BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016P24

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093189.1|  Oxygen-evolving enhancer protein 2                 323   3e-107   Morus notabilis
ref|XP_010247826.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   3e-106   Nelumbo nucifera [Indian lotus]
gb|KHG20721.1|  Oxygen-evolving enhancer 2-3, chloroplastic             320   7e-106   Gossypium arboreum [tree cotton]
ref|XP_009407699.1|  PREDICTED: oxygen-evolving enhancer protein ...    319   9e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB71514.1|  hypothetical protein B456_011G126200                    319   2e-105   Gossypium raimondii
ref|XP_010906959.1|  PREDICTED: oxygen-evolving enhancer protein ...    316   2e-104   Elaeis guineensis
gb|KJB75386.1|  hypothetical protein B456_012G039400                    311   9e-103   Gossypium raimondii
ref|WP_039310993.1|  hypothetical protein                               310   4e-102   Paenibacillus sp. IHB B 3415
gb|KHG22094.1|  Oxygen-evolving enhancer 2-1, chloroplastic             310   4e-102   Gossypium arboreum [tree cotton]
ref|XP_002521576.1|  Oxygen-evolving enhancer protein 2, chloropl...    308   1e-101   Ricinus communis
ref|XP_008809743.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   2e-101   Phoenix dactylifera
ref|XP_003532074.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   3e-101   Glycine max [soybeans]
ref|XP_009419010.1|  PREDICTED: oxygen-evolving enhancer protein ...    306   9e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881132.1|  oxygen-evolving enhancer protein 2                 306   1e-100   Arabidopsis lyrata subsp. lyrata
gb|KDP36279.1|  hypothetical protein JCGZ_10289                         306   1e-100   Jatropha curcas
gb|KHN28540.1|  Oxygen-evolving enhancer protein 2, chloroplastic       306   1e-100   Glycine soja [wild soybean]
ref|NP_001274949.1|  oxygen-evolving enhancer protein 2, chloropl...    305   2e-100   Solanum tuberosum [potatoes]
ref|XP_006296023.1|  hypothetical protein CARUB_v10025169mg             305   3e-100   Capsella rubella
gb|AFK44592.1|  unknown                                                 305   4e-100   Lotus japonicus
ref|XP_011100486.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    304   5e-100   Sesamum indicum [beniseed]
ref|XP_002307570.1|  photosystem II oxygen-evolving complex prote...    304   5e-100   Populus trichocarpa [western balsam poplar]
gb|AFK47979.1|  unknown                                                 304   6e-100   Lotus japonicus
sp|O49080.1|PSBP_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    304   7e-100   Fritillaria agrestis
ref|XP_010054080.1|  PREDICTED: oxygen-evolving enhancer protein ...    304   9e-100   Eucalyptus grandis [rose gum]
ref|XP_004499534.1|  PREDICTED: oxygen-evolving enhancer protein ...    304   1e-99    
ref|XP_011085433.1|  PREDICTED: oxygen-evolving enhancer protein ...    303   1e-99    Sesamum indicum [beniseed]
ref|XP_006366632.1|  PREDICTED: oxygen-evolving enhancer protein ...    302   1e-99    Solanum tuberosum [potatoes]
gb|EPS69373.1|  hypothetical protein M569_05393                         303   1e-99    Genlisea aurea
ref|XP_002889614.1|  oxygen-evolving enhancer protein 2                 303   1e-99    
ref|XP_007215827.1|  hypothetical protein PRUPE_ppa010093mg             303   3e-99    Prunus persica
ref|XP_007048926.1|  Photosystem II subunit P-1                         303   3e-99    
ref|NP_001234109.1|  oxygen-evolving enhancer protein 2, chloropl...    302   4e-99    
sp|Q40407.1|PSBP_NARPS  RecName: Full=Oxygen-evolving enhancer pr...    302   4e-99    Narcissus pseudonarcissus
emb|CAA41712.1|  photosystem II 23 kDa polypeptide                      302   4e-99    Nicotiana tabacum [American tobacco]
ref|XP_011026206.1|  PREDICTED: oxygen-evolving enhancer protein ...    302   5e-99    Populus euphratica
ref|NP_172153.1|  photosystem II subunit P-1                            302   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001276136.1|  oxygen-evolving enhancer protein 2, chloropl...    302   5e-99    Glycine max [soybeans]
ref|XP_009618672.1|  PREDICTED: oxygen-evolving enhancer protein ...    302   6e-99    Nicotiana tomentosiformis
dbj|BAE71271.1|  putative PSII-P protein                                301   6e-99    Trifolium pratense [peavine clover]
ref|XP_008229592.1|  PREDICTED: oxygen-evolving enhancer protein ...    301   8e-99    Prunus mume [ume]
ref|XP_008380167.1|  PREDICTED: oxygen-evolving enhancer protein ...    301   8e-99    Malus domestica [apple tree]
ref|XP_006303580.1|  hypothetical protein CARUB_v10011102mg             301   8e-99    Capsella rubella
ref|XP_011032754.1|  PREDICTED: oxygen-evolving enhancer protein ...    301   1e-98    Populus euphratica
sp|P16059.1|PSBP_PEA  RecName: Full=Oxygen-evolving enhancer prot...    301   1e-98    Pisum sativum [garden pea]
gb|ACJ84745.1|  unknown                                                 301   1e-98    Medicago truncatula
gb|AFK39738.1|  unknown                                                 301   1e-98    Lotus japonicus
gb|ABY52939.1|  chloroplast 23 kDa polypeptide of photosystem II        298   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009144275.1|  PREDICTED: oxygen-evolving enhancer protein ...    301   1e-98    Brassica rapa
ref|XP_002300858.1|  photosystem II oxygen-evolving complex prote...    300   2e-98    Populus trichocarpa [western balsam poplar]
ref|NP_001058863.1|  Os07g0141400                                       300   2e-98    
ref|NP_001117239.1|  photosystem II subunit P-1                         298   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AGZ95660.1|  photosystem II extrinsic subunit (chloroplast)          300   2e-98    Oryza sativa [red rice]
ref|XP_006410179.1|  hypothetical protein EUTSA_v10017096mg             300   3e-98    Eutrema salsugineum [saltwater cress]
gb|EYU43166.1|  hypothetical protein MIMGU_mgv1a011987mg                300   4e-98    Erythranthe guttata [common monkey flower]
ref|XP_007155967.1|  hypothetical protein PHAVU_003G2476001g            296   4e-98    Phaseolus vulgaris [French bean]
ref|XP_010414217.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004491279.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   4e-98    Cicer arietinum [garbanzo]
gb|KFK31259.1|  hypothetical protein AALP_AA6G089000                    300   4e-98    Arabis alpina [alpine rockcress]
ref|XP_010486454.1|  PREDICTED: oxygen-evolving enhancer protein ...    299   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010469798.1|  PREDICTED: oxygen-evolving enhancer protein ...    299   6e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008793536.1|  PREDICTED: oxygen-evolving enhancer protein ...    302   6e-98    Phoenix dactylifera
pdb|2VU4|A  Chain A, Structure Of Psbp Protein From Spinacia Oler...    296   7e-98    Spinacia oleracea
gb|AFK45301.1|  unknown                                                 299   7e-98    Medicago truncatula
ref|XP_010680144.1|  PREDICTED: oxygen-evolving enhancer protein ...    299   7e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009765610.1|  PREDICTED: oxygen-evolving enhancer protein ...    299   8e-98    Nicotiana sylvestris
sp|P12302.1|PSBP_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    299   8e-98    Spinacia oleracea
pdb|4RTI|A  Chain A, The Crystal Structure Of Psbp From Spinacia ...    296   1e-97    Spinacia oleracea
ref|XP_010486460.1|  PREDICTED: putative oxygen-evolving enhancer...    297   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010457809.1|  PREDICTED: putative oxygen-evolving enhancer...    296   1e-97    Camelina sativa [gold-of-pleasure]
emb|CAA44292.1|  23-kDa ploypeptide of photosystem II oxygen-evol...    298   2e-97    Nicotiana tabacum [American tobacco]
gb|AAC02750.1|  photosystem II oxygen-evolving complex 23K protei...    298   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AGZ95659.1|  photosystem II extrinsic subunit                        298   2e-97    Nicotiana benthamiana
ref|XP_009356583.1|  PREDICTED: oxygen-evolving enhancer protein ...    297   5e-97    Pyrus x bretschneideri [bai li]
ref|XP_009619867.1|  PREDICTED: oxygen-evolving enhancer protein ...    296   6e-97    Nicotiana tomentosiformis
gb|EYU42856.1|  hypothetical protein MIMGU_mgv1a011103mg                297   1e-96    Erythranthe guttata [common monkey flower]
gb|AFH58003.1|  chloroplast PsbP3 precursor                             296   1e-96    Nicotiana benthamiana
ref|XP_004147746.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   2e-96    Cucumis sativus [cucumbers]
ref|XP_003519527.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   2e-96    Glycine max [soybeans]
ref|XP_003545316.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   3e-96    Glycine max [soybeans]
ref|XP_004965800.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   3e-96    Setaria italica
ref|XP_010557156.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   3e-96    Tarenaya hassleriana [spider flower]
emb|CDP17859.1|  unnamed protein product                                295   4e-96    Coffea canephora [robusta coffee]
ref|XP_006658268.1|  PREDICTED: oxygen-evolving enhancer protein ...    297   4e-96    
ref|XP_004303902.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   4e-96    Fragaria vesca subsp. vesca
ref|XP_008451840.1|  PREDICTED: oxygen-evolving enhancer protein ...    295   4e-96    
pdb|1V2B|A  Chain A, Crystal Structure Of Psbp Protein In The Oxy...    291   6e-96    Nicotiana tabacum [American tobacco]
gb|KFK42985.1|  hypothetical protein AALP_AA1G064500                    294   6e-96    Arabis alpina [alpine rockcress]
dbj|BAA96364.1|  oxygen evolving enhancer protein 2                     290   6e-96    Bruguiera gymnorhiza [Burma mangrove]
emb|CDY15587.1|  BnaA08g28710D                                          294   6e-96    Brassica napus [oilseed rape]
gb|AFH58002.1|  chloroplast PsbP2 precursor                             294   6e-96    Nicotiana benthamiana
emb|CDY06657.1|  BnaA10g04360D                                          294   8e-96    
ref|XP_006417894.1|  hypothetical protein EUTSA_v10008504mg             294   8e-96    Eutrema salsugineum [saltwater cress]
emb|CDX86515.1|  BnaC08g01880D                                          293   9e-96    
emb|CDY10216.1|  BnaC05g04590D                                          293   1e-95    Brassica napus [oilseed rape]
ref|XP_008342330.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   1e-95    Malus domestica [apple tree]
ref|XP_009769223.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   2e-95    Nicotiana sylvestris
emb|CAA68801.1|  23 kD subunit                                          292   2e-95    Sinapis alba [bai jie]
sp|P11594.2|PSBP_SINAL  RecName: Full=Oxygen-evolving enhancer pr...    292   2e-95    Sinapis alba [bai jie]
gb|ADQ00373.1|  oxygen-evolving enhancer protein 2                      292   3e-95    Sequoia sempervirens [California redwood]
gb|ACU23674.1|  unknown                                                 292   4e-95    Glycine max [soybeans]
pdb|4RTH|A  Chain A, The Crystal Structure Of Psbp From Zea Mays        289   4e-95    Zea mays [maize]
sp|Q96334.1|PSBP_BRAJU  RecName: Full=Oxygen-evolving enhancer pr...    290   5e-95    Brassica juncea [brown mustard]
emb|CAA45699.1|  23 kDa polypeptide of water-oxidizing complex of...    291   6e-95    Nicotiana tabacum [American tobacco]
gb|KDO44763.1|  hypothetical protein CISIN_1g025092mg                   291   6e-95    Citrus sinensis [apfelsine]
ref|XP_002461438.1|  hypothetical protein SORBIDRAFT_02g002690          291   9e-95    Sorghum bicolor [broomcorn]
emb|CAA45700.1|  23 kDa polypeptide of water-oxidizing complex of...    289   1e-94    Nicotiana tabacum [American tobacco]
ref|XP_006843560.1|  hypothetical protein AMTR_s00007p00081670          291   1e-94    Amborella trichopoda
ref|XP_009110976.1|  PREDICTED: oxygen-evolving enhancer protein ...    291   1e-94    Brassica rapa
ref|XP_006437083.1|  hypothetical protein CICLE_v10032502mg             290   1e-94    Citrus clementina [clementine]
ref|XP_008652004.1|  PREDICTED: oxygen-evolving enhancer protein ...    292   1e-94    
gb|ABQ85433.1|  23 kDa OEC protein                                      288   2e-94    Salicornia veneta
tpg|DAA42743.1|  TPA: hypothetical protein ZEAMMB73_321092              289   4e-94    
gb|AFH58001.1|  chloroplast PsbP1 precursor                             289   6e-94    Nicotiana benthamiana
ref|XP_010543054.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    290   8e-94    
ref|XP_009119039.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   8e-94    Brassica rapa
gb|AAX53162.1|  chloroplast photosynthetic oxygen-evolving protei...    288   9e-94    Nicotiana benthamiana
ref|XP_009118485.1|  PREDICTED: oxygen-evolving enhancer protein ...    288   9e-94    Brassica rapa
emb|CDY06222.1|  BnaA09g49810D                                          288   9e-94    
dbj|BAG70022.1|  23 kDa precursor protein of the oxygen-evolving ...    288   9e-94    Salicornia europaea [chicken-claws]
emb|CDY09962.1|  BnaC08g44890D                                          288   1e-93    Brassica napus [oilseed rape]
sp|P85189.1|PSBP_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    288   1e-93    Helianthus annuus
ref|XP_003557629.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   2e-93    Brachypodium distachyon [annual false brome]
emb|CDY47118.1|  BnaC04g13750D                                          300   2e-93    Brassica napus [oilseed rape]
ref|XP_009376988.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   4e-93    Pyrus x bretschneideri [bai li]
ref|XP_010522048.1|  PREDICTED: oxygen-evolving enhancer protein ...    286   5e-93    Tarenaya hassleriana [spider flower]
ref|XP_002283048.1|  PREDICTED: oxygen-evolving enhancer protein ...    286   5e-93    Vitis vinifera
ref|XP_009118486.1|  PREDICTED: putative oxygen-evolving enhancer...    285   5e-93    Brassica rapa
emb|CBI22068.3|  unnamed protein product                                285   6e-93    Vitis vinifera
ref|XP_010657103.1|  PREDICTED: putative oxygen-evolving enhancer...    284   1e-92    Vitis vinifera
gb|EMS54608.1|  Oxygen-evolving enhancer protein 2, chloroplastic       284   3e-92    Triticum urartu
gb|ABQ41912.1|  23kDa polypeptide of the oxygen evolving complex ...    281   2e-91    Sonneratia apetala
gb|ABQ41911.1|  23kDa polypeptide of the oxygen evolving complex ...    281   2e-91    Sonneratia ovata
gb|AAB82135.1|  23kDa polypeptide of photosystem II                     281   5e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_003617328.1|  Oxygen-evolving enhancer protein                   281   6e-91    Medicago truncatula
gb|ABK26108.1|  unknown                                                 281   9e-91    Picea sitchensis
gb|ABR16937.1|  unknown                                                 280   2e-90    Picea sitchensis
gb|ABK22374.1|  unknown                                                 280   3e-90    Picea sitchensis
gb|ABQ41910.1|  23kDa polypeptide of the oxygen evolving complex ...    277   9e-90    Sonneratia caseolaris
gb|EMT29894.1|  Oxygen-evolving enhancer protein 2, chloroplastic       278   4e-89    
gb|ABK21284.1|  unknown                                                 276   8e-89    Picea sitchensis
ref|XP_006354308.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   1e-88    
sp|Q00434.1|PSBP_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    275   1e-88    Triticum aestivum [Canadian hard winter wheat]
gb|ABS84824.1|  chloroplast oxygen-evolving enhancer protein 2          275   2e-88    Limonium bicolor
ref|XP_007141448.1|  hypothetical protein PHAVU_008G196500g             274   5e-88    Phaseolus vulgaris [French bean]
gb|AGV54458.1|  oxygen-evolving enhancer protein 2 chloroplastic-...    273   6e-88    Phaseolus vulgaris [French bean]
gb|AAN77240.1|  PsbP                                                    272   1e-87    Xerophyta humilis
tpg|DAA59516.1|  TPA: hypothetical protein ZEAMMB73_927356              275   1e-87    
gb|AGV54655.1|  oxygen-evolving enhancer protein 2-2 chloroplast ...    271   6e-87    Phaseolus vulgaris [French bean]
ref|XP_002992976.1|  hypothetical protein SELMODRAFT_136349             268   2e-86    
ref|XP_002991817.1|  hypothetical protein SELMODRAFT_134339             267   6e-86    
gb|KDO44762.1|  hypothetical protein CISIN_1g025092mg                   265   1e-84    Citrus sinensis [apfelsine]
gb|KEH33650.1|  oxygen-evolving enhancer protein 2-1                    263   4e-84    Medicago truncatula
gb|ABQ41909.1|  23kDa polypeptide of the oxygen evolving complex ...    261   1e-83    Sonneratia alba
dbj|BAA08564.1|  23 kDa polypeptide of photosystem II                   259   3e-82    Oryza sativa Japonica Group [Japonica rice]
gb|ACS68649.1|  23 kDa polypeptide of the oxygen evolving complex...    256   1e-81    Sonneratia alba
gb|ABK55671.1|  chloroplast photosystem II oxygen-evolving comple...    252   4e-81    Cucumis sativus [cucumbers]
ref|XP_006417893.1|  hypothetical protein EUTSA_v10008504mg             253   4e-80    
emb|CAA41713.1|  photosystem II 23 kDa polypeptide                      245   3e-77    Nicotiana tabacum [American tobacco]
ref|XP_001771262.1|  predicted protein                                  246   5e-77    
ref|XP_001763729.1|  predicted protein                                  245   1e-76    
ref|XP_001765395.1|  predicted protein                                  239   2e-74    
ref|XP_001753947.1|  predicted protein                                  235   2e-73    
ref|NP_180637.3|  photosystem II subunit P-2                            210   4e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763489.1|  predicted protein                                  208   1e-63    
sp|P11471.1|PSBP_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    207   2e-62    Chlamydomonas reinhardtii
ref|XP_001694126.1|  oxygen-evolving enhancer protein 2 of photos...    207   8e-62    Chlamydomonas reinhardtii
ref|XP_002956365.1|  oxygen-evolving enhancer protein 2                 213   1e-58    Volvox carteri f. nagariensis
emb|CCM44238.1|  photosystem II subunit P                               197   2e-58    Chlamydomonas raudensis
emb|CEG02166.1|  Mog1/PsbP, alpha/beta/alpha sandwich                   197   2e-58    Ostreococcus tauri
gb|ABV57471.1|  chloroplast PsbP                                        190   2e-57    Phyllostachys edulis [kikko-chiku]
gb|ACD10926.1|  photosystem II oxygen evolving system 23 kDa subunit    189   4e-57    Lemna minor
ref|XP_002505689.1|  photosystem II oxygen-evolving complex 23 kD...    194   5e-57    Micromonas commoda
ref|XP_005649549.1|  photosystem II oxygen evolving complex prote...    192   3e-56    Coccomyxa subellipsoidea C-169
ref|XP_001422601.1|  oxygen evolving enhancer 2 of Photosystem II       192   3e-56    Ostreococcus lucimarinus CCE9901
gb|AFK45562.1|  unknown                                                 189   5e-56    Lotus japonicus
ref|XP_005649550.1|  oxygen evolving enhancer 2 of photosystem II       185   2e-53    Coccomyxa subellipsoidea C-169
ref|XP_007509854.1|  predicted protein                                  185   2e-53    Bathycoccus prasinos
ref|XP_003060004.1|  photosystem II oxygen-evolving complex 23 kD...    185   2e-53    Micromonas pusilla CCMP1545
ref|XP_011396200.1|  Oxygen-evolving enhancer protein 2, chloropl...    183   9e-53    Auxenochlorella protothecoides
gb|KIY95992.1|  hypothetical protein MNEG_11971                         184   7e-50    Monoraphidium neglectum
gb|KDO44766.1|  hypothetical protein CISIN_1g025092mg                   170   9e-49    Citrus sinensis [apfelsine]
