLLD+DKV
Sbjct  258  CVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHFARLTKLLDEDKV  317

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K+ED   +IN+  
Sbjct  318  SGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDKLEDSFDLINSGA  377

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PFGGVGESG G+YHGKFSF
Sbjct  378  KPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSF  437

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL G 
Sbjct  438  DAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRALFGW  488



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 193/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SRIV+S  F RL K+LD+DKV
Sbjct  317  CIGVDYIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRIVSSTQFKRLAKMLDEDKV  376

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV K+ED   +IN+R 
Sbjct  377  SDKIVLGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVEKIEDSFDVINSRP  436

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  437  KPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSF  496

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL+G 
Sbjct  497  DGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILALIGW  547



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY+ITTKE A +L+DA   E++ FYGKDPL S DLS +VNS HF RL  LLDD+KV
Sbjct  246  CVSPDYVITTKEYASKLVDAFACEMENFYGKDPLQSNDLSSVVNSRHFDRLINLLDDEKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GG+RD+ +LKIAP+I+++  ED+LIM EEIFGPLLPI+TV+K+ED I II +++
Sbjct  306  SGKIVLGGQRDKTKLKIAPSIILNPSEDSLIMNEEIFGPLLPIITVDKIEDCIGIITSKE  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++N+KL+ +F++N+S+GG++INDT LH+A  +LPFGGVGESG GSYHGKFSF
Sbjct  366  KPLAAYLFSNNEKLKNDFISNVSSGGMVINDTTLHLAEASLPFGGVGESGMGSYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVLKR F GD+  RYPPYT  K   ++A++SGN++ IIRAL G 
Sbjct  426  DAFSHKKAVLKRGFNGDVSVRYPPYTNGKLNFVKAMLSGNILRIIRALFGW  476



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKV
Sbjct  319  CIAPDYIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKV  378

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKI+HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R 
Sbjct  379  SGKIIHGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRG  438

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NKKL+++FV  +SAGGL+INDT LH A  TLPFGGVGESG GSYHGKFS+
Sbjct  439  KPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSY  498

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G 
Sbjct  499  EAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIGW  549



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKV
Sbjct  318  CIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKV  377

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ 
Sbjct  378  SNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKP  437

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  438  KPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSF  497

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL+G 
Sbjct  498  DGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILALIGW  548



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 191/230 (83%), Gaps = 9/230 (4%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK+     L+    EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKV
Sbjct  257  CIASDYIITTKD-----LN----ELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKV  307

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S K+V+GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  
Sbjct  308  SKKVVYGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGA  367

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT++KKL++ FV N+SAGGL++NDT +H+AVH LPFGGVGESG G+YHGKFSF
Sbjct  368  KPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSF  427

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL G
Sbjct  428  DAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRALFG  477



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   320 bits (820),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKV
Sbjct  328  CIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKV  387

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ 
Sbjct  388  SNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKP  447

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  448  KPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSF  507

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL+G 
Sbjct  508  DGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILALIGW  558



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKV
Sbjct  274  CIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKV  333

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ 
Sbjct  334  SDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKP  393

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA  F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGESG GSYHGKFSF
Sbjct  394  KPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSF  453

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  454  DAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  504



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKV
Sbjct  328  CIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKV  387

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ 
Sbjct  388  SNKIVLGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKP  447

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  448  KPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSF  507

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ +++ II +L+G 
Sbjct  508  DGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRDILTIILSLIGW  558



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+D MK EL+KFYGK+P+ SKD+SRI+NSNHF RL+KLL++  V
Sbjct  253  CVSPDYILTTKEYAPKLIDTMKHELEKFYGKNPMESKDMSRIINSNHFDRLSKLLEEKDV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D ++LKI+PTIL+DVP D+LIM EEIFGP+LPI+TVN +E+   +I +R 
Sbjct  313  SDKIVYGGEKDREKLKISPTILLDVPLDSLIMSEEIFGPILPIITVNNLEESFDVIRSRP  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL+++F   +SAGG+++ND A+H+A+HTLPFGGVGESG GSYHGKFSF
Sbjct  373  KPLAAYLFTHNKKLKEKFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  433  DAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGL  483



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKV
Sbjct  310  CIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ 
Sbjct  370  SDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKP  429

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA  F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGESG GSYHGKFSF
Sbjct  430  KPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSF  489

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  490  DAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  540



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF+RL  LLD+DKV
Sbjct  310  CIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHFARLASLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K+ED   +I ++ 
Sbjct  370  SDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEKIEDSFDVIKSKP  429

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA  F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGESG GSYHGKFSF
Sbjct  430  KPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSF  489

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL+G 
Sbjct  490  DAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLALIGW  540



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D KV
Sbjct  247  CIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNLIEDKKV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED I+ IN+R 
Sbjct  307  AQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQFINSRT  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPFGGVG+SG GSYHGKFSF
Sbjct  367  KPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  427  DCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  477



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF RL+K+LD+ +V
Sbjct  253  CISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLSKMLDEKEV  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  313  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRP  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  373  KPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  433  DAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGL  483



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 196/256 (77%), Gaps = 26/256 (10%)
 Frame = -2

Query  770  CIARDYIITTKENALQLL--------------------------DAMKVELDKFYGKDPL  669
            CIA DYIITTK+ A +L+                          D +K EL+ FYGK+PL
Sbjct  257  CIASDYIITTKDLAPKLVRLPYPHVLVFSLYGVVSCTLPYLFQVDVLKNELETFYGKNPL  316

Query  668  CSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKE  489
             SKDLSRIVNS+HF+RLTKLLD+DKVS K+V+GGERD  +L+IAPTIL+DVP D+LIM E
Sbjct  317  ESKDLSRIVNSDHFTRLTKLLDEDKVSKKVVYGGERDPTKLQIAPTILLDVPRDSLIMNE  376

Query  488  EIFGPLLPILTVNKVEDGIKIINARDKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTAL  309
            EIFGPLLPILTV+K+E+   IIN+  KPLAA +FT++KKL++ FV N+SAGGL++NDT +
Sbjct  377  EIFGPLLPILTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTV  436

Query  308  HVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            H+AVH LPFGGVGESG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++
Sbjct  437  HLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMK  496

Query  128  ALMSGNLIFIIRALLG  81
            AL+ G+++ I+RAL G
Sbjct  497  ALLGGSILGILRALFG  512



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D KV
Sbjct  259  CIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRLTNLIEDKKV  318

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED I+ IN+R 
Sbjct  319  AQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIEDSIQFINSRT  378

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPFGGVG+SG GSYHGKFSF
Sbjct  379  KPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSF  438

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  439  DCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  489



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+V
Sbjct  316  CISPDYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEV  375

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KI+ GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ 
Sbjct  376  SDKIIIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKS  435

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGESG GSYHGKFSF
Sbjct  436  KPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSF  495

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  496  DAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  546



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+V
Sbjct  315  CISPDYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEV  374

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KI+ GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ 
Sbjct  375  SDKIIIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKS  434

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGESG GSYHGKFSF
Sbjct  435  KPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSF  494

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  495  DAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  545



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 192/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT KE A +L+ A+K EL++F+GKDPL SKD+SRIV+ N F+RL KLLD+DKV
Sbjct  335  CISVDYIITRKEFAPKLISALKEELEQFFGKDPLESKDMSRIVSPNQFARLVKLLDEDKV  394

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIV GG+RDEK+LKI+PTI++DVPEDAL+M+EEIFGP++PI+TV+ +ED   II +R 
Sbjct  395  SGKIVLGGQRDEKKLKISPTIILDVPEDALVMQEEIFGPIMPIITVDNIEDCYSIIKSRP  454

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGV ESG G YHGKFSF
Sbjct  455  KPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSF  514

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSH+K VL RSF GD   RYPPYTP+K +LL+A+++GN++ I  ALLG 
Sbjct  515  DSFSHRKPVLYRSFDGDSSIRYPPYTPQKEKLLKAIITGNIVQIFLALLGW  565



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK    +L+D++K  L++FYG+DPL S DLSRIVNS HF R+ KL++D KV
Sbjct  246  CIAPDYIITTKTFVTELVDSLKRVLERFYGEDPLQSADLSRIVNSKHFHRIAKLIEDKKV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+E+ I+ INA  
Sbjct  306  AEKIVLGGQTDEKQLKIAPTVLVDVPHDTALMTEEIFGPLLPIVTVDKIEESIEHINAGT  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ NKKL+QEF+ N+S+GG+L+ND ALH+A   LPFGGVG+SGTGSYHGKF+F
Sbjct  366  KPLAAYLFSRNKKLQQEFIANVSSGGMLVNDVALHLANPHLPFGGVGDSGTGSYHGKFTF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R FGG+  ARYPPYTP+K R+LR L+ G+   +I ALLG 
Sbjct  426  DCFSHKKAVLVRGFGGEANARYPPYTPEKQRILRGLIKGSFFALILALLGF  476



>ref|XP_006662790.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D  V
Sbjct  164  CIAPDYVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRLTNLIEDKTV  223

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED I+ IN++ 
Sbjct  224  SQKIVYGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIEDSIEFINSKT  283

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPFGGVG+SG GSYHGKFSF
Sbjct  284  KPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSF  343

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  344  DCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  394



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKV
Sbjct  209  CISPDYIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKV  268

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +I +  
Sbjct  269  SSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLITSGA  328

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  329  KPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  388

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL+G 
Sbjct  389  DTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRALMGW  439



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF RL KLLD+D  
Sbjct  312  CIAIDYIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHFKRLAKLLDEDGT  371

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ +EDG  +IN++ 
Sbjct  372  SDKIVLGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDNIEDGFHMINSKP  431

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +  L+++FV N+SAGG+LIND  LH+ V TLPFGGVG+SG G+YHGKFSF
Sbjct  432  KPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSF  491

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II ALL
Sbjct  492  DAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILALL  540



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF+RL KL+D+DKV
Sbjct  262  CISPDYIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFNRLIKLMDEDKV  321

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+   +IN+  
Sbjct  322  SDKIVYGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGT  381

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ K +++FV  +SAGGLLINDT LH+ V TLPFGGVG+SG G+YHGKFSF
Sbjct  382  KPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSF  441

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL G 
Sbjct  442  DAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRALFGW  492



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF RL KLLD+D  
Sbjct  317  CIAIDYIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHFKRLAKLLDEDGT  376

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ +EDG  +IN++ 
Sbjct  377  SDKIVLGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDNIEDGFHMINSKP  436

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +  L+++FV N+SAGG+LIND  LH+ V TLPFGGVG+SG G+YHGKFSF
Sbjct  437  KPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSF  496

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II ALL
Sbjct  497  DAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILALL  545



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF+RL KL+D+DKV
Sbjct  257  CISPDYIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFNRLIKLMDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK+E+   +IN+  
Sbjct  317  SDKIVYGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ K +++FV  +SAGGLLINDT LH+ V TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL G 
Sbjct  437  DAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRALFGW  487



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+D MK+EL+KFYGK+P+ SKD+SRIVNSNH  RL+KLLD+ +V
Sbjct  249  CVSPDYILTTKEYAPKLIDDMKLELEKFYGKNPIESKDMSRIVNSNHLDRLSKLLDEKEV  308

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  309  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRP  368

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  369  KPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  428

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +A SHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + LLGL
Sbjct  429  DASSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLGL  479



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF+RL KLLD+DKV
Sbjct  257  CISPDYIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHFARLLKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++KVED   +I +  
Sbjct  317  SSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDKVEDSFDLITSGA  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL+G 
Sbjct  437  DTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRALMGW  487



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHFSRL +LLD+DKV
Sbjct  320  CISVDYIITTKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHFSRLERLLDEDKV  379

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV   +D I +IN++ 
Sbjct  380  CNKIVVGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVENAKDSIDLINSKP  439

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            +PL A LFT+N+KL  +FV N+S GG++INDT LHV V +LPFGGVGESG GSYHGKFSF
Sbjct  440  EPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSF  499

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G ++ II AL+G 
Sbjct  500  DAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGILDIILALMGW  550



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +LLDAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++ +V
Sbjct  255  CVSPDYILTTKEFAPKLLDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKEV  314

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R 
Sbjct  315  SDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRP  374

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  375  KPLAAYLFTHNQKLKERFAMKVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  434

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  435  DAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  485