gb|KIZ07080.1|  hypothetical protein MNEG_0869                          168   2e-47    Monoraphidium neglectum
gb|KDO44761.1|  hypothetical protein CISIN_1g025092mg                   166   5e-47    Citrus sinensis [apfelsine]
gb|KCW89790.1|  hypothetical protein EUGRSUZ_A02039                     165   2e-46    Eucalyptus grandis [rose gum]
gb|EAZ02734.1|  hypothetical protein OsI_24852                          160   1e-44    Oryza sativa Indica Group [Indian rice]
gb|AAP79210.1|  photosystem II protein PsbP                             154   4e-41    Bigelowiella natans
gb|AAP48993.1|  probable oxygen-evolving enhancer protein 2             146   2e-40    Vitis vinifera
gb|ACF24545.1|  photosystem II oxygen evolving enhancer protein 2       150   1e-39    Gymnochlora stellata
emb|CAA44291.1|  23-dDa polypeptide of Photosystem II oxygen-evol...    139   2e-37    Nicotiana tabacum [American tobacco]
ref|XP_006437084.1|  hypothetical protein CICLE_v10032502mg             139   9e-37    
gb|KDO44764.1|  hypothetical protein CISIN_1g025092mg                   140   1e-36    Citrus sinensis [apfelsine]
gb|ABS71999.1|  putative chloroplast photosystem II 23kDa protein       131   6e-35    Olea europaea
ref|XP_005844169.1|  hypothetical protein CHLNCDRAFT_139312             129   1e-32    Chlorella variabilis
ref|NP_001183682.1|  uncharacterized protein LOC100502276             93.2    9e-19    
dbj|BAH57013.1|  AT1G06680                                            81.6    4e-16    Arabidopsis thaliana [mouse-ear cress]
ref|WP_009554127.1|  PsbP protein                                     66.2    4e-10    Oscillatoriales cyanobacterium JSC-12
ref|XP_002279556.1|  PREDICTED: psbP-like protein 2, chloroplastic    64.7    4e-09    Vitis vinifera
emb|CCC15105.1|  oxygen-evolving enhancer protein 2                   63.9    4e-09    Lepidodinium chlorophorum
ref|XP_009612833.1|  PREDICTED: psbP-like protein 2, chloroplasti...  63.2    1e-08    Nicotiana tomentosiformis
ref|WP_041456005.1|  photosystem II oxygen evolving complex prote...  62.4    1e-08    Trichormus variabilis
gb|ABA20458.1|  Photosystem II oxygen evolving complex protein PsbP   62.4    1e-08    Trichormus variabilis ATCC 29413
ref|WP_044521617.1|  photosystem II oxygen evolving complex prote...  62.0    2e-08    Nostocaceae
ref|WP_040554030.1|  photosystem II oxygen evolving complex prote...  62.0    2e-08    
ref|XP_010067371.1|  PREDICTED: psbP-like protein 2, chloroplasti...  63.2    2e-08    Eucalyptus grandis [rose gum]
ref|XP_010067370.1|  PREDICTED: psbP-like protein 2, chloroplasti...  62.8    2e-08    
ref|WP_006276144.1|  Photosystem II oxygen evolving complex prote...  62.0    2e-08    Cylindrospermopsis
gb|EFA72028.1|  Photosystem II oxygen evolving complex protein PsbP   62.0    2e-08    Raphidiopsis brookii D9
ref|WP_024969103.1|  PsbP                                             61.2    3e-08    Microcystis
dbj|BAB74775.1|  all3076                                              62.4    3e-08    Nostoc sp. PCC 7120
ref|WP_002796693.1|  Photosystem II oxygen-evolving complex 23K p...  60.8    4e-08    Microcystis aeruginosa
gb|KDO67745.1|  hypothetical protein CISIN_1g026701mg                 62.0    4e-08    Citrus sinensis [apfelsine]
ref|XP_006436071.1|  hypothetical protein CICLE_v10032629mg           61.6    4e-08    Citrus clementina [clementine]
ref|WP_039715871.1|  PsbP                                             60.8    5e-08    
ref|XP_009762547.1|  PREDICTED: psbP-like protein 2, chloroplastic    61.2    5e-08    Nicotiana sylvestris
ref|WP_017291288.1|  hypothetical protein                             60.5    5e-08    Leptolyngbya boryana
ref|WP_015202023.1|  photosystem II oxygen evolving complex prote...  60.5    6e-08    Crinalium epipsammum
ref|WP_028083101.1|  photosystem II oxygen evolving complex prote...  60.5    6e-08    Dolichospermum circinale
ref|WP_002801162.1|  Photosystem II oxygen-evolving complex 23K p...  60.5    6e-08    Microcystis aeruginosa
ref|WP_008205525.1|  Genome sequencing data, contig C315              60.5    7e-08    Microcystis
ref|WP_002792247.1|  Photosystem II oxygen-evolving complex 23K p...  60.5    7e-08    Microcystis aeruginosa
ref|WP_016517298.1|  PsbP                                             60.5    7e-08    Microcystis aeruginosa
ref|WP_009632926.1|  PsbP                                             60.1    7e-08    Synechocystis sp. PCC 7509
ref|XP_006360615.1|  PREDICTED: psbP-like protein 2, chloroplasti...  60.8    7e-08    Solanum tuberosum [potatoes]
gb|AFZ03570.1|  photosystem II oxygen evolving complex protein PsbP   60.5    8e-08    Calothrix sp. PCC 6303
ref|WP_012265569.1|  photosystem II oxygen-evolving complex 23K p...  60.1    8e-08    Microcystis aeruginosa
dbj|BAH57265.1|  AT1G06680                                            43.9    8e-08    Arabidopsis thaliana [mouse-ear cress]
ref|WP_028089888.1|  photosystem II oxygen evolving complex prote...  60.1    8e-08    Dolichospermum circinale
ref|WP_041740865.1|  photosystem II oxygen evolving complex prote...  60.1    8e-08    Calothrix parietina
ref|XP_006360616.1|  PREDICTED: psbP-like protein 2, chloroplasti...  60.5    9e-08    
ref|XP_006574866.1|  PREDICTED: psbP-like protein 1, chloroplasti...  60.8    1e-07    Glycine max [soybeans]
ref|XP_003518660.2|  PREDICTED: psbP-like protein 1, chloroplasti...  60.8    1e-07    Glycine max [soybeans]
ref|WP_002789162.1|  Genome sequencing data, contig C315              59.7    1e-07    Microcystis aeruginosa
ref|WP_002758996.1|  Photosystem II oxygen-evolving complex 23K p...  59.7    1e-07    Microcystis aeruginosa
ref|WP_039201026.1|  photosystem II oxygen evolving complex prote...  59.7    1e-07    Aphanizomenon flos-aquae
ref|WP_002740438.1|  psbP protein                                     59.7    1e-07    Microcystis aeruginosa
ref|XP_009612834.1|  PREDICTED: psbP-like protein 2, chloroplasti...  60.5    1e-07    Nicotiana tomentosiformis
ref|WP_027404260.1|  photosystem II oxygen evolving complex prote...  59.3    1e-07    Aphanizomenon flos-aquae
ref|XP_003552675.1|  PREDICTED: uncharacterized LOC100305918          60.1    2e-07    Glycine max [soybeans]
ref|WP_011610056.1|  photosystem II oxygen evolving complex prote...  59.3    2e-07    Trichodesmium erythraeum
ref|WP_006104633.1|  PsbP                                             59.3    2e-07    Coleofasciculus chthonoplastes
ref|WP_002731843.1|  psbP protein                                     58.9    2e-07    Microcystis aeruginosa
gb|AFK34664.1|  unknown                                               59.7    2e-07    Lotus japonicus
ref|XP_004248685.1|  PREDICTED: psbP-like protein 2, chloroplastic    59.7    2e-07    Solanum lycopersicum
ref|WP_002783248.1|  Photosystem II oxygen-evolving complex 23K p...  58.9    2e-07    Microcystis aeruginosa
ref|WP_015132230.1|  photosystem II oxygen evolving complex prote...  58.5    3e-07    Calothrix sp. PCC 7507
ref|WP_035157088.1|  photosystem II oxygen evolving complex prote...  58.5    3e-07    Calothrix sp. 336/3
ref|WP_002775529.1|  Genome sequencing data, contig C315              58.5    3e-07    Microcystis aeruginosa
ref|XP_007142714.1|  hypothetical protein PHAVU_007G010700g           59.3    4e-07    Phaseolus vulgaris [French bean]
ref|WP_036535616.1|  hypothetical protein                             58.2    4e-07    Neosynechococcus sphagnicola
dbj|GAL95241.1|  photosystem II oxygen evolving complex protein PsbP  58.2    4e-07    Microcystis aeruginosa NIES-44
ref|WP_015083710.1|  photosystem II oxygen evolving complex prote...  57.8    5e-07    Anabaena sp. 90
ref|WP_015111000.1|  photosystem II oxygen evolving complex prote...  57.8    5e-07    Nostoc sp. PCC 7107
ref|WP_012411767.1|  photosystem II oxygen evolving complex prote...  57.8    5e-07    Nostoc punctiforme
ref|WP_019492722.1|  hypothetical protein                             57.8    5e-07    Calothrix sp. PCC 7103
ref|WP_002771776.1|  Genome sequencing data, contig C315              57.8    6e-07    Microcystis aeruginosa
ref|WP_004158165.1|  Genome sequencing data, contig C315              57.8    6e-07    Microcystis aeruginosa
ref|WP_015184008.1|  PsbP                                             57.4    7e-07    Microcoleus sp. PCC 7113
gb|KCW65501.1|  hypothetical protein EUGRSUZ_G02907                   58.5    8e-07    Eucalyptus grandis [rose gum]
ref|WP_044491972.1|  PsbP                                             57.4    8e-07    Moorea producens
gb|EGJ35475.1|  PsbP                                                  57.4    8e-07    Moorea producens 3L
gb|KJB60571.1|  hypothetical protein B456_009G317700                  57.0    1e-06    Gossypium raimondii
ref|WP_015153770.1|  photosystem II oxygen evolving complex prote...  57.0    1e-06    Chroococcidiopsis thermalis
ref|XP_011398169.1|  PsbP-like protein 1, chloroplastic               56.6    1e-06    Auxenochlorella protothecoides
ref|WP_037222275.1|  photosystem II oxygen evolving complex prote...  57.0    1e-06    
ref|XP_002531973.1|  Thylakoid lumenal 25.6 kDa protein, chloropl...  57.4    2e-06    Ricinus communis
ref|WP_023072460.1|  photosystem ii oxygen evolving complex protein   56.6    2e-06    Leptolyngbya sp. Heron Island J
ref|XP_009804509.1|  PREDICTED: psbP-like protein 1, chloroplastic    57.4    2e-06    Nicotiana sylvestris
ref|XP_007009492.1|  PsbP-like protein 2                              57.0    2e-06    
ref|WP_015117673.1|  PsbP                                             56.2    2e-06    Rivularia sp. PCC 7116
ref|XP_009616348.1|  PREDICTED: psbP-like protein 1, chloroplastic    57.0    2e-06    Nicotiana tomentosiformis
ref|WP_013189766.1|  photosystem II oxygen evolving complex prote...  56.2    2e-06    Trichormus azollae
dbj|BAD93863.1|  PSII-P protein                                       53.5    3e-06    Arabidopsis thaliana [mouse-ear cress]
gb|KJB60570.1|  hypothetical protein B456_009G317700                  57.0    3e-06    Gossypium raimondii
ref|WP_015140669.1|  PsbP                                             55.8    3e-06    Nostoc sp. PCC 7524
ref|WP_033365751.1|  photosystem II oxygen evolving complex prote...  55.8    3e-06    
ref|WP_015178250.1|  photosystem II oxygen evolving complex prote...  55.5    3e-06    Oscillatoria nigro-viridis
gb|KHG11813.1|  PsbP-like protein 1, chloroplastic                    56.6    3e-06    Gossypium arboreum [tree cotton]
ref|WP_017653270.1|  photosystem II oxygen evolving complex prote...  55.8    3e-06    Fortiea contorta
gb|KJB60573.1|  hypothetical protein B456_009G317700                  56.6    3e-06    Gossypium raimondii
ref|WP_015161669.1|  PsbP                                             55.5    4e-06    
gb|ADJ67185.1|  oxygen-evolving enhancer protein 2                    54.3    4e-06    
ref|WP_015210908.1|  PsbP                                             55.5    4e-06    
gb|ACU13830.1|  unknown                                               55.5    5e-06    
ref|XP_003057832.1|  predicted protein                                55.5    7e-06    
gb|AFK35875.1|  unknown                                               55.5    9e-06    
ref|WP_026098526.1|  PsbP                                             54.3    9e-06    
ref|XP_008233569.1|  PREDICTED: psbP-like protein 1, chloroplasti...  54.7    1e-05    
ref|XP_004497306.1|  PREDICTED: psbP-like protein 2, chloroplasti...  55.1    1e-05    
gb|KEH21888.1|  oxygen-evolving complex/thylakoid lumenal 25.6 kD...  55.1    1e-05    
ref|XP_006650258.1|  PREDICTED: psbP-like protein 1, chloroplasti...  53.9    1e-05    
ref|XP_007218285.1|  hypothetical protein PRUPE_ppa010690mg           54.7    1e-05    
ref|XP_008233568.1|  PREDICTED: psbP-like protein 1, chloroplasti...  54.7    2e-05    
ref|WP_017740576.1|  photosystem II oxygen evolving complex prote...  53.5    2e-05    
ref|XP_004236065.1|  PREDICTED: psbP-like protein 1, chloroplastic    54.7    2e-05    
ref|WP_013323866.1|  photosystem II oxygen evolving complex prote...  53.5    2e-05    
ref|XP_005848519.1|  hypothetical protein CHLNCDRAFT_13502            52.8    2e-05    
ref|XP_005651435.1|  Mog1p/PsbP-like protein                          52.8    2e-05    
ref|WP_029637277.1|  photosystem II oxygen evolving complex prote...  53.1    2e-05    
ref|XP_004149814.1|  PREDICTED: psbP-like protein 1, chloroplasti...  53.9    2e-05    
ref|NP_001239935.1|  uncharacterized protein LOC100813624             53.9    3e-05    
ref|WP_035139287.1|  photosystem II oxygen evolving complex prote...  53.5    3e-05    
gb|EAY78809.1|  hypothetical protein OsI_33912                        52.8    3e-05    
ref|WP_006635860.1|  photosystem II oxygen evolving complex prote...  52.8    3e-05    
ref|WP_017309667.1|  MULTISPECIES: photosystem II oxygen evolving...  53.1    3e-05    
ref|XP_006345107.1|  PREDICTED: psbP-like protein 1, chloroplasti...  53.9    3e-05    
ref|WP_015187674.1|  photosystem II oxygen evolving complex prote...  52.8    4e-05    
ref|WP_039744117.1|  photosystem II oxygen evolving complex prote...  52.8    4e-05    
ref|XP_010243166.1|  PREDICTED: psbP-like protein 2, chloroplasti...  53.1    4e-05    
ref|XP_007139268.1|  hypothetical protein PHAVU_008G015100g           53.5    4e-05    
ref|WP_015145076.1|  PsbP                                             52.4    5e-05    
ref|WP_041040089.1|  photosystem II oxygen evolving complex prote...  52.4    5e-05    
ref|WP_016952682.1|  photosystem II oxygen evolving complex prote...  52.4    5e-05    
gb|EPS69731.1|  hypothetical protein M569_05031                       53.1    6e-05    
emb|CDP00039.1|  unnamed protein product                              53.1    6e-05    
gb|KCW65494.1|  hypothetical protein EUGRSUZ_G02904                   53.1    6e-05    
ref|WP_015216462.1|  photosystem II oxygen evolving complex prote...  52.0    6e-05    
gb|KJB76058.1|  hypothetical protein B456_012G069100                  53.1    6e-05    
ref|WP_017320865.1|  photosystem II oxygen evolving complex prote...  52.0    6e-05    
gb|KHG00113.1|  PsbP-like protein 2, chloroplastic                    52.8    6e-05    
ref|XP_002531975.1|  Thylakoid lumenal 25.6 kDa protein, chloropl...  52.0    7e-05    
ref|XP_010243165.1|  PREDICTED: psbP-like protein 2, chloroplasti...  52.8    8e-05    
ref|XP_010554599.1|  PREDICTED: psbP-like protein 1, chloroplastic    52.4    8e-05    
gb|AFK35542.1|  unknown                                               52.4    9e-05    
ref|WP_006199039.1|  Photosystem II oxygen evolving complex prote...  51.6    9e-05    
gb|KEH44485.1|  photosystem II reaction center PsbP family protein    52.4    9e-05    
ref|XP_008371213.1|  PREDICTED: psbP-like protein 1, chloroplasti...  52.0    9e-05    
gb|KIE11036.1|  photosystem II oxygen evolving complex protein PsbP   51.6    1e-04    
ref|XP_003536772.1|  PREDICTED: psbP-like protein 2, chloroplasti...  52.4    1e-04    
ref|WP_026087703.1|  photosystem II oxygen evolving complex prote...  51.2    1e-04    
gb|AFK40517.1|  unknown                                               52.0    1e-04    
ref|XP_003083092.1|  photosystem II oxygen-evolving complex 23 kD...  52.4    1e-04    
gb|AAM93722.1|  putative oxygen evolving complex protein              51.2    1e-04    
ref|XP_008463515.1|  PREDICTED: psbP-like protein 1, chloroplastic    52.0    1e-04    
ref|XP_008371077.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.2    1e-04    
ref|WP_016859031.1|  photosystem II oxygen evolving complex prote...  51.6    1e-04    
ref|WP_009458976.1|  MULTISPECIES: photosystem II oxygen evolving...  51.2    1e-04    
ref|XP_011091485.1|  PREDICTED: psbP-like protein 2, chloroplastic    52.0    1e-04    
ref|WP_035992996.1|  PsbP                                             51.2    1e-04    
ref|WP_007353352.1|  MULTISPECIES: photosystem II oxygen evolving...  50.8    1e-04    
ref|XP_008371205.1|  PREDICTED: psbP-like protein 1, chloroplasti...  52.0    1e-04    
gb|ACJ84402.1|  unknown                                               52.0    1e-04    
ref|XP_009357669.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.6    1e-04    
ref|XP_011072964.1|  PREDICTED: psbP-like protein 1, chloroplastic    51.6    2e-04    
ref|XP_010067366.1|  PREDICTED: psbP-like protein 1, chloroplastic    51.6    2e-04    
gb|KDP37390.1|  hypothetical protein JCGZ_08401                       51.6    2e-04    
ref|XP_008371200.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.6    2e-04    
gb|EEC83439.1|  hypothetical protein OsI_28915                        51.6    2e-04    
ref|XP_008463498.1|  PREDICTED: psbP-like protein 2, chloroplasti...  51.2    2e-04    
ref|XP_009335896.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.6    2e-04    
ref|XP_008371069.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.2    2e-04    
gb|EAY78811.1|  hypothetical protein OsI_33914                        50.4    2e-04    
gb|ABG66118.1|  PsbP family protein, expressed                        51.6    2e-04    
gb|EEE68542.1|  hypothetical protein OsJ_27001                        51.2    2e-04    
ref|XP_009335895.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.2    2e-04    
ref|XP_009357667.1|  PREDICTED: psbP-like protein 1, chloroplasti...  51.2    3e-04    
gb|EYU18366.1|  hypothetical protein MIMGU_mgv1a012838mg              51.2    3e-04    
ref|WP_017297470.1|  hypothetical protein                             50.1    3e-04    
dbj|BAD03159.1|  oxygen evolving complex protein-like                 51.2    3e-04    
ref|XP_006844277.1|  hypothetical protein AMTR_s00145p00071320        51.2    3e-04    
gb|KDO67736.1|  hypothetical protein CISIN_1g025977mg                 50.8    4e-04    
gb|AAP54144.2|  PsbP family protein, expressed                        51.2    4e-04    
ref|XP_011469843.1|  PREDICTED: psbP-like protein 1, chloroplasti...  50.1    4e-04    
ref|XP_008463496.1|  PREDICTED: psbP-like protein 2, chloroplasti...  50.4    4e-04    
dbj|BAJ90241.1|  predicted protein                                    50.1    4e-04    
ref|XP_001757884.1|  predicted protein                                49.3    5e-04    
ref|XP_001418695.1|  lumenal PsbP-like protein                        50.1    5e-04    
dbj|BAJ93986.1|  predicted protein                                    50.1    5e-04    
gb|KIJ84038.1|  photosystem II oxygen evolving complex protein PsbP   49.3    5e-04    
gb|ABG66117.1|  PsbP family protein, expressed                        50.8    5e-04    
ref|XP_004492088.1|  PREDICTED: psbP-like protein 1, chloroplasti...  50.1    5e-04    
ref|XP_002315245.1|  photosystem 2 reaction center PsbP family pr...  50.1    6e-04    
gb|KHN20276.1|  PsbP-like protein 2, chloroplastic                    48.9    6e-04    
ref|XP_011027128.1|  PREDICTED: psbP-like protein 2, chloroplastic    50.1    6e-04    
ref|NP_001064776.1|  Os10g0461100                                     50.8    6e-04    
gb|ABG66119.1|  PsbP family protein, expressed                        50.8    6e-04    
ref|XP_004492089.1|  PREDICTED: psbP-like protein 1, chloroplasti...  50.1    7e-04    
ref|WP_015221481.1|  photosystem II oxygen evolving complex prote...  49.3    7e-04    
ref|XP_004308890.1|  PREDICTED: psbP-like protein 1, chloroplasti...  50.1    7e-04    
ref|XP_009414307.1|  PREDICTED: psbP-like protein 2, chloroplasti...  49.7    8e-04    
emb|CEF98710.1|  Twin-arginine translocation pathway, signal sequ...  48.9    8e-04    
ref|WP_026786540.1|  MULTISPECIES: PsbP                               48.9    9e-04    
gb|EMT01328.1|  PsbP-like protein 1, chloroplastic                    49.3    9e-04    
ref|XP_009414308.1|  PREDICTED: psbP-like protein 2, chloroplasti...  49.7    9e-04    
ref|WP_035998139.1|  PsbP                                             48.9    9e-04    
ref|WP_016869793.1|  photosystem II oxygen evolving complex prote...  48.9    9e-04    



>ref|XP_010093189.1| Oxygen-evolving enhancer protein 2 [Morus notabilis]
 gb|EXB53677.1| Oxygen-evolving enhancer protein 2 [Morus notabilis]
Length=264

 Score =   323 bits (827),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD T+N+ VLVTPTD
Sbjct  86   IFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDSTTNVAVLVTPTD  145

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPEEFL++VDYLLGKQAYSGKTDSEGGFD +AVATANILE+STPV+GGKQYY
Sbjct  146  KKSITDYGSPEEFLSKVDYLLGKQAYSGKTDSEGGFDSDAVATANILESSTPVIGGKQYY  205

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITASV +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  FLSVLTRTADGDEGGKHQLITASVKDGKLYICKAQAGDKRWFKGARKFVE  255



>ref|XP_010247826.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=260

 Score =   320 bits (820),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP+TGDGFKL VPSKWNPSKE+E+PGQVLRYEDNFD  SN+ V+VTPTDK
Sbjct  83   FGKPKTNTDFLPVTGDGFKLLVPSKWNPSKEIEYPGQVLRYEDNFDANSNVAVMVTPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+G+PEEFL++VDYLLGKQAY GKTDSEGGFDP+ VATANILETSTPVVGGKQYY+
Sbjct  143  KSITDFGAPEEFLSKVDYLLGKQAYFGKTDSEGGFDPDVVATANILETSTPVVGGKQYYY  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+ITA+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  203  LSVLTRTADGDEGGKHQIITATVSDGKLYICKAQAGDKRWFKGARKFVE  251



>gb|KHG20721.1| Oxygen-evolving enhancer 2-3, chloroplastic [Gossypium arboreum]
Length=271

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+P  G+GFKL +PSKWNPSKEVE+PGQVLRYEDNFD T+N+ V+VTPTDK
Sbjct  94   FGKPKTNTEFIPYNGEGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDSTTNVAVMVTPTDK  153

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE FL++VDYLLGKQAYSG TD+EGGFD NAVATANILETSTPV+GGKQYYF
Sbjct  154  KSITDFGSPENFLSKVDYLLGKQAYSGLTDAEGGFDSNAVATANILETSTPVIGGKQYYF  213

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+NGKLYICKAQAGDKRWFKGARKFVE
Sbjct  214  LSVLTRTADGDEGGKHQLITATVNNGKLYICKAQAGDKRWFKGARKFVE  262



>ref|XP_009407699.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=264

 Score =   319 bits (818),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPT K
Sbjct  87   FGKPKTNTDFLPYKGDGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDTTSNVAVMVTPTSK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SITDYGSPEEFL+QVDYLLGKQAYSGKTDSEGGFD +AVATANILETSTPV+ GK+YYF
Sbjct  147  SSITDYGSPEEFLSQVDYLLGKQAYSGKTDSEGGFDSDAVATANILETSTPVIDGKKYYF  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+VS GKLYICKAQAGDKRWFKGARKFVE
Sbjct  207  ISVLTRTADGDEGGKHQLITATVSGGKLYICKAQAGDKRWFKGARKFVE  255



>gb|KJB71514.1| hypothetical protein B456_011G126200 [Gossypium raimondii]
Length=295

 Score =   319 bits (818),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+P  G+GFKL +PSKWNPSKEVE+PGQVLRYEDNFD T+N+ V+VTPTDK
Sbjct  118  FGKPKTNTEFIPYNGEGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDSTTNVAVMVTPTDK  177

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE FL++VDYLLGKQAYSG TD+EGGFD NAVATANILETSTPV+GGKQYYF
Sbjct  178  KSITDFGSPENFLSKVDYLLGKQAYSGLTDAEGGFDSNAVATANILETSTPVIGGKQYYF  237

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+NGKLYICKAQAGDKRWFKGARKFVE
Sbjct  238  LSVLTRTADGDEGGKHQLITATVNNGKLYICKAQAGDKRWFKGARKFVE  286


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IG AAVG KVSPADAAYGEAANVF K + N   IP N
Sbjct  95   IGTAAVGSKVSPADAAYGEAANVFGKPKTNTEFIPYN  131



>ref|XP_010906959.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Elaeis guineensis]
Length=260

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+FL   GDGFKL VPSKWNPSKEVE+PGQV+RYEDNFD  S +CV+VTPT 
Sbjct  82   IFGKPKTNTDFLTYAGDGFKLMVPSKWNPSKEVEYPGQVMRYEDNFDSNSYVCVMVTPTS  141

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
             KSITDYGSPEEFL+QVDYLLGKQAY+GKTD+EGGFD +AVATANILE+STPVVGGKQYY
Sbjct  142  NKSITDYGSPEEFLSQVDYLLGKQAYAGKTDAEGGFDQDAVATANILESSTPVVGGKQYY  201

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +ISVLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  202  YISVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKFVE  251



>gb|KJB75386.1| hypothetical protein B456_012G039400 [Gossypium raimondii]
 gb|KJB75387.1| hypothetical protein B456_012G039400 [Gossypium raimondii]
Length=262

 Score =   311 bits (798),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+TEF+P  GDGFKL +PSKWNPSKEVEFPGQVLRYEDNFD TSN+ V++TPTDK
Sbjct  85   FGKPKTDTEFMPYNGDGFKLSIPSKWNPSKEVEFPGQVLRYEDNFDTTSNLSVMITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+ VDYLLGKQAY GKTDSEGGFD  AVATANILE+S+  VGGK YYF
Sbjct  145  KSITDYGSPEEFLSSVDYLLGKQAYFGKTDSEGGFDSGAVATANILESSSSTVGGKPYYF  204

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+NGKLYICKAQAGDKRWFKGARKFVE
Sbjct  205  LSVLTRTADGDEGGKHQLITATVNNGKLYICKAQAGDKRWFKGARKFVE  253



>ref|WP_039310993.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91170.1| hypothetical protein QW71_36210 [Paenibacillus sp. IHB B 3415]
Length=267

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+FLP  G+GF +Q+P+KWNPSKEVEFPGQVLRYEDNFD  SN+CV+VTPTD
Sbjct  89   IFGKPKTNTDFLPYIGNGFTVQIPAKWNPSKEVEFPGQVLRYEDNFDPNSNVCVMVTPTD  148

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITD+GSPE+FL++VDYLLGKQAYSGKT++EGGF+PN VATANILETSTPVVGGK YY
Sbjct  149  KKSITDFGSPEDFLSKVDYLLGKQAYSGKTEAEGGFEPNDVATANILETSTPVVGGKPYY  208

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
             ISVLTRTADGDEGGKHQLITA+VS  KLYICKAQAGDKRWFKGA+KFVE
Sbjct  209  IISVLTRTADGDEGGKHQLITATVSGSKLYICKAQAGDKRWFKGAKKFVE  258



>gb|KHG22094.1| Oxygen-evolving enhancer 2-1, chloroplastic [Gossypium arboreum]
Length=262

 Score =   310 bits (793),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F+P +GDGFKL +PSKWNPSKEVEFPGQVLRYEDNFD TSN+ V++TPTDK
Sbjct  85   FGKPKTDTDFMPYSGDGFKLSIPSKWNPSKEVEFPGQVLRYEDNFDTTSNLSVMITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+ VDYLLGKQAY GKTD+EGGFD  AVATANILE+S+  VGGK YYF
Sbjct  145  KSITDYGSPEEFLSSVDYLLGKQAYFGKTDAEGGFDSGAVATANILESSSSTVGGKPYYF  204

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+NGKLYICKAQAGDKRWFKGARKFVE
Sbjct  205  LSVLTRTADGDEGGKHQLITATVNNGKLYICKAQAGDKRWFKGARKFVE  253



>ref|XP_002521576.1| Oxygen-evolving enhancer protein 2, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40847.1| Oxygen-evolving enhancer protein 2, chloroplast precursor, putative 
[Ricinus communis]
Length=265

 Score =   308 bits (790),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F+P  GDGF+L VPSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  88   FGKPKTNTDFMPYNGDGFQLSVPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVMITPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+G+PEEFLA+VDYLLGKQAY GKT SEGGFDPNAVATANIL++ST VVGGK+YYF
Sbjct  148  KSITDFGTPEEFLAKVDYLLGKQAYFGKTASEGGFDPNAVATANILDSSTQVVGGKEYYF  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  208  LSVLTRTADGDEGGKHQLITAAVKDGKLYICKAQAGDKRWFKGARKFVE  256


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  65   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFMPYN  101



>ref|XP_008809743.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=259

 Score =   308 bits (788),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKT+T+FLPI+GDGFKL +PSKWNPSKEVEFPGQVLR+EDN D  SN+ V+VTPT 
Sbjct  81   IFGKPKTDTDFLPISGDGFKLMIPSKWNPSKEVEFPGQVLRFEDNLDSNSNVGVMVTPTT  140

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            K SITDYGSPEEFL+QVDYLLGKQAYSGKT SEGGFD +AVATANILE+STPVVGGK+YY
Sbjct  141  KSSITDYGSPEEFLSQVDYLLGKQAYSGKTVSEGGFDQDAVATANILESSTPVVGGKKYY  200

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
             ISVLTRTADGDEGGKHQLI A+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  201  NISVLTRTADGDEGGKHQLIIATVSDGKLYICKAQAGDKRWFKGARKFVE  250



>ref|XP_003532074.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Glycine max]
 gb|KHM99676.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=262

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VT TDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTATDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QVDYLLGKQA+ G+TD+EGGFD NAVATANILE+STPV+ GKQYY 
Sbjct  145  KSITDYGSPEEFLSQVDYLLGKQAFFGQTDAEGGFDSNAVATANILESSTPVIDGKQYYS  204

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLI A+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  205  LTVLTRTADGDEGGKHQLIAATVKDGKLYICKAQAGDKRWFKGARRFVE  253



>ref|XP_009419010.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=260

 Score =   306 bits (784),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD  SN+ V+VTPT K
Sbjct  83   FGKPKTNTDFLPYAGDGFKLMIPSKWNPSKEVEYPGQVLRYEDNFDSNSNVTVMVTPTTK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             +IT YG+PEEFL+QVDYLLGKQAYSGKTDSEGGFD +AVATANILET+T   GGK+YYF
Sbjct  143  STITGYGTPEEFLSQVDYLLGKQAYSGKTDSEGGFDSDAVATANILETTTQESGGKKYYF  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  203  VSVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKFVE  251



>ref|XP_002881132.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57391.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++TPTDK
Sbjct  85   FGKPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGKQYY+
Sbjct  145  KSITDYGSPEQFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKQYYY  204

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  205  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  253



>gb|KDP36279.1| hypothetical protein JCGZ_10289 [Jatropha curcas]
Length=264

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP +G+GFK+ +PSKWNPSKEVE+PGQVLRYEDNFD  SN+ V++ PTDK
Sbjct  87   FGKPKTNTDFLPYSGEGFKVLIPSKWNPSKEVEYPGQVLRYEDNFDSNSNLSVMIIPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFLAQV++LLGKQAY GKTDSEGGFDPNAVATANILET+TP + GKQYY 
Sbjct  147  KSITDYGSPEEFLAQVNFLLGKQAYFGKTDSEGGFDPNAVATANILETATPQINGKQYYS  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKH LITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  207  ITVLTRTADGDEGGKHLLITAAVKDGKLYICKAQAGDKRWFKGARKFVE  255



>gb|KHN28540.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=265

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FL   G+GFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VT TDK
Sbjct  88   FGKPKTNTDFLSYNGNGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTATDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QVDYLLGKQA+ G+TD+EGGFD NAVATANILE+STPVV GKQYY 
Sbjct  148  KSITDYGSPEEFLSQVDYLLGKQAFFGQTDAEGGFDSNAVATANILESSTPVVDGKQYYS  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  208  LTVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARRFVE  256



>ref|NP_001274949.1| oxygen-evolving enhancer protein 2, chloroplastic precursor [Solanum 
tuberosum]
 sp|P93566.1|PSBP_SOLTU RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
 emb|CAA67696.1| 23 kDa oxygen evolving protein of photosystem II [Solanum tuberosum]
Length=260

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP  GDGFKLQ+P+KWNPSKE+EFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  83   FGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAY GKTDSEGGF+  AVATAN+LE S+  VGGKQYY+
Sbjct  143  KSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATANLLEASSATVGGKQYYY  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  203  LSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  251


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKA-ENKHRIPAN  661
            IG AA+G KVSPADAAYGEAANVF K  EN   +P N
Sbjct  60   IGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYN  96



>ref|XP_006296023.1| hypothetical protein CARUB_v10025169mg [Capsella rubella]
 gb|EOA28921.1| hypothetical protein CARUB_v10025169mg [Capsella rubella]
Length=263

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++TPTDK
Sbjct  86   FGKPKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMITPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGKQYY+
Sbjct  146  KSITDYGSPEKFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKQYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>gb|AFK44592.1| unknown [Lotus japonicus]
Length=259

 Score =   305 bits (780),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  GDGFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++T TDK
Sbjct  82   FGKPKSNTDFLPYNGDGFKLSIPAKWNPSKEREFPGQVLRYEDNFDATSNVSVIITATDK  141

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+TDSEGGFD NAVA ANILE+S PVVGGKQYY 
Sbjct  142  KSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDANAVAVANILESSAPVVGGKQYYN  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+ITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  202  VSVLTRTADGDEGGKHQIITATVNDGKLYICKAQAGDKRWFKGARKFVE  250


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  59   IGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYN  95



>ref|XP_011100486.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
2, chloroplastic-like [Sesamum indicum]
Length=256

 Score =   304 bits (779),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F P TGDGFKL +PSKWNPS EVE+PGQVLRYEDNFD TSN+ V +TPTD
Sbjct  78   IFGKPKTNTDFKPYTGDGFKLSIPSKWNPSNEVEYPGQVLRYEDNFDATSNLTVTITPTD  137

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPE+FL+QVDYLLGKQAY GKTD+EGGFD   VATANILE STPVVGGKQYY
Sbjct  138  KKSITDYGSPEDFLSQVDYLLGKQAYFGKTDAEGGFDSGVVATANILEASTPVVGGKQYY  197

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKH LITA+V +GKLYICK QAGDKRWFKGAR++VE
Sbjct  198  FLSVLTRTADGDEGGKHLLITAAVKDGKLYICKVQAGDKRWFKGARRYVE  247



>ref|XP_002307570.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
 gb|ABK95873.1| unknown [Populus trichocarpa]
 gb|EEE94566.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
Length=262

 Score =   304 bits (779),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKT+T+FLP  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ V+V PTD
Sbjct  84   IFGKPKTDTDFLPYNGDGFKLSVPSKWNPSKEREFPGQVLRYEDNFDATSNVSVMVIPTD  143

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPEEFL++VD+LLGKQ+    T SEGGFDPN VATANILETSTPVVGGKQY+
Sbjct  144  KKSITDYGSPEEFLSKVDFLLGKQSSLFATASEGGFDPNTVATANILETSTPVVGGKQYF  203

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  253



>gb|AFK47979.1| unknown [Lotus japonicus]
Length=259

 Score =   304 bits (779),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  GDGFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++T TDK
Sbjct  82   FGKPKSNTDFLPYNGDGFKLSIPAKWNPSKEREFPGQVLRYEDNFDATSNVSVIITATDK  141

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+TDSEGGFD NAVA ANILE+S PVVGGKQYY 
Sbjct  142  KSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVVGGKQYYN  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+ITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  202  VSVLTRTADGDEGGKHQIITATVNDGKLYICKAQAGDKRWFKGARKFVE  250


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  59   IGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYN  95



>sp|O49080.1|PSBP_FRIAG RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04809.1| photosystem II oxygen evolving complex protein 2 precursor [Fritillaria 
agrestis]
Length=264

 Score =   304 bits (779),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+FLP TGDGF L +P+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPT K
Sbjct  87   FGKAKTNTDFLPYTGDGFNLLIPAKWNPSKEVEFPGQVLRYEDNFDVTSNVSVTVTPTSK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYG+PEEFL+ VDYLLGKQAYSGKT SEGGFDP++VATANILE STPVVGGKQYY 
Sbjct  147  KSITDYGTPEEFLSTVDYLLGKQAYSGKTASEGGFDPDSVATANILEVSTPVVGGKQYYN  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKH +I+A+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  207  ISVLTRTADGDEGGKHHVISATVTDGKLYICKAQAGDKRWFKGAKKFVE  255



>ref|XP_010054080.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Eucalyptus grandis]
 gb|KCW89789.1| hypothetical protein EUGRSUZ_A02039 [Eucalyptus grandis]
Length=262

 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GF L +P+KWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  85   FGKPKTNTDFLPYNGNGFTLLIPAKWNPSKEVEYPGQVLRYEDNFDTTSNVSVMVTPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITD+GSPE FLA+V+YLLGKQAY GKTDSEGGF+ +AVATANILE+STP +GGK+YYF
Sbjct  145  KAITDFGSPENFLAEVNYLLGKQAYFGKTDSEGGFESDAVATANILESSTPEIGGKKYYF  204

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITAS+ +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  205  VSVLTRTADGDEGGKHQLITASIKDGKLYICKAQAGDKRWFKGARKFVE  253


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  98



>ref|XP_004499534.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG+PKTNT+FLP  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ V+VT TDK
Sbjct  88   FGRPKTNTDFLPYNGDGFKLLVPSKWNPSKEREFPGQVLRYEDNFDATSNVSVMVTATDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPEEFL++VDYLLGKQ+Y G+TDSEGGFD NAVA ANILETS PV+GGKQYY 
Sbjct  148  KSITDFGSPEEFLSKVDYLLGKQSYFGQTDSEGGFDTNAVAVANILETSAPVIGGKQYYN  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  208  LSVLTRTADGDEGGKHQLIIATVNGGKLYICKAQAGDKRWFKGARKFVE  256



>ref|XP_011085433.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F P +G+GFKL +PSKWNPS EVEFPGQVLRYEDNFD TS + V + PTD
Sbjct  87   IFGKPKTNTDFKPYSGEGFKLSIPSKWNPSNEVEFPGQVLRYEDNFDATSYLTVTINPTD  146

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPE+FL++VDYLLGKQAY GKTDSEGGFD   VATANILETSTPVVGG QYY
Sbjct  147  KKSITDYGSPEDFLSKVDYLLGKQAYFGKTDSEGGFDSGVVATANILETSTPVVGGTQYY  206

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  207  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  256



>ref|XP_006366632.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=221

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP  GDGFKLQ+P+KWNPSKE+EFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  44   FGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFPGQVLRYEDNFDSTSNLMVAVTPTDK  103

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAY GKTDSEGGF+  AVATAN+LE S+  VGGKQYY+
Sbjct  104  KSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATANLLEASSATVGGKQYYY  163

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  164  LSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  212



>gb|EPS69373.1| hypothetical protein M569_05393, partial [Genlisea aurea]
Length=251

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F P TGDGFK+ +PSKWNPS E+EFPGQVLRYEDNFD TSN+ V + PTD
Sbjct  73   IFGKPKTNTDFRPYTGDGFKISIPSKWNPSGEIEFPGQVLRYEDNFDSTSNLTVTINPTD  132

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPE+FL+QVDYLLGKQAYSGKTDSEGGFD  AVATANILET+TP + GK+YY
Sbjct  133  KKSITDYGSPEDFLSQVDYLLGKQAYSGKTDSEGGFDSGAVATANILETATPEIDGKKYY  192

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLI A+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  193  FLSVLTRTADGDEGGKHQLIYAAVKDGKLYICKAQAGDKRWFKGARKFVE  242



>ref|XP_002889614.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65873.1| oxygen-evolving enhancer protein 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILE+S+  VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_007215827.1| hypothetical protein PRUPE_ppa010093mg [Prunus persica]
 gb|EMJ17026.1| hypothetical protein PRUPE_ppa010093mg [Prunus persica]
Length=264