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RLT L++D  V
Sbjct  246  CIAPDYVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRLTNLIEDKTV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED I+ IN++ 
Sbjct  306  SQKIVYGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIEDSIEFINSKT  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPFGGVG+SG GSYHGKFSF
Sbjct  366  KPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  426  DCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  476



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++ +V
Sbjct  254  CVSPDYILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKEV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R 
Sbjct  314  SDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRP  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  374  KPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  434  DAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  484



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +V
Sbjct  251  CISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+++   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  311  SDKIVYGGQKNRDNLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  431  DAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF RL+KLL++  V
Sbjct  254  CVSPDYILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHFDRLSKLLEEKDV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N +E+   +I++R 
Sbjct  314  SDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNNLEESFDVIHSRP  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  374  KPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + LLGL
Sbjct  434  DAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVLLGL  484



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITT+ENA +L+DA+K EL+ FYGKDPL S+D+S I+N   F R+T LLDD KV
Sbjct  247  CISPDYIITTEENAPKLVDAIKCELESFYGKDPLKSQDMSSIINERQFERMTGLLDDKKV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+ D+  LKIAPTIL+DV ED+ +M EEIFGPLLPI+TV K+E+  KII ++ 
Sbjct  307  SDKIVYGGQSDKSNLKIAPTILLDVSEDSSVMSEEIFGPLLPIITVGKIEECYKIIASKP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++KK  +EFV+N+SAGG+ IND ALH     LPFGGVGESG GSYHGKFSF
Sbjct  367  KPLAAYLFTNDKKRTEEFVSNVSAGGITINDIALHFLEPRLPFGGVGESGMGSYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKK+VLKRSFGG++ ARYPPY P K   + A++ G++  +++A LG 
Sbjct  427  DAFSHKKSVLKRSFGGEVAARYPPYAPWKLHFMEAILQGDIFGLLKAWLGW  477



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 185/229 (81%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+DA+K+ L+KFYGK+PL S DLSRIVNS+HF+RL  LLD++KV
Sbjct  251  CIAPDYIITTKAFAPKLVDALKITLEKFYGKNPLGSTDLSRIVNSSHFTRLKNLLDEEKV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG IVHGG+ DEK LKIAPT+L+DVP DA IMKEEIFGPLLPI+TV+ +E    +IN++ 
Sbjct  311  SGTIVHGGQEDEKHLKIAPTLLLDVPSDASIMKEEIFGPLLPIITVDDLEQSFDVINSKP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT + KLE++FV  +SAGG+LIND  L      LPFGGVGESG GSYHG+FSF
Sbjct  371  KPLAAYLFTKDHKLEKKFVKTVSAGGMLINDAILQFTNPHLPFGGVGESGMGSYHGRFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +AFSHKKAVL R F G++  RYPPYTP K ++LR L++GN++ ++ AL+
Sbjct  431  DAFSHKKAVLSRGFYGEIPMRYPPYTPLKQKVLRGLIAGNILPLLHALV  479



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 191/231 (83%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT KE A +L+DA+K EL++F+GKDP+ SKD+SRIV+ N F+RL  LLD+DKV
Sbjct  310  CISVDYIITRKEFAPKLVDALKEELEQFFGKDPMESKDMSRIVSPNQFARLVNLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTI++ VPEDA+IM+EEIFGP++PI+TV+ +ED   II ++ 
Sbjct  370  SDKIVLGGQRDEKKLKIAPTIILGVPEDAMIMQEEIFGPIMPIVTVDNIEDCYSIIKSKP  429

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGV ESG G YHGKFSF
Sbjct  430  KPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSF  489

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSH+K+VL RSF  D   RYPPYTP+K +LL+AL+SGN++ II +LLG 
Sbjct  490  DSFSHRKSVLYRSFDADSTIRYPPYTPQKEKLLKALISGNIVQIILSLLGW  540



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  758  DYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKI  579
            DYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+VS KI
Sbjct  312  DYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEVSDKI  371

Query  578  VHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLA  399
            + GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ KPLA
Sbjct  372  IIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPLA  431

Query  398  AXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAFS  219
            A LF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGESG GSYHGKFSF+AFS
Sbjct  432  AYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFS  491

Query  218  HKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  492  HKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  538



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +V
Sbjct  251  CISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  311  SDKIVYGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  431  DAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +V
Sbjct  251  CISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKILEEKEV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  311  SDKIVYGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNNLEECFDVIRSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + LLGL
Sbjct  431  DAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYII TK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHFSRL +LLD+ KV
Sbjct  255  CISVDYIIATKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHFSRLERLLDEYKV  314

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV  V+D I +IN++ 
Sbjct  315  FNKIVVGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVENVKDSIDLINSKP  374

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            +PL A LFT+N+KL  +FV N+S GG++INDT LHV V +LPFGGVGESG GSYHGKFSF
Sbjct  375  EPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSF  434

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G +  II AL+G 
Sbjct  435  DAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGIFDIILALMGW  485



>ref|XP_009350139.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=450

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL K+LD+DKV
Sbjct  218  CIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKVLDEDKV  277

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+ I+TV K+ED   +I+++ 
Sbjct  278  SNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMSIVTVEKIEDSFSVIHSKP  337

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+N++ ++ FV N+S+GG+LINDT LHV++  LPFGGVGESG GSYHGKFSF
Sbjct  338  KPLAVCAFTNNEQPKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSF  397

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ N++ II +L+G 
Sbjct  398  DGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRNILTIILSLIGW  448



>ref|XP_010437649.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=308

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V
Sbjct  73   CIGVDYVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGV  132

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  133  ANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKP  192

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  193  KPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  252

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  253  ETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  303



>ref|XP_010444975.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=256

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+IT K+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V
Sbjct  21   CIGVDYVITKKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGV  80

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  81   ANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKP  140

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  141  KPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  200

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  201  ETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  251



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLL++D+V
Sbjct  315  CIGVDYIITTKDFAPKLIEALKDGLEQFFGKDPMNSKDISRIVSSTQFARLVKLLEEDRV  374

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ DEK+LKIAPTIL+D+PED  IM EEIFGPL+PI+TV+K+E    +I +R 
Sbjct  375  SDKIVLGGQTDEKQLKIAPTILLDIPEDTQIMNEEIFGPLMPIVTVDKIEGSFDVIKSRP  434

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT+N++L++ FV N+S+GG+LINDT LHVAV  LPFGGVGESG GSYHGKFSF
Sbjct  435  KPLAVYVFTNNEQLKKSFVENISSGGMLINDTVLHVAVAGLPFGGVGESGMGSYHGKFSF  494

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK+V+ RS  GD   RYPPYTP+K +L +A +SGN+  II AL+G 
Sbjct  495  DGFSHKKSVMYRSLSGDSTLRYPPYTPEKEKLFKAALSGNIFRIILALIGW  545



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE + +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +V
Sbjct  251  CISPDYILTTKEFSPKVIDALKQELEAFYGKNPMESKDMSRIVNSNHFDRLSKMLEEKEV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG+++  +LKIAPTIL+DVP D+ IM EEIFGPLLPI+T+N +E+   +I +R 
Sbjct  311  SDKIVYGGQKNRDKLKIAPTILVDVPLDSQIMSEEIFGPLLPIITLNNLEECFDVIRSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+AV TLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTQNQKLKERFALTVSAGGIVVNDIAVHLAVPTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++ I R +LGL
Sbjct  431  DAFSHKKAVLYKSFIGDAAIRYPPYSTGKLRLLKALVNSNILEIFRVILGL  481



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 196/259 (76%), Gaps = 28/259 (11%)
 Frame = -2

Query  770  CIARDYIITTKENALQL----------------------------LDAMKVELDKFYGKD  675
            CIA DYI+TTK+ A +L                            +DA+K EL+ +YGKD
Sbjct  257  CIAPDYIVTTKDFAPKLVRLLICMKLVWYLFLCLFHFPLLLLFLQIDALKHELEAWYGKD  316

Query  674  PLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIM  495
            PL SKDL+ IVNSNHF+RL KLLDDDKVSGKI+HGG+RD+  LK APTIL+DVPED+L+M
Sbjct  317  PLESKDLAHIVNSNHFARLAKLLDDDKVSGKIIHGGQRDKANLKFAPTILLDVPEDSLVM  376

Query  494  KEEIFGPLLPILTVNKVEDGIKIINARDKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDT  315
             EEIFGPLLPILTV+K+ED   +I +R KPLAA LFT+NKKL+++FV  +SAGGL+INDT
Sbjct  377  NEEIFGPLLPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDT  436

Query  314  ALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARL  135
             LH A  TLPFGGVGESG GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +L
Sbjct  437  VLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKL  496

Query  134  LRALMSGNLIFIIRALLGL  78
            L+AL+SG+++ +I AL+G 
Sbjct  497  LKALLSGSVVGVILALIGW  515



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+IT +  A +L+DA+KV L+KF+GKDP  S DLSRIVN +HF+RLT+LLDD KV
Sbjct  324  CISPDYVITLESFAPKLIDALKVTLEKFFGKDPFQSADLSRIVNFSHFARLTRLLDDPKV  383

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S K+++GG+RDEKRL IAPT+L+D P D+LIM EEIFGPLLPI+TV K+E+ ++++++  
Sbjct  384  SDKVIYGGQRDEKRLIIAPTLLLDAPMDSLIMTEEIFGPLLPIITVQKMEEALEVVSSLP  443

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK  E++ V ++SAGG+++NDTALH+  H LPFGGVGESG G+YHGKFSF
Sbjct  444  KPLAAYLFTKNKMFERQVVASISAGGMVVNDTALHLVNHHLPFGGVGESGMGAYHGKFSF  503

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSH+KAVL R F GDL ARYPPYT +K +++R L++G+ + ++ AL+G 
Sbjct  504  ENFSHRKAVLYRGFMGDLMARYPPYTRRKQKIVRCLLNGDFLGLLYALIGW  554



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C A DY+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF+RL KL+++D V
Sbjct  317  CTAADYVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHFTRLMKLMEEDGV  376

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K+ED  ++I ++ 
Sbjct  377  SDKIVLGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEKIEDSFEVIKSKP  436

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPFGGVGESG G YHGKFSF
Sbjct  437  KPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSF  496

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  96
            EAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  497  EAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  541



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C A DY+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF+RL KL+++D V
Sbjct  316  CTAADYVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHFTRLMKLMEEDGV  375

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K+ED  ++I ++ 
Sbjct  376  SDKIVLGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEKIEDSFEVIKSKP  435

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPFGGVGESG G YHGKFSF
Sbjct  436  KPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSF  495

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  96
            EAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  496  EAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  540



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ V
Sbjct  230  CISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENV  289

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  290  SDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMT  349

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGESG G+YHG+FSF
Sbjct  350  KALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSF  409

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  410  EAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  460



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ V
Sbjct  230  CISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENV  289

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  290  SDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMT  349

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGESG G+YHG+FSF
Sbjct  350  KALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSF  409

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  410  EAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  460



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 186/230 (81%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ +  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF RL KL+D+DKV
Sbjct  257  CISPDYIITTKDFSPLLVDALKTELENFFGKNPLESNDLSRIVSSNHFHRLIKLMDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GG +DE +L+IAPTIL+D P D+LIM EEIFGPLLPI+TVNK+E+   +IN+  
Sbjct  317  SDKIVYGGAKDESKLRIAPTILLDTPRDSLIMSEEIFGPLLPIITVNKLEESFDVINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ K +++FV  +SAGGL+IND+ LH    TLPFGGVG+SG G+YHGKFSF
Sbjct  377  KPLAAYLFTNDNKFKEQFVKKVSAGGLVINDSVLHFVACTLPFGGVGDSGMGAYHGKFSF  436

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AF+H+KAVL R F GD   RYPPYT KK + ++AL++G++  ++RAL G
Sbjct  437  DAFTHRKAVLYRGFTGDSSLRYPPYTDKKQKCMKALVAGDVPGLVRALFG  486



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+RL KL+DD+ V
Sbjct  250  CISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRLKKLMDDENV  309

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  310  SDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHESFALINSMT  369

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGESG G+YHG+FSF
Sbjct  370  KALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSF  429

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+LG 
Sbjct  430  EAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF  480



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   ++RL KLLD+DKV
Sbjct  310  CISVDYIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQYARLVKLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+TV+ +ED   II +R 
Sbjct  370  SDKIVLGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVDSIEDSFSIIQSRP  429

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGVGESG G YHGKFSF
Sbjct  430  KPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVGESGMGCYHGKFSF  489