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFKL +P+KWNPSKEVE+PGQVLRYEDNFD TSN+ V +TPTDK
Sbjct  87   FGKPKTNTDFLPYVGEGFKLSIPAKWNPSKEVEYPGQVLRYEDNFDTTSNVAVTITPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL +VDYLLGKQAY GKTDSEGGFD  AVATANILE+S+ VV GK YY+
Sbjct  147  KSITDYGSPEEFLTKVDYLLGKQAYFGKTDSEGGFDSGAVATANILESSSQVVDGKPYYY  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  207  LSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  255



>ref|XP_007048926.1| Photosystem II subunit P-1 [Theobroma cacao]
 gb|EOX93083.1| Photosystem II subunit P-1 [Theobroma cacao]
Length=268

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FL I GDGFKL +PSKWNPSKEVEFPGQV+RYEDNFD  S + V+VTPTDK
Sbjct  91   FGKPKTNTDFLTINGDGFKLSIPSKWNPSKEVEFPGQVVRYEDNFDPNSYVAVMVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FLA VDYLLGKQAY+G TD+EGGF+ NAVA ANI+++STPV+GG QYY 
Sbjct  151  KSITDFGSPEQFLANVDYLLGKQAYAGVTDAEGGFESNAVAVANIMDSSTPVIGGTQYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V NGKLYICKAQAGDKRWFKGARKFVE
Sbjct  211  VSVLTRTADGDEGGKHQLISATVKNGKLYICKAQAGDKRWFKGARKFVE  259



>ref|NP_001234109.1| oxygen-evolving enhancer protein 2, chloroplastic [Solanum lycopersicum]
 sp|P29795.1|PSBP_SOLLC RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA44736.1| photosystem II 23 kDa protein [Solanum lycopersicum]
Length=258

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP  GDGFKLQVP+KWNPSKEVE+PGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  81   FGKPKENTDFLPYNGDGFKLQVPAKWNPSKEVEYPGQVLRYEDNFDSTSNLIVAVTPTDK  140

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAY GKTDSEGGF+  AVAT N+LE S+  VGGK+YY+
Sbjct  141  KSITDYGSPEEFLSKVDYLLGKQAYFGKTDSEGGFESGAVATRNLLEASSATVGGKEYYY  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  201  LSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  249


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKA-ENKHRIPAN  661
            IG AA+G KVSPADAAYGEAANVF K  EN   +P N
Sbjct  58   IGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYN  94



>sp|Q40407.1|PSBP_NARPS RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Narcissus pseudonarcissus]
 emb|CAA55393.1| OEC 23kd protein [Narcissus pseudonarcissus]
Length=265

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F  +TGDGFK+ +PSKWNPSKEVEFPGQVLRYEDNFD TSN+ V+V PTDK
Sbjct  88   FGKPKTNTDFQTVTGDGFKILIPSKWNPSKEVEFPGQVLRYEDNFDTTSNVGVMVNPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPE+FL+QVDYLLGKQAY GKT SEGGF+PNAV TANILETSTPVVGGK YY 
Sbjct  148  KSIKDYGSPEQFLSQVDYLLGKQAYFGKTISEGGFEPNAVRTANILETSTPVVGGKDYYS  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I VLTRTADGDEGGKH LITA+VS+GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  208  IHVLTRTADGDEGGKHLLITATVSDGKLYICKAQAGDKRWFKGAKKFVE  256



>emb|CAA41712.1| photosystem II 23 kDa polypeptide [Nicotiana tabacum]
Length=261

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  84   FGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL QVD+LLGKQAY GKTDSEGGF+  AVATAN+LETS+  VGGK+YY 
Sbjct  144  KSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYI  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  LSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGARKFVE  252



>ref|XP_011026206.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Populus euphratica]
Length=262

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+FLP  GDGFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V+V PTD
Sbjct  84   IFGKPKTNTDFLPYNGDGFKLSIPAKWNPSKEREFPGQVLRYEDNFDATSNVSVMVIPTD  143

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPEEFL++VDYLLGKQ+    T SEGGFD N VATANILETSTPV+ GKQYY
Sbjct  144  KKSITDYGSPEEFLSKVDYLLGKQSSLFATSSEGGFDTNTVATANILETSTPVIDGKQYY  203

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  253



>ref|NP_172153.1| photosystem II subunit P-1 [Arabidopsis thaliana]
 sp|Q42029.2|PSBP1_ARATH RecName: Full=Oxygen-evolving enhancer protein 2-1, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Short=OEC23; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24829.1|AC007592_22 F12K11.3 [Arabidopsis thaliana]
 emb|CAA66785.1| 23 kDa polypeptide of oxygen-evolving comlex (OEC) [Arabidopsis 
thaliana]
 gb|AAL08272.1| At1g06680/F4H5_18 [Arabidopsis thaliana]
 gb|AAL49935.1| At1g06680/F4H5_18 [Arabidopsis thaliana]
 gb|AAL67005.1| putative 23 kDa polypeptide of oxygen-evolving comlex protein 
[Arabidopsis thaliana]
 gb|AAM20127.1| putative 23 kDa polypeptide of oxygen-evolving complex (OEC) 
[Arabidopsis thaliana]
 gb|AAM64856.1| 23 kDa polypeptide of oxygen-evolving comlex (OEC) [Arabidopsis 
thaliana]
 gb|AEE28022.1| photosystem II subunit P-1 [Arabidopsis thaliana]
Length=263

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLR+EDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILE+S+  VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|NP_001276136.1| oxygen-evolving enhancer protein 2, chloroplastic-like [Glycine 
max]
 gb|ACU18270.1| unknown [Glycine max]
Length=265

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FL   G+GFK  +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VT TDK
Sbjct  88   FGKPKTNTDFLSYNGNGFKPSIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTATDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QVDYLLGKQA+ G+TD+EGGFD NAVATANILE+STPVV GKQYY 
Sbjct  148  KSITDYGSPEEFLSQVDYLLGKQAFFGQTDAEGGFDSNAVATANILESSTPVVDGKQYYS  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  208  LTVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARRFVE  256



>ref|XP_009618672.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q7DM39.2|PSBP1_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-1, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
Length=268

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL QVD+LLGKQAY GKTDSEGGF+  AVATAN+LETS+  VGGK+YY 
Sbjct  151  KSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  211  LSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGARKFVE  259



>dbj|BAE71271.1| putative PSII-P protein [Trifolium pratense]
Length=261

 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+FLP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ V+V  TDK
Sbjct  84   FGKAKTNTDFLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVIVQTTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FLAQVDYLLGKQA+ G+TDSEGGFD NAVA A ILE+STPVVGGKQY+ 
Sbjct  144  KSITDYGSPEQFLAQVDYLLGKQAFFGQTDSEGGFDTNAVAVAKILESSTPVVGGKQYFN  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  ISVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  252


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            +GAAAVG KVSPADAAYGEAANVF KA+ N   +P N
Sbjct  61   LGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYN  97



>ref|XP_008229592.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Prunus mume]
Length=264

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFKL +P+KWNPSKEVE+PGQVLRYEDNFD TSN+ V +TPTDK
Sbjct  87   FGKPKTNTDFLPYVGEGFKLSIPAKWNPSKEVEYPGQVLRYEDNFDTTSNVAVTITPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYGSPEEFL +VDYLLGKQAY GKTDSEGGFD  AVATANILE+S+ VV GK YY+
Sbjct  147  KAITDYGSPEEFLTKVDYLLGKQAYFGKTDSEGGFDSGAVATANILESSSQVVDGKPYYY  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  207  LSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  255



>ref|XP_008380167.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Malus domestica]
Length=268

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  G+GFKL +P+KWNPSKEVEFPGQVLRYEDNFD  SN+ V +TPTDK
Sbjct  91   FGKPKSNTDFLPYVGEGFKLSIPAKWNPSKEVEFPGQVLRYEDNFDSNSNVSVTITPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFLA+VDYLLGKQAY GKT+SEGGFDP AVATANILE+S+ V+ GKQYY+
Sbjct  151  KSIADYGSPEEFLAKVDYLLGKQAYFGKTESEGGFDPGAVATANILESSSRVIDGKQYYY  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V +GKLYI KAQAGDKRWFKGARKFVE
Sbjct  211  VSVLTRTADGDEGGKHQLITATVKDGKLYILKAQAGDKRWFKGARKFVE  259



>ref|XP_006303580.1| hypothetical protein CARUB_v10011102mg [Capsella rubella]
 gb|EOA36478.1| hypothetical protein CARUB_v10011102mg [Capsella rubella]
Length=263

 Score =   301 bits (771),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F+P +GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKTNTDFMPYSGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL++S+  VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDSSSQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_011032754.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Populus euphratica]
Length=262

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKT+T+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD TSN+ V+V PTD
Sbjct  84   IFGKPKTDTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDATSNVSVMVIPTD  143

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPEEFL++VD+LLGKQ+    T SEGGFDPN VATANILETSTPV+GGKQY+
Sbjct  144  KKSITDYGSPEEFLSKVDFLLGKQSSLFATASEGGFDPNNVATANILETSTPVIGGKQYF  203

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARK+VE
Sbjct  204  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKYVE  253



>sp|P16059.1|PSBP_PEA RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33557.1| unnamed protein product [Pisum sativum]
 dbj|BAA02553.1| precursor for 23-kDa protein of photosystem II [Pisum sativum]
Length=259

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT++LP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ VLV  TDK
Sbjct  82   FGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDK  141

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+TDSEGGFD NAVA ANILE+S PV+GGKQYY 
Sbjct  142  KSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYYN  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  202  ISVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  250


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF KA+ N   +P N
Sbjct  59   IGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYN  95



>gb|ACJ84745.1| unknown [Medicago truncatula]
 gb|KEH33649.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=261

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+FLP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ VLV  TDK
Sbjct  84   FGKAKTNTDFLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+TDSEGGFD NAVA ANILE+S PV+GGKQY+ 
Sbjct  144  KSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYFN  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  ISVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  252


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            +GAAAVG KVSPADAAYGEAANVF KA+ N   +P N
Sbjct  61   LGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYN  97



>gb|AFK39738.1| unknown [Lotus japonicus]
Length=259

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  GDGFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++T TDK
Sbjct  82   FGKPKSNTDFLPYNGDGFKLSIPAKWNPSKEREFPGQVLRYEDNFDATSNVSVIITATDK  141

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T SEGGFD NAVA ANILE+S PVVGGKQYY 
Sbjct  142  KSITDYGSPEEFLSKVDYLLGKQAFFGQTYSEGGFDTNAVAVANILESSAPVVGGKQYYN  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+ITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  202  VSVLTRTADGDEGGKHQIITATVNDGKLYICKAQAGDKRWFKGARKFVE  250


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  59   IGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYN  95



>gb|ABY52939.1| chloroplast 23 kDa polypeptide of photosystem II [Oryza sativa 
Japonica Group]
Length=185

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  8    FGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTK  67

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPEEFLAQVD+LLGKQAYSGKTDSEGGF+ +AVATANILE+S PVVGGKQYY 
Sbjct  68   KTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVGGKQYYS  127

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  128  VTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  176



>ref|XP_009144275.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY10755.1| BnaA05g11810D [Brassica napus]
Length=263

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P  G+GFK+++PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V++TPTDK
Sbjct  86   FGKPKKNTDFMPYNGEGFKIEIPSKWNPSKEVEYPGQVLRYEDNFDATSNVSVMITPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+I DYGSPE+FL+QV YLLGKQAY G+T SEGGFD NAVATANILETST  VGGK+YY+
Sbjct  146  KTIADYGSPEQFLSQVSYLLGKQAYFGETASEGGFDANAVATANILETSTQEVGGKKYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_002300858.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
 gb|ABK95552.1| unknown [Populus trichocarpa]
 gb|EEE80131.1| photosystem II oxygen-evolving complex protein 2 precursor [Populus 
trichocarpa]
Length=262

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+FLP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ V+VTPTD
Sbjct  84   IFGKPKTNTDFLPYNGDGFKLSVPAKWNPSKEREFPGQVLRYEDNFDATSNLSVMVTPTD  143

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
             KSI DYGSPEEFL++VDYLLGKQ+    T SEGGFD N VATANILETSTPV+ GKQYY
Sbjct  144  TKSIADYGSPEEFLSKVDYLLGKQSSLFATSSEGGFDTNTVATANILETSTPVIDGKQYY  203

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVE  253



>ref|NP_001058863.1| Os07g0141400 [Oryza sativa Japonica Group]
 gb|AAC98778.1| 23 kDa polypeptide of photosystem II [Oryza sativa Japonica Group]
 dbj|BAC21393.1| probable photosystem II oxygen-evolving complex protein 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF20777.1| Os07g0141400 [Oryza sativa Japonica Group]
 gb|EAZ02732.1| hypothetical protein OsI_24850 [Oryza sativa Indica Group]
 gb|EAZ38656.1| hypothetical protein OsJ_23049 [Oryza sativa Japonica Group]
 dbj|BAG89433.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96904.1| unnamed protein product [Oryza sativa Japonica Group]
Length=254

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  77   FGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTK  136

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPEEFLAQVD+LLGKQAYSGKTDSEGGF+ +AVATANILE+S PVVGGKQYY 
Sbjct  137  KTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVGGKQYYS  196

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  197  VTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  245



>ref|NP_001117239.1| photosystem II subunit P-1 [Arabidopsis thaliana]
 gb|AEE28023.1| photosystem II subunit P-1 [Arabidopsis thaliana]
Length=219

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFK+QVP+KWNPSKE+E+PGQVLR+EDNFD TSN+ V+VTPTDK
Sbjct  42   FGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILE+S+  VGGK YY+
Sbjct  102  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYY  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  162  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  210



>gb|AGZ95660.1| photosystem II extrinsic subunit (chloroplast) (chloroplast) 
[Oryza sativa]
Length=254

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  77   FGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTK  136

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPEEFLAQVD+LLGKQAYSGKTDSEGGF+ +AVATANILE+S PVVGGKQYY 
Sbjct  137  KTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVGGKQYYS  196

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  197  VTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  245



>ref|XP_006410179.1| hypothetical protein EUTSA_v10017096mg [Eutrema salsugineum]
 dbj|BAJ34543.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51632.1| hypothetical protein EUTSA_v10017096mg [Eutrema salsugineum]
Length=263

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F+P  G+ FK+++PSKWNPSKEVE+PGQVLR+EDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKTNTDFMPYNGERFKIEIPSKWNPSKEVEYPGQVLRFEDNFDATSNVSVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGK+YY+
Sbjct  146  KAITDYGSPEQFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKKYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>gb|EYU43166.1| hypothetical protein MIMGU_mgv1a011987mg [Erythranthe guttata]
Length=264

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F P +G+GFK++VP+KWNPS E EFPGQVLRYEDNFD +SN+ V +TPTD
Sbjct  86   IFGKPKTNTDFKPYSGEGFKIEVPAKWNPSSEKEFPGQVLRYEDNFDASSNLSVTITPTD  145

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KK+ITDYGSPE+FL++VDYLLGKQAY GKTDSEGGF+  AVA+AN+LETSTPVVGG QYY
Sbjct  146  KKAITDYGSPEDFLSKVDYLLGKQAYFGKTDSEGGFESGAVASANVLETSTPVVGGTQYY  205

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  206  FLSVLTRTADGDEGGKHQLITAAVKDGKLYICKAQAGDKRWFKGAKKFVE  255



>ref|XP_007155967.1| hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris]
 gb|ESW27961.1| hypothetical protein PHAVU_003G2476001g, partial [Phaseolus vulgaris]
Length=180

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFK+ +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VT TDK
Sbjct  3    FGKPKTNTDFLPYNGNGFKISIPSKWNPSKEVEYPGQVLRYEDNFDTTSNVSVMVTATDK  62

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL++VDYLLGKQA+ G+TDSEGGFD NAVATANILE++TP + GK+YY 
Sbjct  63   KSITDYGSPEDFLSKVDYLLGKQAFFGQTDSEGGFDSNAVATANILESATPEIDGKKYYS  122

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  123  LSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARRFVE  171



>ref|XP_010414217.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD  SN+ V++TPTDK
Sbjct  86   FGKPKKNTDFMPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDAASNVSVMITPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGK YY+
Sbjct  146  KSITDYGSPEQFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_004491279.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL VPSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  88   FGKPKTNTDFLPFNGDGFKLSVPSKWNPSKEVEYKGQVLRYEDNFDSTSNVVVTVTPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL+QV+YLLGKQA+ G+T +EGGFDPN VATANILE+STPV+ GKQYY 
Sbjct  148  KSIIDYGSPEEFLSQVNYLLGKQAFFGETQAEGGFDPNVVATANILESSTPVIDGKQYYV  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+I A+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  208  LSVLTRTADGDEGGKHQIIRATVKDGKLYICKAQAGDKRWFKGARRFVE  256



>gb|KFK31259.1| hypothetical protein AALP_AA6G089000 [Arabis alpina]
Length=265

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   G+GFK+++PSKWNPSKEVE+PGQVLR+EDNFD TSN+ V+VTPTDK
Sbjct  88   FGKPKKNTDFLTYNGEGFKIEIPSKWNPSKEVEYPGQVLRFEDNFDATSNVSVMVTPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSP++FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGKQYY+
Sbjct  148  KSITDYGSPQKFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKQYYY  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  208  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  256



>ref|XP_010486454.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010457808.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010475408.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
isoform X1 [Camelina sativa]
Length=263

 Score =   299 bits (766),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL++S+  VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDSSSQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_010469798.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P TG+GFK+ +PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++TPTDK
Sbjct  86   FGKPKKNTDFMPYTGEGFKILIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMITPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGK YY+
Sbjct  146  KSITDYGSPEQFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETSTQEIGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_008793536.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=348

 Score =   302 bits (773),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F    G+GFKL +PSKWNPSKEVE+PGQV+R+EDNFD  S + V+VTPT 
Sbjct  170  IFGKPKTNTDFFSYNGNGFKLMIPSKWNPSKEVEYPGQVMRWEDNFDPNSYVAVMVTPTP  229

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPEEF++QVDYLLGKQAYSGKTD+EGGFD +AVATANILE+STPVVGGKQYY
Sbjct  230  KKSITDYGSPEEFISQVDYLLGKQAYSGKTDAEGGFDQDAVATANILESSTPVVGGKQYY  289

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +ISVLTRTADGDEGGKHQLI A+VS+GKLYICKAQAGDKRWFKG+RKFVE
Sbjct  290  YISVLTRTADGDEGGKHQLIMATVSDGKLYICKAQAGDKRWFKGSRKFVE  339



>pdb|2VU4|A Chain A, Structure Of Psbp Protein From Spinacia Oleracea At 
1.98 A Resolution
Length=190

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NTEF+P  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ VLV PTDK
Sbjct  13   FGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDK  72

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLGKQAY GKTDSEGGFD   VA+AN+LE+STPVV GKQYY 
Sbjct  73   KSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYS  132

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQ+I A+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  133  ITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAKKFVE  181



>gb|AFK45301.1| unknown [Medicago truncatula]
Length=261

 Score =   299 bits (765),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+FLP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ VLV  TDK
Sbjct  84   FGKAKTNTDFLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+TDSEGGFD NAVA ANILE+S PV+GGKQY+ 
Sbjct  144  KSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYFN  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDE GKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  ISVLTRTADGDESGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  252


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            +GAAAVG KVSPAD AYGEAANVF KA+ N   +P N
Sbjct  61   LGAAAVGSKVSPADTAYGEAANVFGKAKTNTDFLPYN  97



>ref|XP_010680144.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=265

 Score =   299 bits (765),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL VP+KWNPS+EVE+PGQVLR+EDNFD TSN+ V+VTPTDK
Sbjct  88   FGKPKTNTDFLPYNGDGFKLLVPAKWNPSREVEYPGQVLRFEDNFDATSNLTVMVTPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL++V+YLLGKQAY G+TDSEGGFD   VA+ANILETSTP V GKQYY 
Sbjct  148  KSITDYGSPEKFLSEVNYLLGKQAYFGQTDSEGGFDSGVVASANILETSTPEVDGKQYYS  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQ+ITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  208  VTVLTRTADGDEGGKHQIITATVKDGKLYICKAQAGDKRWFKGARKFVE  256


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  65   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  101



>ref|XP_009765610.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Nicotiana sylvestris]
 gb|AFH58004.1| chloroplast PsbP4 precursor [Nicotiana benthamiana]
Length=268

 Score =   299 bits (765),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKQNTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSIT YGSPEEFL+QVD+LLGKQAY GKTDSEGGF+  AVATAN+LE S   VGGK+YY 
Sbjct  151  KSITGYGSPEEFLSQVDFLLGKQAYFGKTDSEGGFESGAVATANLLEASNTTVGGKEYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  211  LSVLTRTADGDEGGKHQLISATVNDGKLYICKAQAGDKRWFKGARKFVE  259



>sp|P12302.1|PSBP_SPIOL RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
 emb|CAA29055.1| 23 kDa OEC protein [Spinacia oleracea]
 prf||1307179A luminal protein 23kD
Length=267

 Score =   299 bits (765),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NTEF+P  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ VLV PTDK
Sbjct  90   FGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDK  149

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLGKQAY GKTDSEGGFD   VA+AN+LE+STPVV GKQYY 
Sbjct  150  KSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYS  209

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQ+I A+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  210  ITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAKKFVE  258


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKA-ENKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K  +N   +P N
Sbjct  67   IGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYN  103



>pdb|4RTI|A Chain A, The Crystal Structure Of Psbp From Spinacia Oleracea
Length=186

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NTEF+P  GDGFKL VPSKWNPSKE EFPGQVLRYEDNFD TSN+ VLV PTDK
Sbjct  9    FGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDK  68

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLGKQAY GKTDSEGGFD   VA+AN+LE+STPVV GKQYY 
Sbjct  69   KSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYS  128

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQ+I A+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  129  ITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAKKFVE  177



>ref|XP_010486460.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
Length=219

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  42   FGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL++S+  VGGK YY+
Sbjct  102  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDSSSQDVGGKPYYY  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  162  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  210



>ref|XP_010457809.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
 ref|XP_010475409.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Camelina sativa]
Length=219

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P  GDGFK+QVP+KWNPSKE+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  42   FGKPKANTDFMPYNGDGFKVQVPAKWNPSKEIEYPGQVLRYEDNFDATSNLNVMVTPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL++S+  VGGK YY+
Sbjct  102  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDSSSQDVGGKPYYY  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  162  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  210



>emb|CAA44292.1| 23-kDa ploypeptide of photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=266

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  89   FGKPKQNTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  148

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSIT YGSPEEFL+QVD+LLGKQAY GKTDSEGGF+  AVATAN+LE S   VGGK+YY 
Sbjct  149  KSITGYGSPEEFLSQVDFLLGKQAYFGKTDSEGGFESGAVATANLLEASNTTVGGKEYYI  208

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  209  LSVLTRTADGDEGGKHQLISATVNDGKLYICKAQAGDKRWFKGARKFVE  257



>gb|AAC02750.1| photosystem II oxygen-evolving complex 23K protein, putative 
[Arabidopsis thaliana]
Length=257

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  689  PKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSI  510
            PK NT+FLP TG+GFK+Q+PSKWNPSKE+E+PGQVLR+EDNFD TSN+ V++TPTDKKSI
Sbjct  83   PKKNTDFLPYTGEGFKIQIPSKWNPSKEIEYPGQVLRFEDNFDATSNVSVMITPTDKKSI  142

Query  509  TDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISV  330
            TDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +GGK+YY++SV
Sbjct  143  TDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEIGGKEYYYLSV  202

Query  329  LTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            LTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  203  LTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  248



>gb|AGZ95659.1| photosystem II extrinsic subunit (chloroplast) [Nicotiana benthamiana]
Length=268

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKQNTDFMAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSIT YGSPEEFL+QVD+LLGKQAY GKTDSEGGF+  AVATAN+LE S   VGGK+YY 
Sbjct  151  KSITGYGSPEEFLSQVDFLLGKQAYFGKTDSEGGFESGAVATANLLEASNTTVGGKEYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  211  LSVLTRTADGDEGGKHQLISATVNDGKLYICKAQAGDKRWFKGARKFVE  259



>ref|XP_009356583.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=268

 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  G+GFKL +P+KWN SKEVE+PGQVLRYEDNFD  SN+ V +TPTDK
Sbjct  91   FGKPKSNTDFLPYVGEGFKLSIPAKWNRSKEVEYPGQVLRYEDNFDSNSNVAVTITPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY GKT+SEGGFDP AVATANILE+S+ VV GKQYY+
Sbjct  151  KSIADYGSPEEFLTKVDYLLGKQAYFGKTESEGGFDPGAVATANILESSSRVVDGKQYYY  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V +GKLYI KAQAGDKRWFKGARKFVE
Sbjct  211  ISVLTRTADGDEGGKHQLITATVKDGKLYILKAQAGDKRWFKGARKFVE  259



>ref|XP_009619867.1| PREDICTED: oxygen-evolving enhancer protein 2-3, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q04127.1|PSBP3_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-3, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA44293.1| 23-kDa polypeptide of photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=266

 Score =   296 bits (759),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  89   FGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  148

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETST  VGGKQYY+
Sbjct  149  KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSTAEVGGKQYYY  208

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +S+LTRTADG+EGGKHQL+TA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  209  LSILTRTADGNEGGKHQLVTATVNDGKLYICKAQAGDKRWFKGAKKFVE  257



>gb|EYU42856.1| hypothetical protein MIMGU_mgv1a011103mg [Erythranthe guttata]
Length=292

 Score =   297 bits (761),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 2/170 (1%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKTNT+F P  GDGFK+ +PSKWNPSKE EFPGQVLRYEDNF+ TSN+ V++TPTD
Sbjct  116  IFGKPKTNTDFKPYIGDGFKVSIPSKWNPSKEREFPGQVLRYEDNFNATSNLSVMITPTD  175

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITDYGSPE+FL+QVDYLLGKQ+Y GKTDSEGGFD    ATANILETSTPVV GKQYY
Sbjct  176  KKSITDYGSPEDFLSQVDYLLGKQSYFGKTDSEGGFDSG--ATANILETSTPVVEGKQYY  233

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            F+SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  234  FLSVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGAKKFVE  283



>gb|AFH58003.1| chloroplast PsbP3 precursor [Nicotiana benthamiana]
Length=268

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKQNTDFMAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSIT YGSPEEFL+QVD+LLGKQAY GKTDSEGGF+  AVA AN+LE S   VGGK+YY 
Sbjct  151  KSITGYGSPEEFLSQVDFLLGKQAYFGKTDSEGGFESGAVAAANLLEASNTTVGGKEYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  211  LSVLTRTADGDEGGKHQLISATVNDGKLYICKAQAGDKRWFKGARKFVE  259



>ref|XP_004147746.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004161551.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Cucumis sativus]
 sp|Q9SLQ8.1|PSBP_CUCSA RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; AltName: 
Full=OEC23; Flags: Precursor [Cucumis sativus]
 dbj|BAA89317.1| 23kDa polypeptide of the oxygen-evolving complex of photosystem 
II [Cucumis sativus]
 gb|KGN53510.1| Oxygen-evolving enhancer protein 2 [Cucumis sativus]
Length=263

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT++LP +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PTDK
Sbjct  86   FGKPKSNTDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI D+GSPEEFL++VDYLLGKQAY GKT SEGGFDP+AVATANILE +   V GK YYF
Sbjct  146  KSIKDFGSPEEFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATASNVNGKDYYF  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  VSVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  254



>ref|XP_003519527.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Glycine max]
 gb|KHN38354.1| Oxygen-evolving enhancer protein 2, chloroplastic [Glycine soja]
Length=258

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+FLP  GDGFKL +PSKWNPSKEVE+ GQV+RYEDNFD T+N+ V +TPTDK
Sbjct  81   FGKPKTDTDFLPYNGDGFKLSIPSKWNPSKEVEYTGQVVRYEDNFDSTTNVVVTITPTDK  140

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANILET+TPV+ GK YYF
Sbjct  141  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANILETATPVIDGKPYYF  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKH +I A+V +GKL+ICKAQAGDKRWFKGAR+FVE
Sbjct  201  LSVLTRTADGDEGGKHHIIRATVKDGKLFICKAQAGDKRWFKGARRFVE  249



>ref|XP_003545316.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic-like 
[Glycine max]
 gb|ACJ61477.1| oxygen-evolving enhancer protein 2 [Glycine max]
 gb|KHN11997.1| Oxygen-evolving enhancer protein 2-2, chloroplastic [Glycine 
soja]
Length=264

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+FLP  GDGFKL +PSKWNPSKEVE+ GQV+RYEDNFD T+N+ V +TPTDK
Sbjct  87   FGKPKTDTDFLPYNGDGFKLSIPSKWNPSKEVEYTGQVVRYEDNFDSTTNVVVTITPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANILET+TPV+ GK YYF
Sbjct  147  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANILETATPVIDGKPYYF  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKH +I A+V +GKL+ICKAQAGDKRWFKGAR+FVE
Sbjct  207  LSVLTRTADGDEGGKHHIIRATVKDGKLFICKAQAGDKRWFKGARRFVE  255



>ref|XP_004965800.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Setaria italica]
Length=260

 Score =   295 bits (754),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+  +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V+V PT K
Sbjct  83   FGKPKANTDFIAYSGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVMVQPTTK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPE+FLAQVDYLLGKQAYSGKTDSEGGF+ +AVATANILE+S PVV GKQYY 
Sbjct  143  KTITEFGSPEQFLAQVDYLLGKQAYSGKTDSEGGFETDAVATANILESSAPVVDGKQYYS  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARK VE
Sbjct  203  VSVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKGVE  251



>ref|XP_010557156.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic 
[Tarenaya hassleriana]
Length=263

 Score =   295 bits (754),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+FL  +G+GFKLQ+PSKWNPSKEVE+PGQVLRYEDNFD TS + V+VTP+DK
Sbjct  86   FGKPKTDTDFLAYSGEGFKLQIPSKWNPSKEVEYPGQVLRYEDNFDATSYVTVMVTPSDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQ++ G+TDSEGGFD NAVATANIL+TST  VGGKQYY+
Sbjct  146  KSITDYGSPEQFLSQVNYLLGKQSFFGQTDSEGGFDGNAVATANILDTSTQDVGGKQYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADG+EGGKHQLI A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  LTVLTRTADGNEGGKHQLIAATVNGGKLYICKAQAGDKRWFKGARKFVE  254



>emb|CDP17859.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+++P  G GFKL +PSKWNPSKEVEFPGQVLRYEDNFD  S++ V++ P DK
Sbjct  86   FGKPKTNTDYIPYNGAGFKLSIPSKWNPSKEVEFPGQVLRYEDNFDSNSSVSVIIIPCDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYG PEEFL++VDYLLGKQ Y+GKT++EGGF+PN VATANILE  TP+V GKQYY 
Sbjct  146  KSITDYGPPEEFLSKVDYLLGKQVYAGKTEAEGGFEPNTVATANILEQETPIVNGKQYYV  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLI A+VS+GKLYICKAQAGDKRWFKGARK++E
Sbjct  206  ISVLTRTADGDEGGKHQLIRATVSDGKLYICKAQAGDKRWFKGARKYIE  254


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   IP N
Sbjct  63   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDYIPYN  99



>ref|XP_006658268.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=340

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  163  FGKPKTNTEFISYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNLSVMINPTTK  222

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPEEFLAQVDYLLGKQAY+GKTDSEGGF+ +AVATANILE+S PV+GGKQYY 
Sbjct  223  KTITEFGSPEEFLAQVDYLLGKQAYAGKTDSEGGFESDAVATANILESSAPVIGGKQYYS  282

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V++GKL+ICKAQAGDKRWFKGARKFVE
Sbjct  283  VTVLTRTADGDEGGKHQLITATVNDGKLFICKAQAGDKRWFKGARKFVE  331



>ref|XP_004303902.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=264

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPKT+T+FLP  G+GFK+ +P+KWNPSKEVEFPGQVLRYEDNFD TSN+ V + PTD
Sbjct  86   IFGKPKTSTDFLPYAGEGFKVSIPAKWNPSKEVEFPGQVLRYEDNFDVTSNLTVTINPTD  145

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KKSITD+GSPE+FL QVDYLLGKQAY GKTDSEGGFD  AVATANILE+ST  + GK YY
Sbjct  146  KKSITDFGSPEQFLTQVDYLLGKQAYFGKTDSEGGFDSGAVATANILESSTQTIDGKPYY  205

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            FISVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  206  FISVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGAKKFVE  255



>ref|XP_008451840.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Cucumis melo]
Length=263

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT++LP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PTDK
Sbjct  86   FGKPKTNTDYLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+I D+GSPE+FL++VDYLLGKQAY GKT SEGGFDP+AVATANILE +   V GK YYF
Sbjct  146  KTIKDFGSPEDFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATESNVNGKDYYF  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  206  ISVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKFVE  254



>pdb|1V2B|A Chain A, Crystal Structure Of Psbp Protein In The Oxygen-Evolving 
Complex Of Photosystem Ii From Higher Plants
 pdb|1V2B|B Chain B, Crystal Structure Of Psbp Protein In The Oxygen-Evolving 
Complex Of Photosystem Ii From Higher Plants
Length=177

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = -2

Query  695  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  516
            GKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDKK
Sbjct  1    GKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDKK  60

Query  515  SITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFI  336
            SITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETST  VGGKQYY++
Sbjct  61   SITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSTAEVGGKQYYYL  120

Query  335  SVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            S+LTRTADG+EGGKHQL+TA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  121  SILTRTADGNEGGKHQLVTATVNDGKLYICKAQAGDKRWFKGAKKFVE  168



>gb|KFK42985.1| hypothetical protein AALP_AA1G064500 [Arabis alpina]
Length=260

 Score =   294 bits (752),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   TGDGFK+QVP+KWNPS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  83   FGKPKANTDFTAYTGDGFKVQVPAKWNPSREIEYPGQVLRYEDNFDATSNLNVMVTPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILE+S   VGGK YY+
Sbjct  143  KSITDYGSPEQFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSAQEVGGKPYYY  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  203  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  251



>dbj|BAA96364.1| oxygen evolving enhancer protein 2 [Bruguiera gymnorhiza]
Length=160

 Score =   290 bits (743),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  695  GKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKK  516
            GKPK NT+FLP  GDGFKLQ+PSKWNPSKEVEFPGQVLRYEDNFD  S++ V++TPTDKK
Sbjct  1    GKPKENTDFLPYDGDGFKLQIPSKWNPSKEVEFPGQVLRYEDNFDSNSSVSVIITPTDKK  60

Query  515  SITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFI  336
            SITDYGSPE+FL+QVD+LLGKQAY+GKT++EGGFDP+ VATANILE++TPV+GGKQYYF+
Sbjct  61   SITDYGSPEQFLSQVDFLLGKQAYAGKTEAEGGFDPDVVATANILESATPVIGGKQYYFL  120

Query  335  SVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWF  216
            SVLTRTADGDEGGKHQLITA+V +GKLYICKAQAGDKRWF
Sbjct  121  SVLTRTADGDEGGKHQLITAAVKDGKLYICKAQAGDKRWF  160



>emb|CDY15587.1| BnaA08g28710D [Brassica napus]
Length=261

 Score =   294 bits (752),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  84   FGKPKTNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  144  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYY  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  204  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  252



>gb|AFH58002.1| chloroplast PsbP2 precursor [Nicotiana benthamiana]
Length=265

 Score =   294 bits (753),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  88   FGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETS+  VGGK YY+
Sbjct  148  KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYY  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+V+NGKLYICKAQAGDKRWFKGA+KFVE
Sbjct  208  LSVLTRTADGNEGGKHQLITATVNNGKLYICKAQAGDKRWFKGAKKFVE  256



>emb|CDY06657.1| BnaA10g04360D [Brassica napus]
Length=263

 Score =   294 bits (752),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F P +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTPYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNVSDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>ref|XP_006417894.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
 dbj|BAJ34178.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36247.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
Length=263

 Score =   294 bits (752),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGFK+QVP+KWNPS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKANTDFTAYSGDGFKVQVPAKWNPSREIEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDANAVATANILETNVQEVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>emb|CDX86515.1| BnaC08g01880D [Brassica napus]
Length=261

 Score =   293 bits (751),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F    GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  84   FGKPKTNTDFTAYNGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  144  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYY  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  204  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  252



>emb|CDY10216.1| BnaC05g04590D [Brassica napus]
Length=263

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F P  GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTPYNGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNVQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>ref|XP_008342330.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Malus domestica]
Length=268

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+FLP  G GFKL +P+KWNPSKEVE+PGQVLRYEDNFD T+N+ V +TPTDK
Sbjct  91   FGKPKSNTDFLPYVGKGFKLSIPAKWNPSKEVEYPGQVLRYEDNFDTTTNVAVTITPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYG PE FL QVDYLLGKQAY GKTDSEGGFD  AVATANILE+S+ VV GKQYY+
Sbjct  151  KSIGDYGPPEGFLTQVDYLLGKQAYFGKTDSEGGFDSGAVATANILESSSQVVDGKQYYY  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V +GKLYI KAQAGDKRWFKGARKFVE
Sbjct  211  ISVLTRTADGDEGGKHQLITATVKDGKLYILKAQAGDKRWFKGARKFVE  259



>ref|XP_009769223.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769224.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769225.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009769226.1| PREDICTED: oxygen-evolving enhancer protein 2-2, chloroplastic 
[Nicotiana sylvestris]
 sp|P18212.2|PSBP2_TOBAC RecName: Full=Oxygen-evolving enhancer protein 2-2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA39039.1| photosystem II 23kDa polypeptide [Nicotiana tabacum]
Length=265

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  88   FGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETS+  VGGK YY+
Sbjct  148  KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYY  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  208  LSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  256



>emb|CAA68801.1| 23 kD subunit [Sinapis alba]
 prf||1506342A O2 evolving complex 23kD protein
Length=248

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  71   FGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  130

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  131  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYY  190

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  191  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  239



>sp|P11594.2|PSBP_SINAL RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Sinapis alba]
 emb|CAA35081.1| oxygen-evolving complex of photosystem II [Sinapis alba]
Length=260

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  83   FGKPKKNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  143  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYY  202

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  203  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  251



>gb|ADQ00373.1| oxygen-evolving enhancer protein 2 [Sequoia sempervirens]
Length=261

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK NT+F+  +G+GFK+ +P+KWNPSKEVE+PGQVLRYEDNFD  SN+ V+VTPTDK
Sbjct  84   FGAPKKNTDFITYSGEGFKILIPAKWNPSKEVEYPGQVLRYEDNFDGNSNVSVMVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITD+GSP+EFL+QVDYLLGKQAYSGKT SEGGFD NAVATA +LE+  PVV GKQYY 
Sbjct  144  KNITDFGSPQEFLSQVDYLLGKQAYSGKTASEGGFDTNAVATAALLESGNPVVNGKQYYT  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+VS+GKLY+CKAQAGDKRWFKGARKFVE
Sbjct  204  LSVLTRTADGDEGGKHQLISATVSDGKLYVCKAQAGDKRWFKGARKFVE  252



>gb|ACU23674.1| unknown [Glycine max]
Length=264

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+FLP  GDGFKL +PSKWNPSKEVE+ GQV+RYEDNFD T+N+ V +TPTDK
Sbjct  87   FGKPKTDTDFLPYNGDGFKLSIPSKWNPSKEVEYTGQVVRYEDNFDSTTNVVVTITPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGS EEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANILET+TPV+ GK YYF
Sbjct  147  KSITDYGSSEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANILETATPVIDGKPYYF  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKH +I A+V +GKL+ICKAQAGDKRWFKGAR+FVE
Sbjct  207  LSVLTRTADGDEGGKHHIIRATVKDGKLFICKAQAGDKRWFKGARRFVE  255



>pdb|4RTH|A Chain A, The Crystal Structure Of Psbp From Zea Mays
 pdb|4RTH|B Chain B, The Crystal Structure Of Psbp From Zea Mays
Length=186

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K NT+F+   GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  9    FGKTKKNTDFISYVGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPTSK  68

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT+YGSPEEFL+QVDYLLGKQAY GKTDSEGGF+ +AVATAN+LE+STPVV GKQYY 
Sbjct  69   KAITEYGSPEEFLSQVDYLLGKQAYGGKTDSEGGFETDAVATANVLESSTPVVDGKQYYS  128

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARK VE
Sbjct  129  ITVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKGVE  177



>sp|Q96334.1|PSBP_BRAJU RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor, partial [Brassica juncea]
 emb|CAA70099.1| 23kD protein of oxygen evolving system of photosystem II [Brassica 
juncea]
Length=217

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F  I GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  40   FGKPKTNTDFTAINGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  99

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T  EGGFD NAVATANILET+   VGGK YY+
Sbjct  100  KSITDYGSPEEFLSQVNYLLGKQAYFGETACEGGFDNNAVATANILETNIQDVGGKPYYY  159

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTAD DEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  160  LSVLTRTADEDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  208



>emb|CAA45699.1| 23 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=268

 Score =   291 bits (746),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKKNTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAV--ATANILETSTPVVGGKQY  345
            KSITDYGSPEEFL QVD+LLGKQAY  KTDSEGGF+  AV  ATAN+LETS+  VGGK+Y
Sbjct  151  KSITDYGSPEEFLTQVDFLLGKQAY--KTDSEGGFESGAVATATANLLETSSSTVGGKEY  208

Query  344  YFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            Y +SVLTRTADGDEGGKHQLI+A+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  209  YILSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGARKFVE  259