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II ALLG 
Sbjct  490  DSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQIILALLGW  540



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK+ A +L+DAMK EL+ FYGK+P+ SKD+SRIVNSNHF RL+K+L++ +V
Sbjct  252  CISPDYILTTKDYAPKLIDAMKNELEAFYGKNPMESKDMSRIVNSNHFDRLSKMLEEKEV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG++D + LKIAPTIL+DVP D+L+M EEIFGPLLPILTVN +E+   +I +R 
Sbjct  312  SDKIVLGGQKDRENLKIAPTILLDVPLDSLMMSEEIFGPLLPILTVNNLEESFDVIRSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+A+ TLPFGGVGESG GSYHGKFSF
Sbjct  372  KPLAAYLFTQNEKLKERFANTVSAGGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RY PY+  K RLL+AL++ NL+ + + L G 
Sbjct  432  DAFSHKKAVLYKSFLGDSTVRYAPYSRGKLRLLKALVNSNLLEVFKVLFGF  482



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF RL+KLL++ +V
Sbjct  252  CISPDYILTTKEYAPKVIDALKHELEGFYGKNPMESKDMSRIVNSNHFDRLSKLLEEKEV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S +IV+GG+++ + LKIAPTIL+DVP D+ IM EEIFGPLLPILT+N +E+   +I +R 
Sbjct  312  SERIVYGGQKNRESLKIAPTILLDVPLDSQIMNEEIFGPLLPILTLNNLEECFDVIRSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++ F   +SAGG+++ND A+H+A+ TLPFGGVGESG GSYHGKFSF
Sbjct  372  KPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++   + LLGL
Sbjct  432  DAFSHKKAVLYKSFFGDSAIRYPPYSRGKLRLLKALVNSNIVEFFKVLLGL  482



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ ++K  L++FYG+DPL S DLSRIVNS HF RLT+L+++  V
Sbjct  243  CIAPDYIITTKSFAPELVASLKRVLERFYGEDPLQSADLSRIVNSKHFRRLTELIEEKSV  302

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GGE DEK+LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K+E+   +INAR 
Sbjct  303  ADKIVYGGEVDEKQLKIAPTLLLDVPQDSAIMTGEIFGPLLPIVTVEKIEESFDLINARP  362

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++EFV ++ AGG+L+NDT LH+A   +PFGGVG+SG G YHGKF F
Sbjct  363  KPLAAYLFTKNKKLQEEFVADVPAGGMLVNDTVLHLANPYMPFGGVGDSGMGCYHGKFGF  422

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  423  DCFSHKKGVLVRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   311 bits (798),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+DA++  +++F+G DP+ SKD+S IV+SNHFSRL  L+DD KV
Sbjct  523  CISVDYIITTKEFAPKLIDALRKGIEEFFGTDPMESKDISCIVSSNHFSRLESLMDDYKV  582

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+R++K+LKIAPTI +DVP D+ +M+EEIFGPLLPI+TV  V+D I +IN++ 
Sbjct  583  FYKIVVGGQRNQKKLKIAPTIFLDVPGDSQLMQEEIFGPLLPIITVENVKDSIDLINSKP  642

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL A LFT+N+KL+  FV ++S+GG++INDT LHV V +LPFGGVGESG GSYHGKFSF
Sbjct  643  KPLTAYLFTNNEKLKNNFVQSVSSGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSF  702

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP+K +L+RA+M+G +  II A +G 
Sbjct  703  DAFSHKKAVLYRSFSGDTSVRYPPYTPEKQKLVRAVMNGGIFDIILAFMGW  753



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK  A +LL+A++  L+KFYGKDPL S DLSRIVNSNHF+RL +L+DD+ V
Sbjct  245  CISPDFIITTKSFAPKLLEALEKVLEKFYGKDPLRSSDLSRIVNSNHFNRLKRLMDDESV  304

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R E  LKIAPTI MDVP D++IMKEEIFGPLLPI+TV+K+ + + +IN+  
Sbjct  305  SDKIVFGGQRSEHLLKIAPTIFMDVPLDSVIMKEEIFGPLLPIITVDKIHESLALINSMT  364

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT + KL++++V  +SAGG+L+NDTA+H+    LPFGGVGESG G+YHG FSF
Sbjct  365  KPLAAYLFTKDSKLQEQYVAAISAGGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGSFSF  424

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F  +  ARYPPY+  K ++LR ++ GNL  +I+A+LG 
Sbjct  425  EAFSHKKAVLVRGFACEAAARYPPYSMAKLKILRGVLKGNLGAMIQAILGF  475



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V
Sbjct  316  CIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGV  375

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  376  ANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKS  435

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  436  KPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  495

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  496  ETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNMFAAILAFFGF  546



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK    +L+D++K  L++FYG+DPL S DLSRIVN +HF RL KLLDD KV
Sbjct  254  CIAPDYIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVNISHFHRLAKLLDDKKV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KI+ GG+ D ++LKIAPT+L+DVP D  +MK EIFGP+LPI+TV+K+E+GI  INA  
Sbjct  314  AEKILLGGQTDMEQLKIAPTVLVDVPLDTELMKGEIFGPMLPIITVDKIEEGITHINAGA  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGGVG+SGTGSYHGKFSF
Sbjct  374  KPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  434  DCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  484



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   FSRL +LLD+DKV
Sbjct  302  CISVDHIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQFSRLVRLLDEDKV  361

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ +ED   II +R 
Sbjct  362  SDKIVLGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDNIEDSFSIIKSRP  421

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N++L++E+V  +S+GG+LIND  +HVA   LPFGGV ESG G YHGKF+F
Sbjct  422  KPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTF  481

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL G 
Sbjct  482  DSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILALFGW  532



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V
Sbjct  299  CIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGV  358

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  359  ANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKP  418

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  419  KPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  478

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  479  ETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  529



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 188/231 (81%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   FSRL +LLD+DKV
Sbjct  310  CISVDHIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQFSRLVRLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ +ED   II +R 
Sbjct  370  SDKIVLGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDNIEDSFSIIKSRP  429

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N++L++E+V  +S+GG+LIND  +HVA   LPFGGV ESG G YHGKF+F
Sbjct  430  KPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTF  489

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            ++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL G 
Sbjct  490  DSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILALFGW  540



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ AL+L+DA+K EL+ F+G+ PL SKDLSRIVNS HF RL  +L ++ V
Sbjct  314  CIGVDYVITTKDFALKLIDALKTELNTFFGETPLESKDLSRIVNSFHFRRLESMLKENGV  373

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  374  ANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKP  433

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+L+++FV  +SAGG+ INDT LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  434  KPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTLKDLPFGGVGESGIGAYHGKFSY  493

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  494  ETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  544



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V
Sbjct  316  CIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGV  375

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  376  ANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQKIEDGFQVIRSKP  435

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  436  KPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  495

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  496  ETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  546



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL  +L ++ V
Sbjct  314  CIGVDYVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHFKRLESMLKENGV  373

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  374  ANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEKIEDGFQVIRSKP  433

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  434  KPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  493

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  494  ETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAFFGF  544



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G+ PL SKDLSRIVNS HF RL ++L ++ V
Sbjct  312  CIGVDYVITTKDFASRLIDALKTELKTFFGEKPLESKDLSRIVNSFHFKRLERMLKENGV  371

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLP++TV K+EDG ++I ++ 
Sbjct  372  ANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPVVTVEKIEDGFQVIRSKP  431

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF++NK+L+++FV  +SAGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  432  KPLAAYLFSNNKELQEQFVQGVSAGGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  491

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  492  ETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  542



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ ++K  L +FYG+DPL S DLSRIVNS  F RL  L+++ +V
Sbjct  243  CIAPDYIITTKSFAPELVASLKRVLVRFYGEDPLQSADLSRIVNSKQFKRLQDLIEEKRV  302

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV GGE DE++LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K+E+   +INA+ 
Sbjct  303  ADKIVFGGEADEEQLKIAPTVLLDVPQDSAIMTGEIFGPLLPIVTVEKIEESFNLINAKP  362

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++EFV N+ AGG+L+NDTALH+A   LPFGGVG+SG G YHGKF F
Sbjct  363  KPLAAYLFTKNKKLQEEFVANVPAGGMLVNDTALHLANPYLPFGGVGDSGMGCYHGKFGF  422

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  423  DCFSHKKAVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 180/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF RL  +L ++ V
Sbjct  314  CIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHFKRLESMLKENGV  373

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIVHGG+  E +LKI+PTIL+DVPE + +M+EEIFGPLLP+ TV K+EDG ++I ++ 
Sbjct  374  DNKIVHGGQTTEDKLKISPTILLDVPEASSMMQEEIFGPLLPVFTVQKIEDGFQVIRSKP  433

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ +L+++FV N+SAGG+ INDT LHV V  +PFGGVGESG G+YHGKFS+
Sbjct  434  KPLAAYLFTNSAELQKQFVQNVSAGGMTINDTVLHVTVKDMPFGGVGESGIGAYHGKFSY  493

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  GL
Sbjct  494  ETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALISSNIFAAILAFFGL  544



>gb|KHG17901.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
 gb|KHG21723.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
Length=366

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 183/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  133  CIGVDYIITTKELAPKLIATLVNVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  192

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  193  SNKIVFGGQRDESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  252

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  253  KPLAAYLFSDDEQIKRKFVQNIYAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  312

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  313  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  363



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKV
Sbjct  254  CIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + 
Sbjct  314  SDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKP  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGESG GSYHGKFSF
Sbjct  374  KALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  434  DAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  484



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DYI+TTK++A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF RL ++LD+DKV
Sbjct  251  CVSPDYILTTKDHAPKVIDVLKHELEAFYGKNPMESKDLSRIVNSNHFDRLARILDEDKV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+ G++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+  +ED   +IN+  
Sbjct  311  ADKIVYRGQKDRANLKIAPTILLDVPRDSLIMNEEIFGPLLPILTLENLEDSFDVINSGS  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++KKL+++F   +SAGG+++ND A+H+A+HTLPFGGVGESG GSYHGKFSF
Sbjct  371  KPLAAYLFTNDKKLKEKFARIVSAGGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGN  111
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL++ N
Sbjct  431  DAFSHKKAVLYRSLLGDASMRYPPYSRWKLRLLKALVNRN  470



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 188/238 (79%), Gaps = 7/238 (3%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   ++RL KLLD+DKV
Sbjct  310  CISVDYIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQYARLVKLLDEDKV  369

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTV-------NKVEDGI  432
            S KIV GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+TV       + +ED  
Sbjct  370  SDKIVLGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVSTIKGKVDSIEDSF  429

Query  431  KIINARDKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGS  252
             II +R KPLAA LFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGVGESG G 
Sbjct  430  SIIQSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVGESGMGC  489

Query  251  YHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            YHGKFSF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II ALLG 
Sbjct  490  YHGKFSFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQIILALLGW  547



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  210  CISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  269

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  270  SNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  329

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  330  KPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  389

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  390  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  440



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  255  CISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  314

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  315  SNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  374

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  375  KPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  434

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  435  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  485



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKV
Sbjct  309  CIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKV  368

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + 
Sbjct  369  SDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKP  428

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGESG GSYHGKFSF
Sbjct  429  KALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSF  488

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  489  DAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  539



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  315  CISVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  374

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  375  ADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  434

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK+L+ +FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  435  KPLAAYLFTDNKELQNQFVQNVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  494

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  495  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  545



>gb|AFW65463.1| hypothetical protein ZEAMMB73_893012 [Zea mays]
Length=456

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V
Sbjct  221  CIAPDYIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQFKRLTNLIEEKRV  280

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ 
Sbjct  281  ADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKP  340

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+SG G YHGKF F
Sbjct  341  KPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGF  400

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  401  DCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  451



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF RL  LLD+DKV
Sbjct  314  CIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHFMRLVNLLDEDKV  373

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K+ED   +IN + 
Sbjct  374  SDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEKLEDAFDMINRKP  433

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGESG GSYHGKFSF
Sbjct  434  KALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSF  493

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ ALLG 
Sbjct  494  DAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLALLGW  544



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V
Sbjct  243  CIAPDYIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQFKRLTNLIEEKRV  302

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ 
Sbjct  303  ADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKP  362

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+SG G YHGKF F
Sbjct  363  KPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGF  422

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  423  DCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V
Sbjct  243  CIAPDYIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQFKRLTNLIEEKRV  302

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ 
Sbjct  303  ADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKP  362

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+SG G YHGKF F
Sbjct  363  KPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGF  422

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  423  DCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  473



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 179/231 (77%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKDLSRIVNS HF RL  +L ++ +
Sbjct  313  CIGVDYVITTKDFASKLIDALKTELKTFFGENPLESKDLSRIVNSFHFKRLESMLKENGM  372

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV GG+  E +LKI+PTIL+DVPE   +M+EEIFGPLLPI+TV K+EDG ++I ++ 
Sbjct  373  ADKIVKGGQTSEDKLKISPTILLDVPEACSMMQEEIFGPLLPIITVQKIEDGFQVIRSKA  432

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK+L+++FV +++AGG+ INDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  433  KPLAAYLFTDNKELQKKFVQDVAAGGIGINDTVLHVTVKDLPFGGVGESGIGAYHGKFSY  492

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A  G 
Sbjct  493  ETFSHKKGVLYRSFAGDSDLRYPPYTPKKKMVLKALLSSNIFAAILAFFGF  543



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  311  CISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  370

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  371  SNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  430

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  431  KPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  490

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  491  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  541



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  314  CISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  373

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  374  SNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  433

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  434  KPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  493

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ ALLG 
Sbjct  494  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLALLGF  544



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL+ F+G++PL SKD+SRIVNS HF RL  +L ++ V
Sbjct  311  CIGVDYVITTKDFASKLIDALKTELETFFGENPLESKDISRIVNSFHFKRLESMLKENGV  370

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E++LKI+PTI++DVPE + +M+EEIFGPLLP++TV K+EDG ++I ++ 
Sbjct  371  ANKIVHGGQTIEEKLKISPTIVVDVPEASSMMQEEIFGPLLPVVTVAKIEDGFQVIRSKP  430

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+NK+L+++FV  +SAGG+ INDT LHV    LPFGGVGESG G+YHGKFS+
Sbjct  431  KPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTQKDLPFGGVGESGIGAYHGKFSY  490

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  491  ETFSHKKGVLYRSFSGDADLRYPPYTTKKKMVLKALISSNIFAAILAFFGF  541



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  320  CIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  379

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  380  ANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  439

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  440  KPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  499

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  500  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  550



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITT++ A +L+DA+K EL+ F+GK+PL SKDLSRIVNS HF RL  +L ++ V
Sbjct  326  CIGVDYVITTEDFASKLIDAVKTELESFFGKNPLESKDLSRIVNSFHFKRLEGMLKENGV  385

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DV E++ +M+EEIFGPLLPI+TV K+EDGI++I ++ 
Sbjct  386  ANKIVHGGQTIEDKLKISPTILVDVSEESSMMREEIFGPLLPIVTVQKIEDGIQVIRSKP  445

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK+L+Q+FV +++AGG+ +NDT LHV V  LPFGGVGESG G+YHGKFS+
Sbjct  446  KPLAAYLFTDNKELQQQFVQDVAAGGIGVNDTILHVTVKDLPFGGVGESGIGAYHGKFSY  505

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A  G 
Sbjct  506  DTFSHKKGVLYRSFVGDSDIRYPPYTTKKKTVLKALLSSNIFRAILAFFGF  556



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  322  CIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  381

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  382  ANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  441

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  442  KPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  501

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  502  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  552



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  321  CIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  380

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  381  ANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  440

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  441  KPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  500

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  501  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  551



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F RLT L+++ +V
Sbjct  246  CIAPDYIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQFKRLTNLIEEKRV  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K+E+   +INA+ 
Sbjct  306  ADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEKIEESFDLINAKP  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT N+KL++EFV ++ AGG+L+ND ALH+    +PFGGVG+SG G YHGKF F
Sbjct  366  KPLAAYLFTKNRKLQEEFVASVPAGGMLVNDIALHLTNPYMPFGGVGDSGMGCYHGKFGF  425

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  426  DCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILALLGF  476



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 183/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK    +L+D++K  L++FYG+DPL S DLSRIV+ +HF RL KL++D +V
Sbjct  215  CIAPDYIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVSISHFERLAKLIEDKEV  274

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KI  GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+TV+K+E+ I  INA  
Sbjct  275  ATKIQLGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIITVDKIEESITHINAGA  334

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGGVG+SGTGSYHGKFSF
Sbjct  335  KPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSF  394

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  395  DCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  445



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  320  CIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  379

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  380  ADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  439

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  440  KPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  499

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  500  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  550



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF RL  ++ ++ V
Sbjct  322  CIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHFKRLESMMKENGV  381

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K+EDG ++I ++ 
Sbjct  382  ADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSKIEDGFQVIRSKP  441

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGESG G+YHGKFS+
Sbjct  442  KPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSY  501

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A  G 
Sbjct  502  ETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAFFGF  552



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 190/231 (82%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIIT +  A +L+DA+K  L+KFYG+DP+ S DLSRIVNS+HF RLT+LLDD KV
Sbjct  245  CIAPDYIITPESFAPKLIDALKNTLEKFYGQDPIQSADLSRIVNSSHFVRLTRLLDDPKV  304

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S K+++GG+RDEKRL IAPT+++D P D+LIM EEIFGPLL I+TV K+E+ ++++++  
Sbjct  305  SDKVIYGGQRDEKRLIIAPTLVLDAPMDSLIMIEEIFGPLLTIITVQKMEEALEVVSSFS  364

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT NKK E++ V ++SAGG+L+NDTALHV  H LPFGGVGESG GSYHGKFSF
Sbjct  365  KPLAAYVFTKNKKFERQVVASVSAGGMLVNDTALHVTNHHLPFGGVGESGVGSYHGKFSF  424

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAFSHKKAVL R F GDL ARYPPYT +K +++R L+SG+ + ++ A+LG 
Sbjct  425  EAFSHKKAVLYRGFMGDLMARYPPYTTRKQKIVRCLLSGDFLGLLYAILGW  475



>gb|EMT24757.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=334

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 182/231 (79%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA D+IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF RL  L+D++ V
Sbjct  100  CIAPDFIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFGRLKGLMDEEMV  159

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPILTV+K+ +   +IN+  
Sbjct  160  SDKIVFGGQRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPILTVDKIHESFGLINSMA  219

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT + +L+ +F   +SAGG+L NDT++H+    LPFGGVGESGTG+YHGKFSF
Sbjct  220  KPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGESGTGAYHGKFSF  279

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH+KAV+ R F G+  ARYPPY+  K ++L+ ++ G L  +I+A+LG 
Sbjct  280  DAFSHRKAVMNRGFAGEARARYPPYSAPKLKILKGVLEGKLGDMIQAILGF  330



>gb|EPS67421.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=250

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 177/230 (77%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY+ITTK+ A +++DA+  ELD FYGK PL S DLSRIVN  HF RL  LL D+KV
Sbjct  21   CISPDYLITTKDYASRVVDAISTELDNFYGKHPLRSHDLSRIVNPKHFERLLTLLQDEKV  80

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S +IV GGE D   L+IAPT++ DVP D+++M++EIFGPLLPILTV ++E+ + +I+A++
Sbjct  81   SCRIVRGGEHDRTTLRIAPTVIFDVPRDSVLMEDEIFGPLLPILTVERIEESLDVIDAKE  140

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LAA LFT++ KL+ EFV  +SAG + IN+T LH    +LPFGGVGESG G+YHGKFSF
Sbjct  141  KALAAYLFTNSPKLKSEFVRKVSAGAVCINETNLHFMEPSLPFGGVGESGMGAYHGKFSF  200

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            EAFSH+KAVL+R   GD+ ARYPPY+ +K  LL+ L+ G L+   +ALLG
Sbjct  201  EAFSHRKAVLERVLFGDVPARYPPYSRRKMDLLKNLLQGRLVAATQALLG  250



>gb|EMS67813.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=334

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 181/231 (78%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA D+IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF RL  L+D++ V
Sbjct  100  CIAPDFIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFGRLKGLMDEEMV  159

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  160  SDKIVFGGHRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPIITVDKIHESFGLINSMA  219

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT + +L+ +F   +SAGG+L NDT++H+    LPFGGVGESGTGSYHGKFSF
Sbjct  220  KPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGESGTGSYHGKFSF  279

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH+KAV+ R F G+  ARYPPY+  + ++L+ ++ G L  +I+A+LG 
Sbjct  280  DAFSHRKAVMNRGFAGEARARYPPYSAPRLKILKGVLEGKLGDMIQAILGF  330



>ref|XP_002893982.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70241.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 179/231 (77%), Gaps = 5/231 (2%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF RL+KLLD+ +V
Sbjct  266  CISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLSKLLDEKEV  325

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV+GGE+D + LKIAPTIL+DVP D+LIM EE   P     + +   +   +I +R 
Sbjct  326  SDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEENIWP-----SPSNSHESFDMIRSRP  380

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT NKKL++ F T +SAGG+++ND A+H+A+HTLPFGGVGESG G+YHGKFSF
Sbjct  381  KPLAAYLFTHNKKLKERFATTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSF  440

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I +ALLGL
Sbjct  441  DAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKALLGL  491



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 184/237 (78%), Gaps = 6/237 (3%)
 Frame = -2

Query  770  CIARDYIITTKENALQL------LDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKL  609
            CIA DYIITTK    +L      +D++K  L++FYG+DPL S DLSRIV+ +HF RLTKL
Sbjct  276  CIAPDYIITTKAFVTELEINFLQVDSLKRVLERFYGEDPLQSADLSRIVSISHFKRLTKL  335

Query  608  LDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIK  429
            ++D +V+ KI  GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+TV+K+E+ I 
Sbjct  336  IEDKEVATKIQLGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIITVDKIEESIA  395

Query  428  IINARDKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSY  249
             INA  KPLAA LFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGGVG+SGTGSY
Sbjct  396  HINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGTGSY  455

Query  248  HGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            HGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  456  HGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  512



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+TTK  A +LL+++K  L KFYG+DPL S DLSRIVNSNHF+RL  L+DD  V
Sbjct  249  CISPDYIVTTKSLAPKLLESLKKVLRKFYGEDPLRSPDLSRIVNSNHFNRLRTLMDDGTV  308

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +GKI  GG+ DE++L+IAPT+L+DVP D+ IMKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  309  AGKIAFGGQSDEQQLRIAPTLLLDVPLDSAIMKEEIFGPLLPIITVDKISESFAVINSVS  368

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT++ +L+Q+F  N+S+GG++ NDTA+H+    LPFGGVGESG G+YHG FSF
Sbjct  369  KPLAAYLFTNDSRLKQQFERNISSGGMIFNDTAIHLTNPHLPFGGVGESGMGAYHGAFSF  428

Query  230  EAFSHKKAVLKR-SFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AF+H+KAVL R SF G+  ARYPPYTP K  +LR ++ GN + ++ A +G
Sbjct  429  DAFTHRKAVLDRSSFLGEARARYPPYTPAKLGILRGVLKGNPLAMVLAAVG  479



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 175/218 (80%), Gaps = 0/218 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF RL  LL++DKV
Sbjct  311  CISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHFKRLVNLLEEDKV  370

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV ++ED   +IN + 
Sbjct  371  SNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVERLEDSFAMINRKP  430

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGESG GSYHGKFSF
Sbjct  431  KPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSF  490

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMS  117
            +AFSHKKAVL RSF GD   RYPPYTP K + ++AL+S
Sbjct  491  DAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLS  528



>gb|AFW56225.1| hypothetical protein ZEAMMB73_146423 [Zea mays]
Length=420

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  V
Sbjct  183  CVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSV  242

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  243  SGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMP  302

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGESG G+YHG FSF
Sbjct  303  KPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSF  362

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G
Sbjct  363  DAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAG  412



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 177/231 (77%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA D+IITT   A +L++ +K  L KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V
Sbjct  245  CIAPDFIITTSSFAPKLIEELKKVLGKFYGKDPLGSADLSRIVNSNHFNRLKTLMDEEMV  304

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+ D  +LKIAPTIL+DVP D+ IM+EEIFGP LPI+TV+K+ +   +IN+  
Sbjct  305  FEKIVFGGQMDAYQLKIAPTILLDVPLDSAIMREEIFGPFLPIITVDKINECFGLINSMS  364