>gb|KDO44763.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=258

 Score =   291 bits (745),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 149/169 (88%), Gaps = 4/169 (2%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAYSGKT SEGGFDP+AVATANILE S        YYF
Sbjct  145  KSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYF  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V  GKLYICKAQAGDKRWFKG RK+VE
Sbjct  201  LSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVE  249



>ref|XP_002461438.1| hypothetical protein SORBIDRAFT_02g002690 [Sorghum bicolor]
 gb|EER97959.1| hypothetical protein SORBIDRAFT_02g002690 [Sorghum bicolor]
Length=261

 Score =   291 bits (745),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTE++   GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  84   FGKPKTNTEYIAYNGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPTSK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT+YGSPEEFL+QVD+LLGKQA+ G TDSEGGF+  AVATAN+LE+STPVV GKQYY 
Sbjct  144  KTITEYGSPEEFLSQVDFLLGKQAFGGSTDSEGGFETGAVATANVLESSTPVVDGKQYYS  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARK VE
Sbjct  204  VSVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKGVE  252



>emb|CAA45700.1| 23 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=205

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  28   FGKAKTNTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  87

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETS+  VGGK YY+
Sbjct  88   KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVGGKPYYY  147

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+V++GKLYICKAQAGDKRW KGA+KFVE
Sbjct  148  LSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWLKGAKKFVE  196



>ref|XP_006843560.1| hypothetical protein AMTR_s00007p00081670 [Amborella trichopoda]
 gb|ERN05235.1| hypothetical protein AMTR_s00007p00081670 [Amborella trichopoda]
Length=276

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +P+KWNPSKEVEFPGQVLRYEDNFD  S + V+VTP  K
Sbjct  85   FGKPKTNTDFLPYNGDGFKLLIPAKWNPSKEVEFPGQVLRYEDNFDPNSYVSVMVTPNSK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT+YGSPEEFLAQVDYLLGKQ + GKTD+EGGF+P+AVATANILET+TP + GK+YY 
Sbjct  145  KTITEYGSPEEFLAQVDYLLGKQNF-GKTDAEGGFEPDAVATANILETATPEIDGKKYYS  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLI A+VS+GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  ISVLTRTADGDEGGKHQLIIATVSDGKLYICKAQAGDKRWFKGARKFVE  252



>ref|XP_009110976.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Brassica rapa]
Length=261

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F   +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  84   FGKPKTNTDFTAYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  144  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNIQDVGGKPYYY  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRW KGA KF+E
Sbjct  204  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWVKGANKFLE  252



>ref|XP_006437083.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
 ref|XP_006485001.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR50323.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
Length=258

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 149/169 (88%), Gaps = 4/169 (2%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAYSGKT SEGGFDP+AVATANILE S        YYF
Sbjct  145  KSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYF  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V  GKLYICKAQAGDKRWFKG RK+VE
Sbjct  201  LSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVE  249



>ref|XP_008652004.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Zea mays]
 tpg|DAA59517.1| TPA: hypothetical protein ZEAMMB73_927356 [Zea mays]
Length=303

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPK +TE++  +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT 
Sbjct  125  VFGKPKASTEYIAYSGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPTS  184

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            KK+I DYGSPEEFL+QVDYLLG+QAY GKTDSEGGF+  AVATAN+LE+STPV+ GKQYY
Sbjct  185  KKTIADYGSPEEFLSQVDYLLGRQAYGGKTDSEGGFETGAVATANVLESSTPVIDGKQYY  244

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
             +SVLTRTADGDEGGKHQLI A+VS+GKLYICKAQAGDKRWFKGARK VE
Sbjct  245  AVSVLTRTADGDEGGKHQLIAATVSDGKLYICKAQAGDKRWFKGARKGVE  294



>gb|ABQ85433.1| 23 kDa OEC protein, partial [Salicornia veneta]
Length=202

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK +TEF    GDGFKL VPSKWN SKEVE+PGQVLR+EDNFD TSN+ V+V+ TDK
Sbjct  25   FGKPKKDTEFSSYNGDGFKLLVPSKWNKSKEVEYPGQVLRFEDNFDATSNLAVMVSSTDK  84

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL QVDYLLGKQAY GKTDSEGGFD   VA+AN+LE+STPV+ GKQYY 
Sbjct  85   KSITDFGSPEQFLGQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVIDGKQYYS  144

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQ+ITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  145  ITVLTRTADGDEGGKHQIITATVKDGKLYICKAQAGDKRWFKGARKFVE  193



>tpg|DAA42743.1| TPA: hypothetical protein ZEAMMB73_321092 [Zea mays]
Length=258

 Score =   289 bits (740),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K NT+F+   GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  81   FGKTKKNTDFISYVGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPTSK  140

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT+YGSPEEFL+QVDYLLGKQAY GKTDSEGGF+ +AVATAN+LE+STPVV GKQYY 
Sbjct  141  KAITEYGSPEEFLSQVDYLLGKQAYGGKTDSEGGFETDAVATANVLESSTPVVDGKQYYS  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+VS+GKLYICKAQAGDKRWFKGARK VE
Sbjct  201  ITVLTRTADGDEGGKHQLITATVSDGKLYICKAQAGDKRWFKGARKGVE  249



>gb|AFH58001.1| chloroplast PsbP1 precursor [Nicotiana benthamiana]
Length=265

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  88   FGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETS+  V GK YY+
Sbjct  148  KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVIGKPYYY  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  208  LSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  256



>ref|XP_010543054.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
2, chloroplastic, partial [Tarenaya hassleriana]
Length=286

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+++FL   G+GFKLQ+PSKWNPSKEVE+PGQVL YEDNFD T+N+ V+VTP+DK
Sbjct  109  FGKPKTDSDFLAYNGEGFKLQIPSKWNPSKEVEYPGQVLNYEDNFDATNNVTVMVTPSDK  168

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI+DYG PEEFL+QV+YLLGKQ++ G+T SEGGFD NAVATANIL+TS+  VGGKQYY+
Sbjct  169  KSISDYGPPEEFLSQVNYLLGKQSFFGETASEGGFDGNAVATANILDTSSQDVGGKQYYY  228

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+++NGKLY+CKAQAGDKRWFKGARKFVE
Sbjct  229  LSVLTRTADGEEGGKHQLITATINNGKLYVCKAQAGDKRWFKGARKFVE  277



>ref|XP_009119039.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Brassica rapa]
Length=263

 Score =   288 bits (738),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F P +GDGF++QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTPYSGDGFQVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEE L+QV+YLLGKQAY G+T SEGGFD NAVATANILET+   VGGK YY+
Sbjct  146  KSITDYGSPEEVLSQVNYLLGKQAYFGETASEGGFDNNAVATANILETNVSDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRW KGA KF+E
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWVKGANKFLE  254



>gb|AAX53162.1| chloroplast photosynthetic oxygen-evolving protein 23 kDa subunit 
[Nicotiana benthamiana]
Length=261

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKT+T+F    GDGFKLQ+PSKWNP+KEVE+PGQVLR+EDNFD TSN+ V +TPTDK
Sbjct  84   FGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYPGQVLRFEDNFDATSNVIVAITPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL+QVDYLLG+QAYSGKTDSEGGF+ +AVA AN+LETS+  V GK YY+
Sbjct  144  KSITDFGSPEQFLSQVDYLLGRQAYSGKTDSEGGFESDAVAIANVLETSSAEVIGKPYYY  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG+EGGKHQLITA+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  204  LSVLTRTADGNEGGKHQLITATVNDGKLYICKAQAGDKRWFKGAKKFVE  252



>ref|XP_009118485.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=263

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL+T+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDTNIQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>emb|CDY06222.1| BnaA09g49810D [Brassica napus]
Length=263

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL+T+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDTNIQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>dbj|BAG70022.1| 23 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=265

 Score =   288 bits (738),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK +TEF    GDGFKL VPSKWN SKEVE+PGQVLR+EDNFD TSN+ V+V+ TDK
Sbjct  88   FGKPKKDTEFSSYNGDGFKLLVPSKWNKSKEVEYPGQVLRFEDNFDATSNLAVMVSSTDK  147

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPE+FL QVDYLLGKQAY G+TDSEGGFD   VA+AN+LE+STPV+ GKQYY 
Sbjct  148  KSITDFGSPEQFLGQVDYLLGKQAYFGQTDSEGGFDSGVVASANVLESSTPVIDGKQYYS  207

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQ+ITA+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  208  ITVLTRTADGDEGGKHQIITATVKDGKLYICKAQAGDKRWFKGARKFVE  256



>emb|CDY09962.1| BnaC08g44890D [Brassica napus]
Length=263

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL+T+   VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDTNIQDVGGKPYYY  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  206  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  254



>sp|P85189.1|PSBP_HELAN RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=263

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K+ TEF   TG GFKL VP+KWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  87   FGKQKS-TEFSQYTGPGFKLSVPAKWNPSKEVEYPGQVLRYEDNFDTTSNLAVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYG+PEEFL++VDYLLGKQAY GKT SEGGF+ +AVATANILE +TP V GKQYYF
Sbjct  146  KAITDYGAPEEFLSKVDYLLGKQAYFGKTASEGGFEQDAVATANILEVATPTVDGKQYYF  205

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+VS+GKLYICKAQAGDKRWFKGARK+VE
Sbjct  206  LSVLTRTADGDEGGKHQLISATVSDGKLYICKAQAGDKRWFKGARKYVE  254



>ref|XP_003557629.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
[Brachypodium distachyon]
Length=253

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K+ TEF+  +GDGFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++TPT K
Sbjct  77   FGKQKS-TEFVAYSGDGFKLMIPAKWNPSKEREFPGQVLRYEDNFDATSNLSVMITPTPK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV YLLG+Q+Y GKTDSEGGF+ +AVATAN+LE++ PVVGGKQYY 
Sbjct  136  KSITDYGSPEEFLSQVGYLLGQQSYGGKTDSEGGFESDAVATANVLESAAPVVGGKQYYS  195

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLY+CKAQAGDKRWFKGA+KFVE
Sbjct  196  ITVLTRTADGDEGGKHQLITATVADGKLYVCKAQAGDKRWFKGAKKFVE  244



>emb|CDY47118.1| BnaC04g13750D [Brassica napus]
Length=678

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F+P  G+GFK+++PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V++TPTDK
Sbjct  501  FGKPKKNTDFMPYNGEGFKIEIPSKWNPSKEVEYPGQVLRYEDNFDATSNVSVMITPTDK  560

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+I DYGSPE+FL+QV YLLGKQAY G+T SEGGFD NAVATANILETST  VGGK+YY+
Sbjct  561  KTIADYGSPEQFLSQVSYLLGKQAYFGETASEGGFDANAVATANILETSTQEVGGKKYYY  620

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  621  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  669



>ref|XP_009376988.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=268

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK+NT+F P  G GFKL +PSKWNPSKEVE+PGQVLRYEDNFD T+N+ V +TPT+K
Sbjct  91   FGKPKSNTDFWPYFGKGFKLSIPSKWNPSKEVEYPGQVLRYEDNFDTTTNVAVTITPTEK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KS+ DYG PEEFL QVDYLLGKQAY GKT+SEGGFD  AVATANILE+S+ VV GKQYY+
Sbjct  151  KSVGDYGPPEEFLNQVDYLLGKQAYFGKTESEGGFDSGAVATANILESSSQVVDGKQYYY  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V +G LYI KAQAGDKRWFKGARKFVE
Sbjct  211  ISVLTRTADGDEGGKHQLITATVKDGNLYILKAQAGDKRWFKGARKFVE  259



>ref|XP_010522048.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522049.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010522051.1| PREDICTED: oxygen-evolving enhancer protein 2-1, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=264

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK++T+FL  +G+GFKL +PSKWNPSKEVEFPGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  87   FGKPKSDTDFLAYSGEGFKLVIPSKWNPSKEVEFPGQVLRYEDNFDATSNVSVMVTPTDK  146

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPEEFL+QV+YLLGKQ++ GKTD+EGGFD NAVA+ANIL+TS+  VGGKQYY+
Sbjct  147  KSITDFGSPEEFLSQVNYLLGKQSFFGKTDAEGGFDGNAVASANILDTSSQDVGGKQYYY  206

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADG EGGKHQLITA+V+ G   ICKAQAGDKRWFKGARKFVE
Sbjct  207  LSVLTRTADGGEGGKHQLITATVNGGGKVICKAQAGDKRWFKGARKFVE  255



>ref|XP_002283048.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010657102.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CAN60827.1| hypothetical protein VITISV_001116 [Vitis vinifera]
Length=259

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  83   FGKPKTNTDFLPYNGEGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VD+LLGKQA+ G  + EGGFD +AVATANILE+ST  VGGK YY 
Sbjct  143  KSITDYGSPEEFLSKVDFLLGKQAFFGNAN-EGGFDADAVATANILESSTTTVGGKPYYT  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLYICK QAGDKRWFKGARK+VE
Sbjct  202  ITVLTRTADGDEGGKHQLITAAVADGKLYICKVQAGDKRWFKGARKYVE  250



>ref|XP_009118486.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Brassica rapa]
Length=219

 Score =   285 bits (729),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGF +QVP+KWNPS+EVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  42   FGKPKKNTDFTAYSGDGFIVQVPAKWNPSREVEYPGQVLRYEDNFDATSNLNVMVTPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SEGGFD NAVATANIL+T+   VGGK YY+
Sbjct  102  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILDTNIQDVGGKPYYY  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  162  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  210



>emb|CBI22068.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  48   FGKPKTNTDFLPYNGEGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  107

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VD+LLGKQA+ G  + EGGFD +AVATANILE+ST  VGGK YY 
Sbjct  108  KSITDYGSPEEFLSKVDFLLGKQAFFGNAN-EGGFDADAVATANILESSTTTVGGKPYYT  166

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLYICK QAGDKRWFKGARK+VE
Sbjct  167  ITVLTRTADGDEGGKHQLITAAVADGKLYICKVQAGDKRWFKGARKYVE  215



>ref|XP_010657103.1| PREDICTED: putative oxygen-evolving enhancer protein 2-2 isoform 
X2 [Vitis vinifera]
Length=218

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  42   FGKPKTNTDFLPYNGEGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VD+LLGKQA+ G  + EGGFD +AVATANILE+ST  VGGK YY 
Sbjct  102  KSITDYGSPEEFLSKVDFLLGKQAFFGNAN-EGGFDADAVATANILESSTTTVGGKPYYT  160

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLYICK QAGDKRWFKGARK+VE
Sbjct  161  ITVLTRTADGDEGGKHQLITAAVADGKLYICKVQAGDKRWFKGARKYVE  209



>gb|EMS54608.1| Oxygen-evolving enhancer protein 2, chloroplastic [Triticum urartu]
Length=238

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K NT+F+  +G+GFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++ PT K
Sbjct  61   FGKAKKNTDFVAYSGEGFKLMIPAKWNPSKEREFPGQVLRYEDNFDATSNLSVIINPTTK  120

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYGSPEEFL+QV +LLG+Q+Y GKTDSEGGF+ +AVATAN+LE+S PVV GKQYY 
Sbjct  121  KTITDYGSPEEFLSQVGFLLGQQSYGGKTDSEGGFESDAVATANVLESSAPVVDGKQYYS  180

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLY+CKAQAGDKRWFKGA+KFVE
Sbjct  181  ITVLTRTADGDEGGKHQLITATVADGKLYVCKAQAGDKRWFKGAKKFVE  229



>gb|ABQ41912.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia apetala]
Length=233

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEFLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  76   FGKPKTNTEFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTPTDK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY G TDSEGGFD  AVATANILE+ST  V GK+YYF
Sbjct  136  KSIADYGSPEEFLLKVDYLLGKQAYFGNTDSEGGFDSGAVATANILESSTSNVSGKEYYF  195

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDK  225
            +SVLTRTADGDEGGKHQLI A+V NGKLYICKAQAGDK
Sbjct  196  LSVLTRTADGDEGGKHQLIIATVDNGKLYICKAQAGDK  233


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  53   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPYN  89



>gb|ABQ41911.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia ovata]
Length=233

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEFLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  76   FGKPKTNTEFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTPTDK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY G TD+EGGFD  AVATANILE+ST  V GK+YYF
Sbjct  136  KSIADYGSPEEFLLKVDYLLGKQAYFGNTDAEGGFDSGAVATANILESSTSNVSGKEYYF  195

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDK  225
            +SVLTRTADGDEGGKHQLI A+V NGKLYICKAQAGDK
Sbjct  196  LSVLTRTADGDEGGKHQLIIATVDNGKLYICKAQAGDK  233


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  53   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTEFLPYN  89



>gb|AAB82135.1| 23kDa polypeptide of photosystem II [Oryza sativa Indica Group]
Length=254

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+P +G+GFKL +PSKWNPSKE EFPGQVLRY++NF   SN+ V++ P  K
Sbjct  77   FGKPKTNTEFIPYSGEGFKLLIPSKWNPSKEREFPGQVLRYKENFHADSNVSVIINPPTK  136

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K++ ++GSP+EFL QVD+LLGKQAYSGKTDSEGGF+ +AVATANILE+S PVVGGKQY+ 
Sbjct  137  KTVAEFGSPQEFLPQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVGGKQYHS  196

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLITA+V++GKL ICKAQ GDKRWFKGARKFVE
Sbjct  197  VTVLTRTADGDEGGKHQLITATVNDGKLNICKAQPGDKRWFKGARKFVE  245



>ref|XP_003617328.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|AET00287.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=269

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL VPSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  92   FGKPKTNTDFLPYDGDGFKLSVPSKWNPSKEVEYTGQVLRYEDNFDTTSNVVVTVTPTDK  151

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYGSPEEFL+QV+YLLGKQA+ G+T SEGGFDPNAVATANILETSTPV+ GK+YY 
Sbjct  152  KAITDYGSPEEFLSQVNYLLGKQAFFGETLSEGGFDPNAVATANILETSTPVIDGKKYYV  211

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQ+I A+V +GKLYICKAQAGDKRWFKGAR+FVE
Sbjct  212  LSVLTRTADGDEGGKHQIIRATVKDGKLYICKAQAGDKRWFKGARRFVE  260



>gb|ABK26108.1| unknown [Picea sitchensis]
Length=272

 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  713  KPRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV  534
            +P   FG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN D  SN+ V+V
Sbjct  90   EPANVFGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDNGDTVSNVSVMV  149

Query  533  TPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGG  354
             PTDKKSI D+G P++FL+QVD+LLGKQAYSGKT SEGGFDP+AVA A++LE S+ V  G
Sbjct  150  IPTDKKSIKDFGPPQQFLSQVDFLLGKQAYSGKTQSEGGFDPDAVAVASLLEASSSVTNG  209

Query  353  KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            K+YY ISVLTRTADGDEGG+HQLITA+VS+GKLY+CKAQAGDKRWFKGARKFVE
Sbjct  210  KEYYNISVLTRTADGDEGGRHQLITATVSDGKLYVCKAQAGDKRWFKGARKFVE  263



>gb|ABR16937.1| unknown [Picea sitchensis]
Length=272

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN D  SN+ V+V PTDK
Sbjct  95   FGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDNRDTVSNVSVMVIPTDK  154

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI D+G P++FL+QVD+LLGKQAYSGKT SEGGFDP+AVA A++LE S+ V  GK+YY 
Sbjct  155  KSIKDFGPPQQFLSQVDFLLGKQAYSGKTQSEGGFDPDAVAVASLLEASSSVTNGKEYYN  214

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGG+HQLITA+VS+GKLY+CKAQAGDKRWFKGARKFVE
Sbjct  215  ISVLTRTADGDEGGRHQLITATVSDGKLYVCKAQAGDKRWFKGARKFVE  263



>gb|ABK22374.1| unknown [Picea sitchensis]
 gb|ABK23860.1| unknown [Picea sitchensis]
 gb|ABR16069.1| unknown [Picea sitchensis]
 gb|ABR17587.1| unknown [Picea sitchensis]
Length=272

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVLRYEDN D  SN+ V+V PTDK
Sbjct  95   FGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLRYEDNGDTVSNVSVMVIPTDK  154

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI D+G P++FL+QVD+LLGKQAYSGKT SEGGFDP+AVA A++LE S+ V  GK+YY 
Sbjct  155  KSIKDFGPPQQFLSQVDFLLGKQAYSGKTQSEGGFDPDAVAVASLLEASSSVTNGKEYYN  214

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGG+HQLITA+VS+GKLY+CKAQAGDKRWFKGARKFVE
Sbjct  215  ISVLTRTADGDEGGRHQLITATVSDGKLYVCKAQAGDKRWFKGARKFVE  263



>gb|ABQ41910.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia caseolaris]
Length=233

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  76   FGKPKTNTDFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTPTDK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY G TDSEGGFD  AVATANILE+ST  V GK+YY 
Sbjct  136  KSIADYGSPEEFLLKVDYLLGKQAYFGNTDSEGGFDSGAVATANILESSTSNVSGKEYYC  195