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ N KL+ +F  ++SAGG+L+NDT++H+    LPFGGVGESGTG+YHGKFSF
Sbjct  365  KPLAAYLFSRNSKLQDKFERSISAGGMLLNDTSIHLTNPYLPFGGVGESGTGAYHGKFSF  424

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R F G+  ARYPPY+  K ++++ ++ G L  +I+A LG 
Sbjct  425  DAFSHKKAVLNRGFFGEAKARYPPYSEPKLKIMKGVLEGKLGDMIQAFLGF  475



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  V
Sbjct  254  CVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  314  SGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMP  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGESG G+YHG FSF
Sbjct  374  KPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G
Sbjct  434  DAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAG  483



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+RL  L+DD  V
Sbjct  254  CVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFNRLMALMDDYSV  313

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+ +   +IN+  
Sbjct  314  SGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKIGESFAVINSMP  373

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGESG G+YHG FSF
Sbjct  374  KPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSF  433

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  G
Sbjct  434  DAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAAG  483



>ref|XP_010093107.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
 gb|EXB53545.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
Length=588

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 190/304 (63%), Gaps = 73/304 (24%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYIITTK+ A  L+D+++ EL++ +G++PL ++D+SRIVN  HFSRL KLLD+DKV
Sbjct  284  CIAIDYIITTKDFAPTLIDSLRRELEQSFGQNPLETRDVSRIVNKYHFSRLLKLLDEDKV  343

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+ +E +L+IAPTIL+DVP+D  IMKEEIFGP LPI+TV K+ED   +IN+R 
Sbjct  344  SDKIVLGGQSNEDQLRIAPTILLDVPDDTEIMKEEIFGPFLPIVTVEKIEDSFDVINSRP  403

Query  410  KPLAAXL-----------------------------FTSNKKLEQEFVTNLSAGGLLIND  318
            +PL A L                             FT+N +L++++V N+S+GG+L+ND
Sbjct  404  QPLVAYLFTNNDQLKKDYVQNVSSGGMLVNDTVLHIFTNNDQLKKDYVQNVSSGGMLVND  463

Query  317  TALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRS-------------FGG--  183
            T LHV V  LPFGGVGESG GSYHGKFSF+ FSHKK+V+ R              FGG  
Sbjct  464  TVLHVTVDGLPFGGVGESGMGSYHGKFSFDGFSHKKSVMYRGFEPDASVTVDGLPFGGVG  523

Query  182  -----------------------------DLGARYPPYTPKKARLLRALMSGNLIFIIRA  90
                                         D   RYPPYTP+K RLL+AL+SG ++ II+A
Sbjct  524  ESGMGSYHGKFSFDGFSHKKSVMYRGFEPDASVRYPPYTPQKQRLLKALLSGKILAIIQA  583

Query  89   LLGL  78
            L+G 
Sbjct  584  LIGW  587



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 169/231 (73%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+  +  A +L+D +K  ++ FYGK+P+ S +LSRIVN+ H+ RL   L+D ++
Sbjct  268  CISPDYILVDESIASELVDNLKEIIETFYGKNPISSTNLSRIVNTKHYLRLISFLEDPQI  327

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIVHGGERDEK+L IAPT++ D   D+ +M EEIFGP+LPI+ V   ++ I IINAR 
Sbjct  328  CSKIVHGGERDEKKLYIAPTLVCDALMDSFLMSEEIFGPILPIIKVQGEQEAIDIINARP  387

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA +FT+NK +E+  V N+S+GG+++NDT +H     LPFGGVGESG GSYHGKFSF
Sbjct  388  KPLAAYVFTTNKAVEERMVKNVSSGGMVVNDTVMHFVNPGLPFGGVGESGMGSYHGKFSF  447

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R+  GD  ARYPP+T KK   LR ++ G+ I  I +L GL
Sbjct  448  DAFSHKKAVLYRTSLGDFPARYPPFTTKKQNFLRCVLDGDYIGAILSLTGL  498



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 181/230 (79%), Gaps = 0/230 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V
Sbjct  248  CISPDYIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFNRLKALMDEEMV  307

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+ +   +IN+  
Sbjct  308  YDKIVFGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKIHESFALINSMS  367

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LF+ + KL+ +F  N+SAGG++ NDT++H+    LPFGGVGESG GSYHG FSF
Sbjct  368  KPLAAYLFSKDSKLKHQFERNVSAGGMVFNDTSIHLTNQHLPFGGVGESGVGSYHGTFSF  427

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  81
            +AF+HKKAVL RSF G+  ARYPPYTP K ++L+ ++ GN + +++A +G
Sbjct  428  DAFAHKKAVLDRSFLGEAKARYPPYTPGKLKILKGVLKGNPLAMVQAAVG  477



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF RL  +L++  V
Sbjct  210  CIGVDYVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHFKRLESMLNESGV  269

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG +II ++ 
Sbjct  270  ADKIVIGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQKIEDGFEIIRSKP  329

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+ L+++FV N+SAGG+ IND  LHV V  LPFGGVGESG G YHGKFSF
Sbjct  330  KPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSF  389

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            E FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL 
Sbjct  390  ETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILALF  438



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF RL  +L++  V
Sbjct  312  CIGVDYVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHFKRLESMLNESGV  371

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIV GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K+EDG +II ++ 
Sbjct  372  ADKIVIGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQKIEDGFEIIRSKP  431

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLAA LFT+N+ L+++FV N+SAGG+ IND  LHV V  LPFGGVGESG G YHGKFSF
Sbjct  432  KPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSF  491

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            E FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL 
Sbjct  492  ETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILALF  540



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 164/231 (71%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL  LLDD  +
Sbjct  247  CVSPDYVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRLVGLLDDPNI  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KI HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++ I I+N+R 
Sbjct  307  ASKIAHGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDEAIDIVNSRP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT   K++++ +   SAGG+++ND  LH    TLPFGGVGESG GSYHGKFSF
Sbjct  367  KPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  427  DAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 164/231 (71%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL  LLDD  +
Sbjct  247  CVSPDYVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRLVGLLDDPNI  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KI HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++ I I+N+R 
Sbjct  307  ASKIAHGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDEAIDIVNSRP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT   K++++ +   SAGG+++ND  LH    TLPFGGVGESG GSYHGKFSF
Sbjct  367  KPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  427  DAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 163/229 (71%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RLT LLD+D V
Sbjct  247  CISPDYILADESVVPKLITAIKECLLEFYGDDPSKSKDIARVVNGSHFERLTGLLDEDGV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E  +  +N R 
Sbjct  307  KDKIVFGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMESAMSFVNTRP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT +K LE++ V+  SAGG+++NDT LH    T+PFGGVG SG G+YHGKFSF
Sbjct  367  KPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +AFSH+KAVL R F GD+ +RYPPYT  K   ++  + GN +  I+ALL
Sbjct  427  DAFSHRKAVLYRGFWGDMASRYPPYTIAKQTFVKNFLQGNYLEAIKALL  475



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 162/229 (71%), Gaps = 0/229 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RLT LLD+D V
Sbjct  247  CISPDYILADESVVPKLITAIKECLLEFYGDDPSRSKDIARVVNGSHFERLTGLLDEDGV  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E  +  +N R 
Sbjct  307  KDKIVFGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMESAMSFVNTRP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT +K LE++ V+  SAGG+++NDT LH    T+PFGGVG SG G+YHGKFSF
Sbjct  367  KPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  84
            +AFSH+KAVL R F  D+ +RYPPYT  K   +R  + GN +  I+ALL
Sbjct  427  DAFSHRKAVLYRGFWADMASRYPPYTIAKQNFVRNFLQGNYLEAIKALL  475



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 168/231 (73%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  +  A +++D +   ++ FYGKDP  S+DLSRIVN+ H+SRL   LDD K+
Sbjct  260  CIAPDYLLIDEIIASEVVDTLIDVIETFYGKDPKTSQDLSRIVNTKHYSRLAGFLDDPKI  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGG RD+ +L I+PT++ DVP D+ +M EEIFGP+LPI+ V  V++ I II+ R 
Sbjct  320  SSKIVHGGARDDNKLYISPTLVCDVPMDSTLMSEEIFGPILPIIKVKGVQEAIDIISDRP  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL A +FT NK++E+  V ++S+GG+++NDT +H     LPFGGVGESG  SYHGKFSF
Sbjct  380  KPLVAYVFTKNKEVEKRIVASISSGGMVVNDTIVHFLNPGLPFGGVGESGMSSYHGKFSF  439

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSHKKAVL R+  GD+ AR+PP+T  K    RA+M G+ +  + +L GL
Sbjct  440  DAFSHKKAVLYRNNLGDVPARFPPFTTMKQNFRRAIMDGHYLSAVISLTGL  490



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 165/231 (71%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DY++  +  A  L+  ++  L +FYG DP  S DL+RI+N NHF RL+ +LDD  +
Sbjct  247  CISPDYVLVEEHFAPTLIKQLQKTLLEFYGPDPSASVDLARIINKNHFQRLSSMLDDPSI  306

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + KIVHGGERDEK L IAPT++ + P D+ +M EEIFGP+LPI+TV  V+  + IIN + 
Sbjct  307  ADKIVHGGERDEKSLYIAPTLIDNPPLDSPVMVEEIFGPMLPIITVRNVDHALNIINDKP  366

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL   +F++NK L   F    S+GG+++ND  L   +  LPFGGVGESGTG+YHGK +F
Sbjct  367  KPLEVYVFSNNKDLFNRFRDETSSGGIVMNDCVLQFIIPELPFGGVGESGTGAYHGKATF  426

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH+KAVL ++ GGD+ ARYPP+T +K  L++AL++G +I II A LG 
Sbjct  427  DAFSHRKAVLVKNMGGDVFARYPPFTVRKQSLIKALLTGTIIDIILAALGW  477



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 182/268 (68%), Gaps = 38/268 (14%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+RL  L+D++ V
Sbjct  248  CISPDYIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFNRLKALMDEEMV  307

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
              KIV GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+ +   +IN+  
Sbjct  308  YDKIVFGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKIHESFALINSMS  367

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHT--------------------  291
            KPLAA LF+ + KL+ +F  N+SAGG++ NDT++HV  +                     
Sbjct  368  KPLAAYLFSKDSKLKHQFERNVSAGGMVFNDTSIHVRKNCTEPELQSVSELRILFSFITD  427

Query  290  ------------------LPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARY  165
                              LPFGGVGESG GSYHG FSF+AF+HKKAVL RSF G+  ARY
Sbjct  428  GCSLPYKLVATLQLTNQHLPFGGVGESGVGSYHGTFSFDAFAHKKAVLDRSFLGEAKARY  487

Query  164  PPYTPKKARLLRALMSGNLIFIIRALLG  81
            PPYTP K ++L+ ++ GN + +++A +G
Sbjct  488  PPYTPGKLKILKGVLKGNPLAMVQAAVG  515



>gb|KHN21904.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=446

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K   L+L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D +V
Sbjct  204  CITIDYVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHFSRLKNLLADKQV  263

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
             G +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK INAR 
Sbjct  264  KGSVVYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINARP  323

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N  L++  ++  S+G + IND  L  A  T+PFGGVGESG G YHGKFSF
Sbjct  324  KPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSF  383

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            + FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  384  DTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  418



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 149/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+  DY+IT+++ +L+L+DA+  ELD F   DPL S D +RIVNS HF RL +LL+D K+
Sbjct  238  CVCPDYVITSRDYSLKLIDAISSELDNFCSGDPLQSDDSTRIVNSGHFERLVRLLEDPKI  297

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINAR-  414
            SGKIV GG+ D+ +LKI+PT++MD P+D+L+M EEIFGPLLPI+TV  +E+ I +IN + 
Sbjct  298  SGKIVIGGKWDKAKLKISPTVIMDAPKDSLVMNEEIFGPLLPIITVEDIEESIAVINGKG  357

Query  413  DKPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFS  234
            +KPLAA +FT N+KL  +F+ N+SAG + IND  L V    LPFGGVGESG G YHGKFS
Sbjct  358  NKPLAAYIFTRNEKLRDDFIRNVSAGSMAINDVNLQVVEPELPFGGVGESGMGCYHGKFS  417

Query  233  FEAFSHKKAVLKRSF  189
            F+AFSH+K VL R F
Sbjct  418  FDAFSHRKPVLDRHF  432



>ref|XP_003539064.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K   L+L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D +V
Sbjct  252  CITIDYVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHFSRLKNLLADKQV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
             G +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK INAR 
Sbjct  312  KGSVVYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINARP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N  L++  ++  S+G + IND  L  A  T+PFGGVGESG G YHGKFSF
Sbjct  372  KPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            + FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  432  DTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>ref|XP_003539464.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Glycine 
max]
Length=494

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K    +L++ MKV + K  G++P  SK +++IVN +HFSRL  LL D KV
Sbjct  252  CIAIDYVLVEKVYCFKLVELMKVWIKKMCGENPQQSKTIAKIVNKHHFSRLKNLLADKKV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +++GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK IN+R 
Sbjct  312  KESVIYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFINSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N+ L++  ++  S+G + IND  L  AV T+PFGGVGESG G YHGKFSF
Sbjct  372  KPLALYVFTKNQTLQRRMISETSSGSVTINDAILQYAVDTVPFGGVGESGFGMYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            + FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  432  DTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>ref|XP_007132014.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
 gb|ESW04008.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
Length=492

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K+   +L++ MKV + K +G++P  SK +++IVN +HFSRL  LL D  V
Sbjct  250  CIAIDYVLVEKKYCSKLVELMKVWIKKMFGENPQHSKTITKIVNKHHFSRLNNLLTDKMV  309

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K+ED IK I++R 
Sbjct  310  KESVVYGGSMDEENLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEKIEDSIKFISSRP  369

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +F+ NK LE+  V+  S+G L  ND  +  A  TLPFGGVGESG G YHGKFSF
Sbjct  370  KPLALYVFSRNKTLERRMVSETSSGSLTFNDAIVQYAADTLPFGGVGESGFGMYHGKFSF  429

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLL  132
            + FSH+KA+++RSF  D   RYPP+T  K +LL
Sbjct  430  DTFSHQKAIVRRSFLTDFWFRYPPWTLNKLQLL  462



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ D+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF+RL+KLLDDDKV
Sbjct  260  CISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKV  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K+ED   IIN+  
Sbjct  320  SGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGT  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTL  288
            KPLAA LFT+NKKL+Q+FV  +SAGGL+INDTA+HV +  L
Sbjct  380  KPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHVIMLAL  420



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 154/231 (67%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYI+  +  A +L+   +  L +F+G+DP  SKDLSRIVN NHF RL++LLDD   
Sbjct  253  CISPDYILVEEHLAPKLIKQFRSTLVEFFGEDPRTSKDLSRIVNKNHFQRLSRLLDDPAT  312

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            + +IVHGGERDE  L IAPT++ D   D+ IM +EIFGPLLPI+TV  V   I +IN + 
Sbjct  313  ADRIVHGGERDEDSLYIAPTLIEDPALDSPIMADEIFGPLLPIITVRNVNAAIDLINDKP  372

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K L   LF++NK   + F    S+GGL++ND  +   V  LPFGGVGESGTG+YHGK SF
Sbjct  373  KALVVHLFSTNKDYVKMFTEETSSGGLVMNDCIMQFIVPELPFGGVGESGTGAYHGKASF  432

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH K++  +S  GD   RYPP+T  K  +LRA + G    +I+ LLGL
Sbjct  433  DTFSHFKSIFNKSQSGDAPIRYPPFTLWKQAMLRAFLEGRFFKLIQLLLGL  483



>gb|AFK41010.1| unknown [Lotus japonicus]
Length=293

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 143/215 (67%), Gaps = 0/215 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA  Y++      L+L++ MKV + K +G+ P  S  ++RIVN  HF RL  LL D KV
Sbjct  52   CIAVYYVLVENRYCLKLVELMKVWIKKMFGEVPQHSNSIARIVNEKHFFRLKNLLTDQKV  111

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE+ L I PTIL++ P DA IM +EIFGPLLPI+T++K+ED +  IN+  
Sbjct  112  LKSVVYGGSVDEENLFIEPTILVNPPLDAAIMSDEIFGPLLPIITLDKIEDSVNFINSMP  171

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT NK L+   ++  S+G L+ ND+ L  A  TLPFGGVGESG G YHGKFSF
Sbjct  172  KPLALYVFTKNKTLQNRMISETSSGSLMFNDSMLQYAADTLPFGGVGESGFGMYHGKFSF  231

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  126
            + FSH K +++RS+  D   RYPP+T  K +LL  
Sbjct  232  DTFSHHKGIVRRSYLTDFWYRYPPWTLNKFQLLEV  266



>ref|XP_002298405.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
 gb|EEE83210.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
Length=485

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 151/231 (65%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+  K  A  L++ MKV + K +G++P  +  ++RIVN  HF RL  LL D  V
Sbjct  251  CIAIDYILVEKRFASILVELMKVMIKKMFGENPRETNTVARIVNEQHFLRLKNLLSDSAV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DEK L + PTIL+D P DA IM EEIFGPLLPI+T++KVED I  IN++ 
Sbjct  311  QNSIVYGGSMDEKNLFVEPTILVDPPLDAAIMTEEIFGPLLPIITLDKVEDSIAFINSKP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+N+K  +  ++  S+G L+ ND  +  A   LPFGG+GESG G YHGKFSF
Sbjct  371  KPLAIYAFTNNEKFRRRMLSETSSGSLVFNDAVIQYAADALPFGGIGESGIGKYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH KAV +RSF  D   R+PP+   K  LL A  + + + ++  +LGL
Sbjct  431  DTFSHYKAVTRRSFLTDFWFRFPPWNDYKLLLLEATYNYDYLGMLLVILGL  481



>ref|XP_001770374.1| variable substrate [Physcomitrella patens]
 gb|EDQ64864.1| variable substrate [Physcomitrella patens]
Length=466

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 154/231 (67%), Gaps = 1/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+  +  A +L+  ++  L +FYG+DP  +KDL+RIVN NHF RL++LLD    
Sbjct  235  CIAPDYILVEEHLAPKLIKQLQSTLVQFYGEDPRSTKDLARIVNKNHFQRLSRLLDHPST  294

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  I+HGGERDE+ L IAPT++ D P  + IM+EEIFGPLLPI+T + V+  + +IN + 
Sbjct  295  AENIIHGGERDEESLYIAPTLIKDPPLSSPIMEEEIFGPLLPIIT-DHVDAAVDLINDKP  353

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K L   LF++ K    +F    S+GGL++ND  +  AV  LPFGGVGESGTG+YHG  SF
Sbjct  354  KALEIYLFSTRKDYAMKFAEETSSGGLVMNDCIVQFAVSELPFGGVGESGTGAYHGVASF  413

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
              FSH K++  +S G D+  RYPP+T +K  ++RA + G  +  I   LGL
Sbjct  414  NTFSHYKSIFNKSLGVDVAFRYPPFTTQKQGMMRAFLEGRFVNFILLALGL  464



>ref|XP_010045018.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW87156.1| hypothetical protein EUGRSUZ_B03683 [Eucalyptus grandis]
Length=487

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 154/231 (67%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY+I  K+ +  LL+ MKV + K  G++P  S+ ++RIVN +HF RL  LL+D  V
Sbjct  251  CIAIDYVIVEKKFSSTLLELMKVRIGKMLGENPRESRSMARIVNKHHFLRLKTLLEDPNV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DEK L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R 
Sbjct  311  KASIVYGGSMDEKSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N  L +  V   S+G +  ND  +     TLPFGG+GESG G+YHGKFSF
Sbjct  371  KPLALYVFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH KAVL+RSF  D   R+PP+   K +L R++   + + ++  +LGL
Sbjct  431  DTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSVYLFDYLGMLLTVLGL  481



>gb|KDO71077.1| hypothetical protein CISIN_1g0386172mg, partial [Citrus sinensis]
Length=361

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL D  V
Sbjct  129  CVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLKDPLV  188

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R 
Sbjct  189  ADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRP  248

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+SG G YHG +SF
Sbjct  249  KPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSF  308

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            E FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  309  ETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  342



>ref|XP_010031796.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW51187.1| hypothetical protein EUGRSUZ_J00773 [Eucalyptus grandis]
Length=495

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 154/231 (67%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K+ +  L++ MKV + K +G+ P  S+ ++RIVN +HF RL  LL D  V
Sbjct  255  CIGVDYVLVEKKFSSALVELMKVVMKKMFGESPRESQSVARIVNKHHFLRLRSLLLDPLV  314

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R 
Sbjct  315  KSSIVYGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRP  374

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT ++ L +  V+  S+G ++ ND  +     TLPFGG+GESG G YHGKFSF
Sbjct  375  KPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIIQYLADTLPFGGIGESGMGRYHGKFSF  434

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KAV++RSF  D   R+PP+   K +L R+    + + I+  +LGL
Sbjct  435  DTFSHQKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  485



>gb|KCW87154.1| hypothetical protein EUGRSUZ_B03682 [Eucalyptus grandis]
Length=441

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 143/216 (66%), Gaps = 0/216 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++   + +  LL+ MKV + K  G++P  S  ++RIVN NHFSRL  LL+D  V
Sbjct  205  CIAIDYVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHFSRLKTLLEDPNV  264

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R 
Sbjct  265  KASIVYGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRP  324

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT N  L +  V   S+G +  ND  +     TLPFGG+GESG G+YHGKFSF
Sbjct  325  KPLAIYAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSF  384

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
            + FSH KAVL+RSF  D   R+PP+   K +L R++
Sbjct  385  DTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  420



>ref|XP_006425564.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
 gb|ESR38804.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
Length=484

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL+D  V
Sbjct  252  CVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLEDPLV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R 
Sbjct  312  ADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+SG G YHG +SF
Sbjct  372  KPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            E FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  432  ETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>ref|XP_004507095.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=488

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 145/212 (68%), Gaps = 0/212 (0%)
 Frame = -2

Query  767  IARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVS  588
            IA DY+I  + N  ++++ MK+ + K +G +P  SK ++RIVN  H  RL  LL D KV 
Sbjct  249  IAIDYVIVERSNCSKVVELMKMWIKKMFGDNPKHSKSIARIVNKQHLFRLKNLLTDKKVQ  308

Query  587  GKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDK  408
              +V GG  DE+ L + PTIL++ P DA IM +E+FGPLLPI+TV K+ED I+ I+ R K
Sbjct  309  KSVVCGGSVDEENLFVEPTILVNPPLDATIMTDEVFGPLLPIITVEKIEDSIEFISCRPK  368

Query  407  PLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFE  228
            PLA  +FT N+ L++  ++  S+G ++ ND  L  A  +LPFGGVGESG G YHGKFSF+
Sbjct  369  PLALYVFTKNQTLQKRMISETSSGSVVFNDAILQYAADSLPFGGVGESGFGMYHGKFSFD  428

Query  227  AFSHKKAVLKRSFGGDLGARYPPYTPKKARLL  132
             FSH+KA+++RSF  D   RYPP+ P K +LL
Sbjct  429  TFSHQKAIVRRSFFTDFWYRYPPWKPHKFQLL  460



>ref|XP_011006203.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Populus euphratica]
Length=485

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 148/231 (64%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF RL  LL D  V
Sbjct  251  CIAIDYILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHFLRLKNLLSDSAV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++KVED I  IN++ 
Sbjct  311  RNSVVYGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDKVEDSIAFINSKP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   F++N+K  +   +  S+G L+ ND  +  A   LPFGG+GESG G YHGKFSF
Sbjct  371  KPLAIYAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGESGLGKYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH KAV KRSF  D   R+PP+   K  LL A    + + ++  +LGL
Sbjct  431  DTFSHYKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVILGL  481



>ref|XP_011006204.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Populus euphratica]
Length=485

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 148/231 (64%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF RL  LL D  V
Sbjct  251  CIAIDYILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHFLRLKNLLSDSAV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++KVED I  IN++ 
Sbjct  311  RNSVVYGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDKVEDSIAFINSKP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   F++N+K  +   +  S+G L+ ND  +  A   LPFGG+GESG G YHGKFSF
Sbjct  371  KPLAIYAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGESGLGKYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH KAV KRSF  D   R+PP+   K  LL A    + + ++  +LGL
Sbjct  431  DTFSHYKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVILGL  481



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI+ DYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF+RL+KLLD+DKV
Sbjct  257  CISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHFARLSKLLDEDKV  316

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+KVED   +IN+  
Sbjct  317  SSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDKVEDSFDVINSGT  376

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHV  303
            KPLAA LFT+ KKL+++FV  +SAGGL+INDT +HV
Sbjct  377  KPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHV  412