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDK  225
            +SVLTRTADGDEGGKHQLI A+V NGKLYICKAQAGDK
Sbjct  196  LSVLTRTADGDEGGKHQLIIATVDNGKLYICKAQAGDK  233


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  53   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  89



>gb|EMT29894.1| Oxygen-evolving enhancer protein 2, chloroplastic [Aegilops tauschii]
Length=300

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 8/177 (5%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K NT+F+  +G+GFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++ PT K
Sbjct  115  FGKAKKNTDFVAYSGEGFKLMIPAKWNPSKEREFPGQVLRYEDNFDATSNLSVIINPTTK  174

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE--------GGFDPNAVATANILETSTPV  363
            K+ITDYGSPEEFL+QV +LLG+Q+Y GKTDSE        GGF+ +AVATAN+LE+S PV
Sbjct  175  KTITDYGSPEEFLSQVGFLLGQQSYGGKTDSECADDVRVQGGFESDAVATANVLESSAPV  234

Query  362  VGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            V GKQYY I+VLTRTADGDEGGKHQLITA+V++GKLY+CKAQAGDKRWFKGA+KFVE
Sbjct  235  VDGKQYYSITVLTRTADGDEGGKHQLITATVADGKLYVCKAQAGDKRWFKGAKKFVE  291



>gb|ABK21284.1| unknown [Picea sitchensis]
Length=272

 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK NT+F+  +G GF +Q+PSKWNPSKEVE+PGQVL YEDN D  SN+ V+V PTDK
Sbjct  95   FGAPKKNTDFITYSGKGFTIQIPSKWNPSKEVEYPGQVLIYEDNGDTVSNVSVMVIPTDK  154

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI D+G P++FL+QVD+LLGKQAYSGKT SEGGFDP+AVA A++LE S+ V  GK+YY 
Sbjct  155  KSIKDFGPPQQFLSQVDFLLGKQAYSGKTQSEGGFDPDAVAVASLLEASSSVTNGKEYYN  214

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGG+HQLITA+VS+GKLY+CKAQAGDKRWFKGARKFVE
Sbjct  215  ISVLTRTADGDEGGRHQLITATVSDGKLYVCKAQAGDKRWFKGARKFVE  263



>ref|XP_006354308.1| PREDICTED: oxygen-evolving enhancer protein 2, chloroplastic-like 
[Solanum tuberosum]
Length=254

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 149/171 (87%), Gaps = 11/171 (6%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FLP  GDGFKLQ+PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V +TPTD 
Sbjct  84   FGKPKKNTDFLPYNGDGFKLQIPSKWNPSKEVEYPGQVLRYEDNFDATSNVVVTITPTDN  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVAT--ANILETSTPVVGGKQY  345
            KSITDYGSP++FL+QVDYLLGKQAY GKTDSEGGF+ +AVAT  +N         GGKQY
Sbjct  144  KSITDYGSPQQFLSQVDYLLGKQAYFGKTDSEGGFESDAVATHFSN---------GGKQY  194

Query  344  YFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            Y++SVL RTADGDEGGKHQLI A+V++GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  195  YYLSVLIRTADGDEGGKHQLIRATVNDGKLYICKAQAGDKRWFKGAKKFVE  245



>sp|Q00434.1|PSBP_WHEAT RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; AltName: Full=23 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=23 kDa thylakoid 
membrane protein; AltName: Full=OEC 23 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 emb|CAA40669.1| 23kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=258

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK K NT+F+  +G+GFKL +P+KWNPSKE EFPGQVLRYEDNFD TSN+ V++ PT K
Sbjct  82   FGKAKKNTDFVAYSGEGFKLMIPAKWNPSKEREFPGQVLRYEDNFDATSNLSVIINPTTK  141

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+ITDYGSPEEFL+QV +LLG+Q+Y GKTDSEGGF+ +AVATAN+LE+S PVV GKQYY 
Sbjct  142  KTITDYGSPEEFLSQVGFLLGQQSYGGKTDSEGGFESDAVATANVLESSAPVVDGKQYYS  201

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            I+VLTRTADGDEGGKHQLITA+V++GKLY+CKAQ  DKRWFKGA+KFVE
Sbjct  202  ITVLTRTADGDEGGKHQLITATVADGKLYVCKAQR-DKRWFKGAKKFVE  249



>gb|ABS84824.1| chloroplast oxygen-evolving enhancer protein 2 [Limonium bicolor]
Length=268

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KT T+F    G+GFKLQ+P+KWNPS+E+EFPGQVLR+EDNFD TSN+ V++ PTDK
Sbjct  92   FGKQKT-TDFTAYVGEGFKLQIPAKWNPSREIEFPGQVLRFEDNFDTTSNVSVMINPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+G+PEEFL+ V+YL G QAY GKTDSEGGFD   VA+ANILETS+P + GK YY 
Sbjct  151  KSITDFGTPEEFLSTVNYLFGSQAYFGKTDSEGGFDSGVVASANILETSSPTIDGKPYYI  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI+A+V+ GKLYICKAQAGDKRWFKGA+KFVE
Sbjct  211  LSVLTRTADGDEGGKHQLISATVNGGKLYICKAQAGDKRWFKGAKKFVE  259



>ref|XP_007141448.1| hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris]
 gb|ESW13442.1| hypothetical protein PHAVU_008G196500g [Phaseolus vulgaris]
Length=261

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F P  GDGFKL +PSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  84   FGKPKTNTDFQPYNGDGFKLSIPSKWNPSKEVEYRGQVLRYEDNFDTTSNVVVTVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANILE+ST VV GK YY 
Sbjct  144  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANILESSTTVVDGKPYYS  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLI A+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  LTVLTRTADGDEGGKHQLIRATVKDGKLYICKAQAGDKRWFKGARKFVE  252



>gb|AGV54458.1| oxygen-evolving enhancer protein 2 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=261

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F P  GDGFKL +PSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  84   FGKPKTNTDFQPYNGDGFKLSIPSKWNPSKEVEYRGQVLRYEDNFDTTSNVVVTVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANILE+ST VV GK YY 
Sbjct  144  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANILESSTTVVDGKPYYS  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLI A+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  LTVLTRTADGDEGGKHQLIRATVKDGKLYICKAQAGDKRWFKGARKFVE  252



>gb|AAN77240.1| PsbP [Xerophyta humilis]
Length=244

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG+PKTNT+FL   GDGFK+ +PSKWN SKEVE+PGQVLRYEDNFD  SN+ V+V PTDK
Sbjct  81   FGRPKTNTDFLTYAGDGFKVLIPSKWNFSKEVEYPGQVLRYEDNFDANSNLAVMVQPTDK  140

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITD+GSPEEFL++VDYLLGKQAY GKT SEGGFD + VATANILE S   VGGK YY 
Sbjct  141  KSITDFGSPEEFLSKVDYLLGKQAYFGKTASEGGFDKDVVATANILEASATEVGGKPYYN  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGA  207
            ISVLTRTADGDEGGKHQ+I A+VS+GKLYICK QAGDKRWFKGA
Sbjct  201  ISVLTRTADGDEGGKHQIIAATVSDGKLYICKVQAGDKRWFKGA  244



>tpg|DAA59516.1| TPA: hypothetical protein ZEAMMB73_927356 [Zea mays]
Length=337

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 151/204 (74%), Gaps = 34/204 (17%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             FGKPK +TE++  +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT 
Sbjct  125  VFGKPKASTEYIAYSGDGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIIQPTS  184

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE---------------------------  423
            KK+I DYGSPEEFL+QVDYLLG+QAY GKTDSE                           
Sbjct  185  KKTIADYGSPEEFLSQVDYLLGRQAYGGKTDSEVRNITLWTVVTTAMHVCISVAAVLLAL  244

Query  422  -------GGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSN  264
                   GGF+  AVATAN+LE+STPV+ GKQYY +SVLTRTADGDEGGKHQLI A+VS+
Sbjct  245  HESTCVQGGFETGAVATANVLESSTPVIDGKQYYAVSVLTRTADGDEGGKHQLIAATVSD  304

Query  263  GKLYICKAQAGDKRWFKGARKFVE  192
            GKLYICKAQAGDKRWFKGARK VE
Sbjct  305  GKLYICKAQAGDKRWFKGARKGVE  328



>gb|AGV54655.1| oxygen-evolving enhancer protein 2-2 chloroplast precursor (OEE2) 
[Phaseolus vulgaris]
Length=261

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+F P  GDGFKL +PSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  84   FGKPKTNTDFQPYNGDGFKLSIPSKWNPSKEVEYRGQVLRYEDNFDTTSNVVVTVTPTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFD NAVATANILE+ST VV GK YY 
Sbjct  144  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDSNAVATANILESSTTVVDGKPYYS  203

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ++VLTRTADGDEGGKHQLI A+V +GKLYICKAQAGDKRWFKGARKFVE
Sbjct  204  LTVLTRTADGDEGGKHQLIRATVKDGKLYICKAQAGDKRWFKGARKFVE  252



>ref|XP_002992976.1| hypothetical protein SELMODRAFT_136349 [Selaginella moellendorffii]
 gb|EFJ05922.1| hypothetical protein SELMODRAFT_136349 [Selaginella moellendorffii]
Length=219

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK  + F  +TGDGFKL VPSKWNPSKE+EFPG +LRYEDNFDQ SN+ V+V PTDK
Sbjct  42   FGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNFDQKSNLAVMVIPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+   YLLGKQAY+GKT SEGGFDPNAVATA +L++ T  + GK+YY 
Sbjct  102  KSITDYGSPEEFLSAYSYLLGKQAYAGKTVSEGGFDPNAVATAAVLQSKTKDINGKKYYD  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            + VLTRTADGDEGG HQLI AS++NGKLY+ KAQAGDKRWFKGA+KFV+
Sbjct  162  LDVLTRTADGDEGGTHQLIVASINNGKLYLLKAQAGDKRWFKGAQKFVK  210



>ref|XP_002991817.1| hypothetical protein SELMODRAFT_134339 [Selaginella moellendorffii]
 gb|EFJ07079.1| hypothetical protein SELMODRAFT_134339 [Selaginella moellendorffii]
Length=219

 Score =   267 bits (682),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK  + F  +TGDGFKL VPSKWNPSKE+EFPG +LRYEDNFDQ SN+ V+V PTDK
Sbjct  42   FGSPKQQSGFTTLTGDGFKLDVPSKWNPSKELEFPGTLLRYEDNFDQKSNLAVMVIPTDK  101

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPE+FL+   YLLGKQAY+GKT SEGGFDPNAVATA +L++ T  + GK+YY 
Sbjct  102  KSITDYGSPEDFLSAYSYLLGKQAYAGKTVSEGGFDPNAVATAAVLQSKTKDINGKKYYD  161

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            + VLTRTADGDEGG HQLI AS++NGKLY+ KAQAGDKRWFKGA+KFV+
Sbjct  162  LDVLTRTADGDEGGTHQLIVASINNGKLYLLKAQAGDKRWFKGAQKFVK  210



>gb|KDO44762.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=246

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 139/169 (82%), Gaps = 16/169 (9%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL++VDYLLGKQAYSGKT SEGGFDP+AVATANILE S        YYF
Sbjct  145  KSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEGGFDPDAVATANILEASV----RPPYYF  200

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEG            GKLYICKAQAGDKRWFKG RK+VE
Sbjct  201  LSVLTRTADGDEG------------GKLYICKAQAGDKRWFKGTRKYVE  237



>gb|KEH33650.1| oxygen-evolving enhancer protein 2-1 [Medicago truncatula]
Length=244

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 139/169 (82%), Gaps = 17/169 (10%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK KTNT+FLP  GDGFKL VP+KWNPSKE EFPGQVLRYEDNFD TSN+ VLV  TDK
Sbjct  84   FGKAKTNTDFLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDK  143

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL                 S+GGFD NAVA ANILE+S PV+GGKQY+ 
Sbjct  144  KSITDYGSPEEFL-----------------SKGGFDTNAVAVANILESSAPVIGGKQYFN  186

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            ISVLTRTADGDEGGKHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  187  ISVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  235


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            +GAAAVG KVSPADAAYGEAANVF KA+ N   +P N
Sbjct  61   LGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYN  97



>gb|ABQ41909.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia alba]
Length=234

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  76   FGKPKTNTDFLPYNGDGFKLNIPSKWNPSKEVEYPGQVLRYEDNFDSTSNVAVMVTPTDK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY G TD+EGGFD  AVATANILE+ST  V GK+YYF
Sbjct  136  KSIADYGSPEEFLLKVDYLLGKQAYFGNTDAEGGFDSGAVATANILESSTSNVSGKEYYF  195

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICK  243
            +SVLTRTADGDEGGKHQLI A+V NGKLY  +
Sbjct  196  LSVLTRTADGDEGGKHQLIIATVDNGKLYTAR  227


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  53   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  89



>dbj|BAA08564.1| 23 kDa polypeptide of photosystem II [Oryza sativa (japonica 
cultivar-group)]
Length=252

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 146/174 (84%), Gaps = 11/174 (6%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  76   FGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTK  135

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            K+IT++GSPEEFLAQVD+LLGKQAYSGKTDSEGGF+ +AVATANILE+S PVV G     
Sbjct  136  KTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATANILESSAPVVEG-----  190

Query  338  ISVLTRTADGDEGG-----KHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
             SVL R    ++GG     KHQLITA+V++GKLYICKAQAGDKRWFKGARKFVE
Sbjct  191  -SVLQRNGADEDGGRRRGRKHQLITATVNDGKLYICKAQAGDKRWFKGARKFVE  243



>gb|ACS68649.1| 23 kDa polypeptide of the oxygen evolving complex of photosystem 
II [Sonneratia alba]
 gb|ACS68719.1| 23kDa polypeptide of the oxygen evolving complex of photosystem 
II, partial [Sonneratia alba]
Length=214

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKW+PSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  67   FGKPKTNTDFLPYNGDGFKLNIPSKWSPSKEVEYPGQVLRYEDNFDSTSNVAVMVTPTDK  126

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSI DYGSPEEFL +VDYLLGKQAY G TD+EGGFD  AVATANILE+ST  V GK+YYF
Sbjct  127  KSIADYGSPEEFLLKVDYLLGKQAYFGNTDAEGGFDSGAVATANILESSTSNVSGKEYYF  186

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKL  255
            +SVLTRTADGDEGGKHQLI A+V NGKL
Sbjct  187  LSVLTRTADGDEGGKHQLIIATVDNGKL  214


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  44   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  80



>gb|ABK55671.1| chloroplast photosystem II oxygen-evolving complex 23 kDa polypeptide 
[Cucumis sativus]
Length=150

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  677  TEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            T++LP +GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PTDKKSI D+G
Sbjct  1    TDYLPYSGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNLSVIINPTDKKSIKDFG  60

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
            SPEEFL++VDYLLGKQAY GKT SEGGFDP+AVATANILE +   V GK YYF+SVLTRT
Sbjct  61   SPEEFLSKVDYLLGKQAYFGKTASEGGFDPDAVATANILEATASNVNGKDYYFVSVLTRT  120

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGD  228
            ADGDEGGKHQLITA+V++GKLYICKAQAGD
Sbjct  121  ADGDEGGKHQLITATVNDGKLYICKAQAGD  150



>ref|XP_006417893.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
 gb|ESQ36246.1| hypothetical protein EUTSA_v10008504mg [Eutrema salsugineum]
Length=244

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 138/169 (82%), Gaps = 19/169 (11%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+F   +GDGFK+QVP+KWNPS+E+E+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  86   FGKPKANTDFTAYSGDGFKVQVPAKWNPSREIEYPGQVLRYEDNFDATSNLNVMVTPTDK  145

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL+QV+YLLGKQAY G+T SE                    VGGK YY+
Sbjct  146  KSITDYGSPEEFLSQVNYLLGKQAYFGETASEE-------------------VGGKPYYY  186

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGA KFVE
Sbjct  187  LSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGANKFVE  235



>emb|CAA41713.1| photosystem II 23 kDa polypeptide [Nicotiana tabacum]
Length=229

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
            KSITDYGSPEEFL QVD+LLGKQAY GKTDSEGGF+  AVATAN+LETS+  VGGK+YY 
Sbjct  151  KSITDYGSPEEFLTQVDFLLGKQAYFGKTDSEGGFESGAVATANLLETSSSTVGGKEYYI  210

Query  338  ISVLTRTADGDEGGKHQLI  282
            +SVLTRTADGDEGGKHQLI
Sbjct  211  LSVLTRTADGDEGGKHQLI  229



>ref|XP_001771262.1| predicted protein [Physcomitrella patens]
 gb|EDQ63973.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK +T F P +G+GF L++PSKWNPSKE EFPG VLRYEDNFD T+N+ V +TP  K
Sbjct  91   FGAPKQSTGFNPYSGNGFSLEIPSKWNPSKEKEFPGTVLRYEDNFDSTTNLFVSITPATK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SIT+YG PE+FL +V YL GKQAYSGKT SEGGF+ NAVATA +LE ++  V G+ YY 
Sbjct  151  GSITEYGPPEKFLDEVSYLFGKQAYSGKTASEGGFENNAVATAAVLEANSMEVNGRPYYK  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI A+V +G LY+ KAQAGDKRWFKG +KFVE
Sbjct  211  LSVLTRTADGDEGGKHQLIAATVKDGNLYLFKAQAGDKRWFKGVKKFVE  259



>ref|XP_001763729.1| predicted protein [Physcomitrella patens]
 gb|EDQ71371.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK +T F P TGDGF L +PSKWNPSKE EFPG VLR+EDNFD T+N+ V +TP  K
Sbjct  91   FGAPKQSTGFSPFTGDGFSLDIPSKWNPSKEKEFPGTVLRFEDNFDATNNLFVSITPASK  150

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SIT+YGSPE+FL +V YL GKQAY+GKT SEGGF  N+VATA ILE  +  + G+ YY 
Sbjct  151  GSITEYGSPEKFLDEVSYLFGKQAYNGKTASEGGFQNNSVATAAILEAKSVELKGRPYYK  210

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI A+V +G LY+ KAQAGDKRWFKG +KFVE
Sbjct  211  LSVLTRTADGDEGGKHQLIAATVKDGNLYMLKAQAGDKRWFKGVKKFVE  259



>ref|XP_001765395.1| predicted protein [Physcomitrella patens]
 gb|EDQ69858.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK +T F P  G+GF L VPSKWNPSKE EFPG V+R+EDNFD T+N+ V +TP  K
Sbjct  92   FGAPKISTGFTPFAGNGFTLDVPSKWNPSKEQEFPGTVVRFEDNFDATNNLFVSITPATK  151

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SIT+YG PE+FL +V +L GKQAYSGKT SEGGF  NAVATA +LE ++  + G+ YY 
Sbjct  152  GSITEYGPPEKFLDEVSFLFGKQAYSGKTASEGGFVNNAVATAAVLEANSVDINGRPYYK  211

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI A+V +G+LY+ KAQAGDKRWFKG +KFVE
Sbjct  212  LSVLTRTADGDEGGKHQLIAATVKDGQLYLFKAQAGDKRWFKGVKKFVE  260



>ref|XP_001753947.1| predicted protein [Physcomitrella patens]
 gb|EDQ81269.1| predicted protein, partial [Physcomitrella patens]
Length=216

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK  T F P  G+GF L VPSKWNPSKE EFPG V+R+EDNFD T+N+ V VTP  K
Sbjct  39   FGAPKKQTGFTPFIGNGFSLDVPSKWNPSKEKEFPGTVVRFEDNFDATNNLFVSVTPAKK  98

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SI++YG PE+FL +V +L GKQAY GKT SEGGF  NAVATA +L+ ++  V G+ YY 
Sbjct  99   GSISEYGPPEKFLDEVSFLFGKQAYEGKTASEGGFQNNAVATAAVLDAASVEVNGRPYYK  158

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLI A+V +G LY+ KAQAGDKRWFKG +KFVE
Sbjct  159  LSVLTRTADGDEGGKHQLIAATVKDGNLYLFKAQAGDKRWFKGVKKFVE  207



>ref|NP_180637.3| photosystem II subunit P-2 [Arabidopsis thaliana]
 sp|O49344.3|PSBP2_ARATH RecName: Full=Putative oxygen-evolving enhancer protein 2-2; 
Short=OEE2 [Arabidopsis thaliana]
 dbj|BAD43501.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 dbj|BAD43584.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 dbj|BAD43697.1| putative photosystem II oxygen-evolving complex 23K protein [Arabidopsis 
thaliana]
 gb|AAY34155.1| At2g30790 [Arabidopsis thaliana]
 gb|AEC08441.1| photosystem II subunit P-2 [Arabidopsis thaliana]
Length=125

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  539  LVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVV  360
            ++TPTDKKSITDYGSPE+FL+QV+YLLGKQAY G+T SEGGFD NAVATANILETST  +
Sbjct  1    MITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEI  60

Query  359  GGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            GGK+YY++SVLTRTADGDEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  61   GGKEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  116