>ref|XP_006466887.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Citrus 
sinensis]
Length=484

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF RL KLL D  V
Sbjct  252  CVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHFERLRKLLKDPLV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N +++ I+ IN+R 
Sbjct  312  ADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNNIQESIEFINSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+SG G YHG +SF
Sbjct  372  KPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQSGIGRYHGHYSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            E FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  432  ETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>ref|XP_010045016.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=487

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 143/216 (66%), Gaps = 0/216 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++   + +  LL+ MKV + K  G++P  S  ++RIVN NHFSRL  LL+D  V
Sbjct  251  CIAIDYVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHFSRLKTLLEDPNV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R 
Sbjct  311  KASIVYGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKKIEDSINFINSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT N  L +  V   S+G +  ND  +     TLPFGG+GESG G+YHGKFSF
Sbjct  371  KPLAIYAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGESGMGNYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
            + FSH KAVL+RSF  D   R+PP+   K +L R++
Sbjct  431  DTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  466



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 152/231 (66%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYI+  K  A +L+  +K  + K +G++P  S  +SRI+N  HF RL  LLD+ KV
Sbjct  248  CIGIDYILVEKTYANELVQLIKDAIPKTFGENPKESHSISRIINRTHFLRLKNLLDEPKV  307

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE  L I PT+L+D P  A IM EEIFGPLLPI+T++K+ED I+ INAR 
Sbjct  308  KASIVYGGSTDEDNLFIEPTVLLDPPLKAAIMTEEIFGPLLPIITLDKIEDSIEFINARP  367

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K L    FT ++ L+++ ++  S+G ++ NDT +  AV TLPFGGVG+SG G YHGKFSF
Sbjct  368  KTLTIYAFTKDEALKKKIISRTSSGSVVFNDTIIQYAVDTLPFGGVGQSGFGRYHGKFSF  427

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+K V +RSF  D+  RYPP+  K  +L R+    + + ++   LGL
Sbjct  428  DTFSHEKTVARRSFLTDIWFRYPPWNNKSLQLFRSAYRYDYLSVVLITLGL  478



>dbj|BAJ96457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 159/232 (69%), Gaps = 5/232 (2%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+  ++ A  L++ +K  L++F+ K     +D++RIVN   F+RL+ LL+D KV
Sbjct  256  CIAIDYILVEEQFAPILIELLKSTLERFFTK----PEDMARIVNERQFNRLSGLLEDHKV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S  IVHGG+ D K L I PTIL++ P D+ +M EEIFGPLLPI+TV K+ED I+ +N+R 
Sbjct  312  SCSIVHGGDLDPKTLSIEPTILLNPPLDSDVMTEEIFGPLLPIITVKKIEDSIEFVNSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT+++ L+Q+ +   S+G +  ND  +   + ++PFGGVG+SG G YHGK+SF
Sbjct  372  KPLAIYAFTTSEALKQQIIKETSSGSVTFNDAIVQYGLESIPFGGVGQSGFGQYHGKYSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPK-KARLLRALMSGNLIFIIRALLGL  78
            E FSHKKAV +RSF  +   RYPP+  + K  LLR +   + + ++ ALLGL
Sbjct  432  EMFSHKKAVFRRSFLVEFMFRYPPWNDESKLGLLRHVFRYDYVSLVLALLGL  483



>ref|XP_010673629.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 152/231 (66%), Gaps = 2/231 (1%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYI+  K+ +  L++ +K  + K +G++P   + ++RI+N +HF+RL  LLDD +V
Sbjct  245  CIGVDYILVEKKLSSTLVELLKDGIKKSFGENP--EECVARIINKHHFNRLKGLLDDPRV  302

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IVHGG   E +L I PTIL+D P DA IM EEIFGPLLPI+T+  +E  I+ IN+R 
Sbjct  303  KTSIVHGGSIHEDKLFIEPTILVDPPLDAEIMTEEIFGPLLPIITLENIEGSIEFINSRS  362

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL    FT+N K  +   +  S+G +L NDT +  A  T+PFGGVGESG G YHGKF+F
Sbjct  363  KPLVIYCFTNNNKFMKRVSSETSSGAVLFNDTIVQYAADTIPFGGVGESGFGRYHGKFTF  422

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            +AFSH+K ++KR    D   R+PP+T KK  LLRA  S N   I+  +LGL
Sbjct  423  DAFSHEKPIVKRDLFPDFWFRFPPWTSKKLELLRAAFSYNYFLIVLIVLGL  473



>ref|XP_004486968.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=494

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 152/231 (66%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K  +  L++ MK  + K +G +P  S  ++RIVN  H +R+  LL + KV
Sbjct  252  CIAIDYVLVEKSFSSTLVELMKEGIKKMFGDNPKASNTIARIVNKKHSNRIKSLLSEPKV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V GG  D+  L I PTIL+D P D+ IM EEIF PLLPI+T+ K+EDGIK I ++ 
Sbjct  312  KESVVFGGSMDDDDLFIEPTILLDPPLDSAIMTEEIFAPLLPIITLEKIEDGIKFIKSKP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT +K L++  V+  S+G ++ ND  +  AV TLPFGGVGESG G YHGKFSF
Sbjct  372  KPLAIYVFTKSKTLQRRMVSETSSGSIVFNDAIIQYAVDTLPFGGVGESGLGRYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH KAV +RSF  D   R+PP+T +K +LL    + + I I  A+LGL
Sbjct  432  DTFSHHKAVARRSFYTDFWFRFPPWTLEKFQLLEEAYNLDYIGIPLAILGL  482



>ref|XP_010045013.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=474

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 0/216 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++   + +  LL+ MK  + K  G++P  S+ ++RIVN NHF RL  LL+D  V
Sbjct  238  CIAIDYVLVETKFSSTLLELMKAWISKMLGENPRESRSMARIVNKNHFFRLKTLLEDPNV  297

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R 
Sbjct  298  KASIVYGGSMDENSLFIEPTILLDPPLESGLMQDEIFGPLLPIITLKKIEDSINFINSRP  357

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N  L +  V   S+G +  ND  +     TLPFGG+GESG G+YHGKFSF
Sbjct  358  KPLAIYVFTHNDSLRKRMVAETSSGSVTFNDAMVQYVADTLPFGGIGESGMGNYHGKFSF  417

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
            + FSH KAV++RSF  D   R+PP+   K +L R++
Sbjct  418  DTFSHHKAVVRRSFLVDFWFRFPPWNDHKLQLFRSM  453



>ref|XP_006345274.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Solanum 
tuberosum]
Length=495

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 151/231 (65%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYI+  K    +L+  +K+ + K +G++P  S  +SRIVN NHF RL  LLD+  V
Sbjct  262  CIGIDYILVDKTFVNELVKLIKLGIPKMFGENPKESHSISRIVNRNHFLRLKNLLDEPMV  321

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +++GG  DE  L I PT+L+D P  + IM EEIFGPLLPI+T++K+ED I+ INAR 
Sbjct  322  KKSVIYGGSSDEDNLYIEPTVLLDPPMQSTIMTEEIFGPLLPIITLDKIEDSIEFINARP  381

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL    FT N++ +++     S+G L+ NDT +  A  TLPFGGVG+SG G YHGKFSF
Sbjct  382  KPLTIYAFTKNEEFKRKITKGTSSGSLVFNDTIIQYAADTLPFGGVGQSGFGRYHGKFSF  441

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KA+ +RSF  D+  RYPP++    +L ++    + + I+   LGL
Sbjct  442  DTFSHEKAIARRSFLTDIWFRYPPWSDHTLQLFKSAFIYDYLSIVLITLGL  492



>gb|KCW87152.1| hypothetical protein EUGRSUZ_B03680 [Eucalyptus grandis]
Length=487

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 0/216 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++   + +  LL+ MK  + K  G++P  S+ ++RIVN NHF RL  LL+D  V
Sbjct  251  CIAIDYVLVETKFSSTLLELMKAWISKMLGENPRESRSMARIVNKNHFFRLKTLLEDPNV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K+ED I  IN+R 
Sbjct  311  KASIVYGGSMDENSLFIEPTILLDPPLESGLMQDEIFGPLLPIITLKKIEDSINFINSRP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT N  L +  V   S+G +  ND  +     TLPFGG+GESG G+YHGKFSF
Sbjct  371  KPLAIYVFTHNDSLRKRMVAETSSGSVTFNDAMVQYVADTLPFGGIGESGMGNYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
            + FSH KAV++RSF  D   R+PP+   K +L R++
Sbjct  431  DTFSHHKAVVRRSFLVDFWFRFPPWNDHKLQLFRSM  466



>gb|KJE97385.1| aldehyde dehydrogenase type III-PG [Capsaspora owczarzaki ATCC 
30864]
Length=511

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 146/219 (67%), Gaps = 6/219 (3%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++  K+     L+A +  L++FYG DP  S DLSRI+N  H+ RL+ LL     
Sbjct  250  CLSPDYVLIDKKLQPAFLEAARAALNEFYGPDPKASPDLSRIINDAHWKRLSALL----T  305

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG +  GG+ D     IAPTIL+DVP DA +M+ E+FGP+LPI+ V+ +++ IK I +RD
Sbjct  306  SGTVAIGGQTDAATRYIAPTILVDVPHDAPVMQNEVFGPILPIINVSSIDEAIKFITSRD  365

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT N KL+ EF+   S+G   +NDT L   VH LPFGGVG SG GSYHGK+SF
Sbjct  366  KPLATYLFTRNSKLQDEFLKRTSSGSTCVNDTILQGGVHGLPFGGVGASGMGSYHGKYSF  425

Query  230  EAFSHKKAVLKRSFGGDL--GARYPPYTPKKARLLRALM  120
            EAFSH +AV+ ++ G ++    RYPPY+ KK   +  LM
Sbjct  426  EAFSHLRAVVYKNPGMEIVNTIRYPPYSDKKISWVSWLM  464



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 151/231 (65%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DYI+   +    L++ +K  + KF+ K    +K+++RIVN  +F RL  ++D+  V
Sbjct  248  CIAIDYILVEHKFISTLVELLKKYIKKFFDKGSNEAKNMARIVNKQNFLRLKNMVDEPAV  307

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               I++GG  DE +L + PTIL++ P DA IM+EEIFGP+LPI+ ++K+ED I  IN+R 
Sbjct  308  QATIIYGGSMDEDKLFVEPTILLNPPNDAEIMREEIFGPILPIIGMDKIEDSIDFINSRA  367

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT +K  ++  V+  ++G L  ND  +  AV TLPFGGVGESG G YHGKFSF
Sbjct  368  KPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGGVGESGIGRYHGKFSF  427

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KAV+KRSF  D   RYPP+   K  LLR   + N   ++  +LGL
Sbjct  428  DTFSHEKAVVKRSFLIDFWFRYPPWNNHKLELLRHAYNFNYFQLVLTVLGL  478



>gb|EAZ31491.1| hypothetical protein OsJ_15627 [Oryza sativa Japonica Group]
Length=363

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 143/231 (62%), Gaps = 4/231 (2%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DY++  +     L+ A+K  L KF+      S  ++RIVN+ HF RL+ LL D  V
Sbjct  135  CLAIDYVLVEERFVPVLIKALKSTLKKFFAD----SDHMARIVNARHFQRLSDLLKDKSV  190

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  ++HGG  D K L I PTIL++ P D+ IM EEIFGPLLPI+TV K+ED I  + AR 
Sbjct  191  AASVLHGGTLDAKNLCIEPTILLNPPLDSAIMTEEIFGPLLPIITVKKIEDSIAFVRARP  250

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            +PLA   FT N  L +  V   S+G +  ND  +   + +LPFGGVGESG G YHGK+SF
Sbjct  251  RPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPFGGVGESGFGQYHGKYSF  310

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            E FSHKKAVL R +  +L ARYPP+   K  ++R L   N +  +   LGL
Sbjct  311  EMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVGFVLTFLGL  361



>ref|XP_010271510.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nelumbo 
nucifera]
Length=484

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 154/231 (67%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+  DYI+  ++ A  L+D +K  +D+FYG+     KDL+RIVN +HF RL  L+ D  V
Sbjct  252  CVGVDYILVEEKFAPTLIDLLKKSIDQFYGRKAKDFKDLTRIVNRHHFERLHNLIKDPAV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S  IVHGG+ D++R+ I PTIL+D P +A IM EEIFGP LPI+T+  +E+ I+ +++R 
Sbjct  312  SDSIVHGGQVDKERMFIEPTILLDPPLEAEIMTEEIFGPFLPIITLKNIEESIEFVSSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL    FT ++ L++  ++  S+G +  ND A+      LPFGG+G+SG G YHGKFSF
Sbjct  372  KPLVLYAFTKDETLKRLVLSRTSSGSVTFNDIAVQFMSDDLPFGGIGQSGLGKYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            EAF+H+KAVL+R+F  DL +RYPP++  K   +R L   +   II   LGL
Sbjct  432  EAFTHEKAVLRRNFIFDLESRYPPWSDFKLNFIRLLYKYDYFGIILLFLGL  482



>ref|XP_007150367.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
 gb|ESW22361.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
Length=490

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 142/214 (66%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K  +  L+  MK  + K +G++P  S  ++RIVN  HF RL  LL D +V
Sbjct  252  CIAIDYVLVEKSFSSTLVTLMKAGIKKMFGENPKESNTVARIVNHKHFMRLKNLLTDPRV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  +EK L I PTIL++ P D+ IM +EIFGP+LPI+TV K+ED I+ IN+R 
Sbjct  312  KDSVVYGGSMNEKDLFIEPTILLNPPLDSPIMADEIFGPVLPIITVEKIEDSIEFINSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT NK L +  ++  S+G L+ ND  L   V TLPFGGVGE G G YHGKFSF
Sbjct  372  KPLAIYAFTKNKTLHKRLLSETSSGSLVFNDAILQYVVDTLPFGGVGECGFGKYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +AFSH KAV +RS+  D   R+PP+T  K +LL 
Sbjct  432  DAFSHHKAVARRSYFTDFWYRFPPWTLNKLQLLE  465



>ref|XP_004343114.1| aldehyde dehydrogenase type III-PG [Capsaspora owczarzaki ATCC 
30864]
Length=540

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 146/219 (67%), Gaps = 6/219 (3%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C++ DY++  K+     L+A +  L++FYG DP  S DLSRI+N  H+ RL+ LL     
Sbjct  279  CLSPDYVLIDKKLQPAFLEAARAALNEFYGPDPKASPDLSRIINDAHWKRLSALL----T  334

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            SG +  GG+ D     IAPTIL+DVP DA +M+ E+FGP+LPI+ V+ +++ IK I +RD
Sbjct  335  SGTVAIGGQTDAATRYIAPTILVDVPHDAPVMQNEVFGPILPIINVSSIDEAIKFITSRD  394

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  LFT N KL+ EF+   S+G   +NDT L   VH LPFGGVG SG GSYHGK+SF
Sbjct  395  KPLATYLFTRNSKLQDEFLKRTSSGSTCVNDTILQGGVHGLPFGGVGASGMGSYHGKYSF  454

Query  230  EAFSHKKAVLKRSFGGDL--GARYPPYTPKKARLLRALM  120
            EAFSH +AV+ ++ G ++    RYPPY+ KK   +  LM
Sbjct  455  EAFSHLRAVVYKNPGMEIVNTIRYPPYSDKKISWVSWLM  493



>ref|XP_010102335.1| Aldehyde dehydrogenase family 3 member F1 [Morus notabilis]
 gb|EXB93296.1| Aldehyde dehydrogenase family 3 member F1 [Morus notabilis]
Length=491

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 150/231 (65%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K+   + ++ MK    K +G++P  +  ++RIVN  HF RL  LLDD  V
Sbjct  251  CITIDYVLVEKKFLPKAVELMKAITTKMFGENPRETNTVARIVNRRHFLRLKNLLDDPTV  310

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG+ DE+ L I PTIL+D P +A IM EEIFGPLLPI+T+  +ED I+ I AR 
Sbjct  311  KASIVYGGKTDEENLFIEPTILVDPPLEAEIMTEEIFGPLLPIITLENIEDSIEFIKARP  370

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            +PL    FT +K LE++ V+  S+G L+ ND  +  A  T+PFGGVGESG G YHGKFSF
Sbjct  371  RPLTIYAFTKSKTLERKLVSETSSGSLVFNDAIIQYAADTIPFGGVGESGIGRYHGKFSF  430

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KAV +RSF  D   R+PP+   K +L R   + + + +I  +LGL
Sbjct  431  DTFSHEKAVARRSFLVDFWFRFPPWNDYKLQLFREAYNFDYLGVIFVVLGL  481



>gb|KFM72617.1| Aldehyde dehydrogenase, dimeric NADP-preferring, partial [Stegodyphus 
mimosarum]
Length=523

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            C+A DY++ +K+   + +   K  L +F+G DP  S DL+RIVN+ HF R+ K L     
Sbjct  264  CVAPDYVLCSKKTEKKFIQIAKRVLLEFFGDDPEASPDLARIVNAEHFERVIKFLS----  319

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
             GKI  GG+ D K   IAPTIL DV ED  +M+EEIFGP+LPI+TVN  E+ I  IN R+
Sbjct  320  CGKIAVGGDYDPKEKYIAPTILTDVKEDDCVMQEEIFGPILPIITVNSPEEAINFINKRE  379

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPL   LF SNKK+   F+++ S+G + +NDT +H++V  LPFGGVG SG G+Y GK+SF
Sbjct  380  KPLTLYLFASNKKVLDMFLSSTSSGSMCVNDTMVHLSVDALPFGGVGMSGMGTYQGKYSF  439

Query  230  EAFSHKKAVLKR---SFGGDLG-ARYPPYTPKKARLLRALMS  117
            + FSHK++VL+R   SFG  +G ARYPPY   K ++L+  +S
Sbjct  440  DTFSHKRSVLERSLSSFGEYMGKARYPPYNNNKIKILKMFLS  481



>ref|XP_010555061.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Tarenaya hassleriana]
Length=488

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 145/216 (67%), Gaps = 0/216 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY +  K  A  L++ MK  + K +G++P  S  + RI ++N FSRL +LLDD ++
Sbjct  252  CIAVDYALVEKGYAPTLIEVMKGSIKKMFGENPRKSSTVGRISHTNCFSRLKRLLDDKRI  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +VHGG  D++ + I PTIL+D P D+ IM EEIFGPLLPI+T+ K++D I+ IN+R 
Sbjct  312  RECVVHGGSVDDETMFIEPTILLDPPLDSEIMTEEIFGPLLPIITLEKIQDSIEFINSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT ++K  +   +  ++G L+ ND  +  A  TLPFGG+GESG G YHGK+SF
Sbjct  372  KPLAIYAFTKDEKFRKRLASETTSGSLVFNDAIIQYAADTLPFGGIGESGMGKYHGKYSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  123
            EAF+H KA+++RSF  D   R+PP+   K +L R +
Sbjct  432  EAFTHYKAIVRRSFLTDFWFRFPPWNDHKLQLFRTV  467



>gb|KCW51186.1| hypothetical protein EUGRSUZ_J00772 [Eucalyptus grandis]
Length=495

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 157/231 (68%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K+ +  L++ MK+ + K +G++P  S+ ++RIVN +HF RL  LL D  V
Sbjct  255  CIGVDYVLVEKKFSSSLVELMKMMMKKMFGENPRESQSVARIVNKHHFLRLRSLLLDPLV  314

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R 
Sbjct  315  KSSIVYGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRP  374

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT ++ L +  V+  S+G ++ ND  +   V TLPFGG+GESG G YHGKFSF
Sbjct  375  KPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPFGGIGESGMGRYHGKFSF  434

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KAV++RSF  D+  R+PP+   K +L R+    + + I+  +LGL
Sbjct  435  DTFSHQKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  485



>ref|XP_003629375.1| Aldehyde dehydrogenase family 3 member F1 [Medicago truncatula]
 gb|AET03851.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 145/214 (68%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  ++ + +L++ +K  + KFYG + + SK LSRI+N +HF RL  LL D  V
Sbjct  250  CIAIDYLLVEEKYSSELIELLKKFMRKFYGDNMMESKALSRIINKHHFERLCNLLKDPLV  309

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            +  IVHGG  DE  L I PTIL+D P DA IM EEIFGPLLP++TVNK+++ I+ IN+R 
Sbjct  310  AASIVHGGSVDETNLFIEPTILLDPPLDAEIMTEEIFGPLLPVITVNKIQESIEFINSRP  369

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA   FT +   +++ V+  S+G +  NDT +     TLPFGGVG+SG G YHGK+SF
Sbjct  370  KPLAIYAFTKDATFKKKIVSETSSGSVTFNDTLVQFLCDTLPFGGVGQSGFGRYHGKYSF  429

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            + FSH+KAVL R    ++  RYPP++  K   LR
Sbjct  430  DTFSHEKAVLHRHLCLEIEPRYPPWSKFKLEFLR  463



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 140/182 (77%), Gaps = 6/182 (3%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F+RL KLLD+DKV
Sbjct  328  CIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQFTRLAKLLDEDKV  387

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
            S KIV GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K+ED   +IN++ 
Sbjct  388  SNKIVLGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEKIEDSFSVINSKP  447

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG------VGESGTGSY  249
            KPLA   FT+N++L++ FV N+S+GG+LINDT LH  V  LP         +G  GTG  
Sbjct  448  KPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHAMVSRLPDKAEKIQKQIGVLGTGEV  507

Query  248  HG  243
             G
Sbjct  508  EG  509



>ref|XP_010034106.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=503

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 157/231 (68%), Gaps = 0/231 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CI  DY++  K+ +  L++ MK+ + K +G++P  S+ ++RIVN +HF RL  LL D  V
Sbjct  263  CIGVDYVLVEKKFSSSLVELMKMMMKKMFGENPRESQSVARIVNKHHFLRLRSLLLDPLV  322

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               IV+GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK+ED I+ IN+R 
Sbjct  323  KSSIVYGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNKIEDSIEFINSRP  382

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            KPLA  +FT ++ L +  V+  S+G ++ ND  +   V TLPFGG+GESG G YHGKFSF
Sbjct  383  KPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPFGGIGESGMGRYHGKFSF  442

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  78
            + FSH+KAV++RSF  D+  R+PP+   K +L R+    + + I+  +LGL
Sbjct  443  DTFSHQKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLGIVLTVLGL  493



>ref|XP_003547154.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 141/214 (66%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K  +  L+  MK  + K +G++P  S  ++RIVN NHF RL  LL + +V
Sbjct  252  CIAIDYVLVEKSFSSTLVTLMKEWIKKMFGENPKASNSIARIVNKNHFMRLQNLLTEPRV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE  L I PTIL+D P D+ +M EEIFGP+LPI+T+ K+ED ++ I++R 
Sbjct  312  KESVVYGGSMDENDLFIEPTILLDPPLDSAVMAEEIFGPVLPIITLEKIEDSVEFISSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LA   FT N+ L++  V+  S+G L+ ND  L     TLPFGGVGE G G YHGKFSF
Sbjct  372  KALAIYAFTKNQTLQRRMVSETSSGSLVFNDAILQYVADTLPFGGVGECGFGKYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +AFSH KAV +RS+  D   R+PP+T  K +LL 
Sbjct  432  DAFSHHKAVARRSYLTDFWFRFPPWTLDKLQLLE  465



>gb|KHN33348.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=494

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 141/214 (66%), Gaps = 0/214 (0%)
 Frame = -2

Query  770  CIARDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKV  591
            CIA DY++  K  +  L+  MK  + K +G++P  S  ++RIVN NHF RL  LL + +V
Sbjct  252  CIAIDYVLVEKSFSSTLVTLMKEWIKKMFGENPKASNSIARIVNKNHFMRLQNLLTEPRV  311

Query  590  SGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARD  411
               +V+GG  DE  L I PTIL+D P D+ +M EEIFGP+LPI+T+ K+ED ++ I++R 
Sbjct  312  KESVVYGGSMDENDLFIEPTILLDPPLDSAVMAEEIFGPVLPIITLEKIEDSVEFISSRP  371

Query  410  KPLAAXLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSF  231
            K LA   FT N+ L++  V+  S+G L+ ND  L     TLPFGGVGE G G YHGKFSF
Sbjct  372  KALAIYAFTKNQTLQRRMVSETSSGSLVFNDAILQYVADTLPFGGVGECGFGKYHGKFSF  431

Query  230  EAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  129
            +AFSH KAV +RS+  D   R+PP+T  K +LL 
Sbjct  432  DAFSHHKAVARRSYLTDFWFRFPPWTLDKLQLLE  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310