>ref|XP_001763489.1| predicted protein [Physcomitrella patens]
 gb|EDQ71678.1| predicted protein [Physcomitrella patens]
Length=184

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG PK  T F   T +GF + V SKWNPSKE EFP  V+RY+DNFD T+N+ V ++PT K
Sbjct  7    FGAPKKTTGFTSFTDNGFSMDVRSKWNPSKEKEFPEIVIRYKDNFDATNNLFVSISPTTK  66

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             +I+DY +PE+F  QV YL  KQAY GK  SEGGF  NAVATA +LE ++  V G+  Y 
Sbjct  67   STISDYRAPEKFFDQVSYLFEKQAYDGKIPSEGGFMDNAVATAAMLEANSEDVNGRPNYK  126

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SV TRTADGDEGGKHQLI A+V +  LY+ KAQAG KRWFKG +KFVE
Sbjct  127  LSVFTRTADGDEGGKHQLIAATVKDDNLYLFKAQAGHKRWFKGMKKFVE  175



>sp|P11471.1|PSBP_CHLRE RecName: Full=Oxygen-evolving enhancer protein 2, chloroplastic; 
Short=OEE2; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA33088.1| oxygen-evolving enhancer protein 2 [Chlamydomonas reinhardtii]
Length=245

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK    + F+P  GDGF L +P+KWNPSKE +FPG +LRYEDNFD  +N+ V+   TDK
Sbjct  66   FGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRYEDNFDAVNNLVVIAQDTDK  125

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGKQYY  342
            K+I D+GS ++FL  V YLLGKQAYSG+T SEGGF PN V+ A++L+ ST     GK YY
Sbjct  126  KAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAPNRVSAASLLDVSTTTDKKGKTYY  185

Query  341  FISVLTRTADGDEGGKHQLITASV-SNGKLYICKAQAGDKRWFKGARK  201
               +L R+ADGDEGG+HQLI A+V S+ KLYI K Q GDKRWFKGA+K
Sbjct  186  KYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKK  233



>ref|XP_001694126.1| oxygen-evolving enhancer protein 2 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP03062.1| oxygen-evolving enhancer protein 2 of photosystem II [Chlamydomonas 
reinhardtii]
Length=282

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 2/168 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK    + F+P  GDGF L +P+KWNPSKE +FPG +LRYEDNFD  +N+ V+   TDK
Sbjct  103  FGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFPGVILRYEDNFDAVNNLVVIAQDTDK  162

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGKQYY  342
            K+I D+GS ++FL  V YLLGKQAYSG+T SEGGF PN V+ A++L+ ST     GK YY
Sbjct  163  KAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAPNRVSAASLLDVSTTTDKKGKTYY  222

Query  341  FISVLTRTADGDEGGKHQLITASV-SNGKLYICKAQAGDKRWFKGARK  201
               +L R+ADGDEGG+HQLI A+V S+ KLYI K Q GDKRWFKGA+K
Sbjct  223  KYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKK  270



>ref|XP_002956365.1| oxygen-evolving enhancer protein 2 [Volvox carteri f. nagariensis]
 gb|EFJ42509.1| oxygen-evolving enhancer protein 2 [Volvox carteri f. nagariensis]
Length=1454

 Score =   213 bits (541),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 102/168 (61%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -2

Query  698   FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
             FGK    + F+   GDGF L +PSKWNPSKE +FPG  LRYEDNFD  +N+ V+  PTDK
Sbjct  1275  FGKVTNKSGFVSYAGDGFALLLPSKWNPSKETDFPGVTLRYEDNFDAVNNLVVIAQPTDK  1334

Query  518   KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILET-STPVVGGKQYY  342
             KSI D GSP++FL  V YLLG+QAYSG+T SEGGF PN V+ A++L+  +T    GK YY
Sbjct  1335  KSIEDLGSPDKFLESVSYLLGRQAYSGETVSEGGFAPNRVSAASLLDVFTTSDKKGKTYY  1394

Query  341   FISVLTRTADGDEGGKHQLITASV-SNGKLYICKAQAGDKRWFKGARK  201
                +L RTADGDEGG+HQLI A+V S+ KLYI K Q GDKRWFKG +K
Sbjct  1395  KYELLVRTADGDEGGRHQLIAATVGSDSKLYILKVQVGDKRWFKGVKK  1442



>emb|CCM44238.1| photosystem II subunit P, partial [Chlamydomonas raudensis]
Length=247

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK    ++F+P  GDGF +Q+P KWNPSKE +FPG  LRYEDN D  +N  +L   TDK
Sbjct  69   FGKVTNQSQFIPYVGDGFAVQLPGKWNPSKEQDFPGVQLRYEDNGDAVNNFVILKNKTDK  128

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGKQYY  342
              I+D+G  + FL  V YLLGKQAYSG+T SEGGF PN V+ A+IL+ S      G+ YY
Sbjct  129  SKISDFGDKQAFLNSVSYLLGKQAYSGETKSEGGFAPNRVSAASILDISEVTDKKGRTYY  188

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
               +LTRTADG+EGG+HQLI A+V++G L++C  + GDKRWFK A+K
Sbjct  189  TYEILTRTADGNEGGRHQLIKATVADGNLWVCLVRVGDKRWFKTAKK  235



>emb|CEG02166.1| Mog1/PsbP, alpha/beta/alpha sandwich [Ostreococcus tauri]
Length=243

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  677  TEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            T F+P  GDG+   +P+K+NPSKE  FP Q   +EDNFD  +NI V+V    K  I+DYG
Sbjct  73   TGFVPYAGDGYAFLLPAKYNPSKERPFPNQDAYWEDNFDAVTNISVIVEKASKSKISDYG  132

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
             PE FL QV YLLGKQ+Y+G+T SEGGF  N V+TA +LE  +    GKQYY   +LTRT
Sbjct  133  KPEAFLEQVSYLLGKQSYTGETRSEGGFAANKVSTAAVLEVGSRENKGKQYYEYEILTRT  192

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            ADGDEGG+HQLI+A+VS+G LYI K Q+GDKRWFKG  +
Sbjct  193  ADGDEGGRHQLISATVSDGNLYIMKLQSGDKRWFKGQER  231



>gb|ABV57471.1| chloroplast PsbP [Phyllostachys edulis]
Length=118

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  584  LRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPN  405
            LRYEDNFD  SN+ V++TPT KK+IT+YGSPEEFL+QVDYLLGKQAYSGKTDSEGGF+ +
Sbjct  1    LRYEDNFDSNSNVSVMITPTTKKTITEYGSPEEFLSQVDYLLGKQAYSGKTDSEGGFETD  60

Query  404  AVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAG  231
            AVATAN+LE+S PV+GGKQYY I+VLTRTADGDEGGKHQLITA+V++GKLYICKAQAG
Sbjct  61   AVATANVLESSAPVIGGKQYYSITVLTRTADGDEGGKHQLITATVADGKLYICKAQAG  118



>gb|ACD10926.1| photosystem II oxygen evolving system 23 kDa subunit [Lemna minor]
Length=115

 Score =   189 bits (481),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -2

Query  680  NTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDY  501
            NT+F+P  G+GF L +P+KWNPSKE+E+PGQVLR+EDNFD TSN+ VLV  T KKSI++Y
Sbjct  1    NTDFIPYAGEGFNLLIPAKWNPSKEIEYPGQVLRFEDNFDATSNVSVLVQNTSKKSISEY  60

Query  500  GSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFI  336
            GSPEEFLAQVDYLLGKQ Y GKTDSEGGFD +AVATANILETSTP VGGK YYF+
Sbjct  61   GSPEEFLAQVDYLLGKQVYGGKTDSEGGFDQDAVATANILETSTPTVGGKDYYFL  115



>ref|XP_002505689.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas sp. RCC299]
 gb|ACO66947.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas sp. RCC299]
Length=257

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -2

Query  701  FFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD  522
             +G    ++ F+P +GDG+   +PSK+NPSKE  FPGQ   +EDNFD  SNI +LV    
Sbjct  79   IWGSTTNSSGFIPYSGDGYAFLLPSKYNPSKERPFPGQDAYFEDNFDAVSNISILVEKCG  138

Query  521  KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY  342
            K  I D+GSPE +L ++ YLLG+Q YSG+T SEGGF  N V++A +L+  T    GK YY
Sbjct  139  KSKIEDFGSPESYLEKIGYLLGQQVYSGETRSEGGFAANKVSSAAVLDVFTKSNKGKTYY  198

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            +  VLTRTADGDEGG+HQLI A+VS+G LY  K Q+GDKRWFKG  +
Sbjct  199  YYEVLTRTADGDEGGRHQLIAATVSDGTLYTMKLQSGDKRWFKGQER  245



>ref|XP_005649549.1| photosystem II oxygen evolving complex protein PsbP [Coccomyxa 
subellipsoidea C-169]
 gb|EIE25005.1| photosystem II oxygen evolving complex protein PsbP [Coccomyxa 
subellipsoidea C-169]
Length=255

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = -2

Query  707  RMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTP  528
            R+F  K   +T F+P +G+GF L +PSK+NPSKE EFPG  LRYEDN D  ++I V+V  
Sbjct  74   RVFGSKATNSTGFVPYSGEGFALLLPSKYNPSKEKEFPGTQLRYEDNGDAVNSIAVMVRS  133

Query  527  TDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGK  351
            T K SI +YG+P++FL +   LLG Q + G++ SEGGF PN V+ A++L+        GK
Sbjct  134  TTKNSIEEYGTPDKFLDENKNLLGAQVFKGESRSEGGFAPNKVSVASLLDVQQAKDKKGK  193

Query  350  QYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGA  207
             YY   +LTRTADGDEGG+HQLITA+V NG LYI K Q GDKRWFKGA
Sbjct  194  TYYKYEILTRTADGDEGGRHQLITAAVGNGNLYILKVQVGDKRWFKGA  241



>ref|XP_001422601.1| oxygen evolving enhancer 2 of Photosystem II [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00918.1| oxygen evolving enhancer 2 of Photosystem II [Ostreococcus lucimarinus 
CCE9901]
Length=249

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG     T F+P  GDGF   +PSK+NPSKE  FP     +EDNFDQ +NI V+    +K
Sbjct  72   FGGVSNPTGFVPYAGDGFAFLLPSKYNPSKERPFPNTECYFEDNFDQVTNISVIAEKAEK  131

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SI  YG PE+FL ++ YLLG Q+Y+G+T SEGGF  N V+TA +L+  T    GK YY 
Sbjct  132  GSIDAYGKPEQFLEKLGYLLGVQSYAGQTRSEGGFAANKVSTAAVLDVYTRENKGKTYYQ  191

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
              +LTRTADGDEGG+HQLITA+VS+G LYI K Q+GDKRWFKG  +
Sbjct  192  YEILTRTADGDEGGRHQLITATVSDGNLYIMKLQSGDKRWFKGQER  237



>gb|AFK45562.1| unknown [Lotus japonicus]
Length=195

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL VPSKWNPSKEVE+ GQVLRYEDNFD TSN+ V VTPTDK
Sbjct  83   FGKPKTNTDFLPYNGDGFKLSVPSKWNPSKEVEYTGQVLRYEDNFDSTSNVVVTVTPTDK  142

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILE  378
            KSITDYGSPEEFL++VDYLLGKQA+ G+T +EGGFDPNAVATANI  
Sbjct  143  KSITDYGSPEEFLSKVDYLLGKQAFFGETQAEGGFDPNAVATANIFR  189



>ref|XP_005649550.1| oxygen evolving enhancer 2 of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25006.1| oxygen evolving enhancer 2 of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=254

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  704  MFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  525
            +F  KP   T F+P +G+GF L +PSKWNPSKE E  G  LRYEDN D  +++ V+   +
Sbjct  74   IFKSKPTNTTGFIPYSGEGFALLLPSKWNPSKEREESGVALRYEDNGDNLNHVTVITRKS  133

Query  524  DKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGKQ  348
            DK SI  YG+P+EFL  +  LLG+Q + G+T SEGGF  N V+TA +L+        GK 
Sbjct  134  DKSSIDQYGAPDEFLNSIKNLLGEQTFKGETISEGGFAKNKVSTAALLDVQKAKDSKGKT  193

Query  347  YYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            YY   +L+R+ADG+EGGKH LITA+V NG LYIC+   GDKRWFKGA K
Sbjct  194  YYKYDILSRSADGNEGGKHNLITAAVGNGTLYICQVTIGDKRWFKGANK  242



>ref|XP_007509854.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18969.1| predicted protein [Bathycoccus prasinos]
Length=255

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FG     + F+P  G+G+   +PSK+NPSKE  FP     +EDNFDQ SNI V+ T    
Sbjct  78   FGGVSNTSGFIPYAGNGYAFLLPSKYNPSKERPFPDTDSYFEDNFDQVSNISVITTKAKG  137

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
             SI  YG PE  LA   YLLG Q+Y+G+T SEGGF  N V+TA +L+  T    GK +Y 
Sbjct  138  NSIESYGKPEAMLADFGYLLGVQSYAGETRSEGGFAANKVSTAAVLDVFTRTDKGKTFYM  197

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
              +LTRTADGDEGG+HQLI A+VS+G LYI K Q+GDKRWFKG  +
Sbjct  198  FEILTRTADGDEGGRHQLIAATVSDGTLYIMKLQSGDKRWFKGQER  243



>ref|XP_003060004.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas pusilla CCMP1545]
 gb|EEH55956.1| photosystem II oxygen-evolving complex 23 kDa protein, chloroplast 
precursor [Micromonas pusilla CCMP1545]
Length=258

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -2

Query  683  TNTE-FLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKS-I  510
            TNT  F+P +GDG+   +PSK+NPSKE  FP Q + +EDNFD  +NI V+V     KS I
Sbjct  84   TNTSGFIPYSGDGYAFLLPSKYNPSKERPFPNQDVYFEDNFDAVTNISVMVEKKCGKSKI  143

Query  509  TDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISV  330
             D+GSPE +L ++ YLLG+Q Y+G+T SEGGF  N V+ A +L+  T    GK YY+  V
Sbjct  144  EDFGSPEAYLEKIGYLLGQQVYAGETRSEGGFAANKVSAAAVLDVFTKSNKGKTYYYYEV  203

Query  329  LTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            LTRTADGDEGG+HQLI A+VS+G LY  K Q+GDKRWFKG  +
Sbjct  204  LTRTADGDEGGRHQLIAATVSDGDLYTMKLQSGDKRWFKGQER  246



>ref|XP_011396200.1| Oxygen-evolving enhancer protein 2, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23330.1| Oxygen-evolving enhancer protein 2, chloroplastic [Auxenochlorella 
protothecoides]
Length=255

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -2

Query  707  RMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTP  528
            R+F GK    + F+P  G+GF L +P+KWNPS E +FPG VLRYEDN+   +N+ V+  P
Sbjct  73   RVFAGKITNKSGFVPYAGEGFALLLPAKWNPSPERDFPGTVLRYEDNYFPVNNLMVIQRP  132

Query  527  TDKKSITDYGSPEEFLAQVDYLLGKQ-AYSGKTDSEGGFDPNAVATANILETSTPV-VGG  354
              K SI D G+P++FL+   +L G+  A+ G++ SEGGF PN V++A +L+        G
Sbjct  133  VGKNSIEDLGAPDKFLSDNAFLFGESAAWKGESRSEGGFKPNQVSSAALLDAEEATDKKG  192

Query  353  KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
             +YY  +VLTR+ADGDEGG+H L+TA+VSNG LYI K QAGDKRWFKG  K
Sbjct  193  HKYYKYAVLTRSADGDEGGRHHLVTATVSNGNLYILKIQAGDKRWFKGLSK  243



>gb|KIY95992.1| hypothetical protein MNEG_11971 [Monoraphidium neglectum]
Length=791

 Score =   184 bits (468),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 92/170 (54%), Positives = 115/170 (68%), Gaps = 4/170 (2%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPG---QVLRYEDNFDQTSNICVLVTP  528
            FGK    T F+P  G+GF L +PSKWNPSKE +F      VLRYEDN D  +N+ VL   
Sbjct  610  FGKVTNKTGFVPYAGEGFALLLPSKWNPSKEQDFAKFGTTVLRYEDNGDAVNNVVVLTAD  669

Query  527  TDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGK  351
            +DK  I+ YG PE FL  +  LLGKQA+SG+T SEGGF P  VA A++L+        GK
Sbjct  670  SDKSDISGYGEPEAFLQTLTPLLGKQAFSGETLSEGGFAPGRVAAASLLDVGEATDKKGK  729

Query  350  QYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            +YY   +L R+ADG+EGG+H LI+ASVS GKL++CK Q GDKRW KGA +
Sbjct  730  KYYRYEILARSADGNEGGRHILISASVSAGKLWVCKLQIGDKRWIKGANR  779



>gb|KDO44766.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=179

 Score =   170 bits (431),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE  423
            KSITDYGSPEEFL++VDYLLGKQAYSGKT SE
Sbjct  145  KSITDYGSPEEFLSKVDYLLGKQAYSGKTSSE  176


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGE+ANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYN  98



>gb|KIZ07080.1| hypothetical protein MNEG_0869 [Monoraphidium neglectum]
Length=233

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 110/167 (66%), Gaps = 16/167 (10%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGK    + F+P +G+GF + +PS               RYEDN D  +N+ VL  P DK
Sbjct  70   FGKVTNKSGFIPYSGEGFAILLPS---------------RYEDNGDSVNNVVVLTQPADK  114

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGKQYY  342
              IT YG+PE+ L  + +L G+Q++SG+T SEGGF P  V+ A++L+ S  +   GK+YY
Sbjct  115  GDITSYGAPEKLLQDLTFLFGRQSFSGETLSEGGFAPGRVSAASLLDVSEAIDKKGKKYY  174

Query  341  FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
               VLTR+ADGDEGGKH LI+A+VSNGKL+IC+ Q GDKRW KGA K
Sbjct  175  RYEVLTRSADGDEGGKHNLISATVSNGKLWICRVQIGDKRWIKGANK  221



>gb|KDO44761.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=204

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 97/169 (57%), Gaps = 58/169 (34%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDN                
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDN----------------  128

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYF  339
                                              FD N     NILE S        YYF
Sbjct  129  ----------------------------------FDSNT----NILEASVR----PPYYF  146

Query  338  ISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            +SVLTRTADGDEGGKHQLITA+V  GKLYICKAQAGDKRWFKG RK+VE
Sbjct  147  LSVLTRTADGDEGGKHQLITATVKGGKLYICKAQAGDKRWFKGTRKYVE  195


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGE+ANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYN  98



>gb|KCW89790.1| hypothetical protein EUGRSUZ_A02039 [Eucalyptus grandis]
Length=191

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  G+GF L +P+KWNPSKEVE+PGQVLRYEDNFD TSN+ V+VTPTDK
Sbjct  85   FGKPKTNTDFLPYNGNGFTLLIPAKWNPSKEVEYPGQVLRYEDNFDTTSNVSVMVTPTDK  144

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDP  408
            K+ITD+GSPE FLA+V+YLLGKQAY GKTDSE  F P
Sbjct  145  KAITDFGSPENFLAEVNYLLGKQAYFGKTDSEVVFKP  181


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGEAANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYN  98



>gb|EAZ02734.1| hypothetical protein OsI_24852 [Oryza sativa Indica Group]
Length=191

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNTEF+  +G+GFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++ PT K
Sbjct  77   FGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDNFDANSNVSVIINPTTK  136

Query  518  KSITDYGSPEEFLAQVDYLLGKQAYSGKTDSE  423
            K+IT++GSPEEFLAQVD+LLGKQAYSGKTDSE
Sbjct  137  KTITEFGSPEEFLAQVDFLLGKQAYSGKTDSE  168



>gb|AAP79210.1| photosystem II protein PsbP [Bigelowiella natans]
Length=288

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = -2

Query  710  PRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  531
            P   FGK   +  F+P   D +   +PSKW  S E +F   V RY+DNFD  +   ++  
Sbjct  105  PANVFGKVTNSKGFIPTKRDEYSFLLPSKWLYSTERDFDNIVERYQDNFDAVNFAAIIKK  164

Query  530  PTD-KKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VG  357
              D K S+   GSPEEFL   D+L GKQA++G+T SEGGF P +V+  ++L+        
Sbjct  165  KVDGKTSVDQLGSPEEFLKSCDFLFGKQAWTGETKSEGGFKPGSVSALSLLDIDERTDKK  224

Query  356  GKQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            G +YY   +L+RTADGDEGG+H+L++A+V NG+LYI   Q GDKRWFKG  K
Sbjct  225  GTKYYNYELLSRTADGDEGGRHKLVSAAVKNGQLYIVFIQVGDKRWFKGTDK  276



>gb|AAP48993.1| probable oxygen-evolving enhancer protein 2, partial [Vitis vinifera]
Length=98

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = -2

Query  461  LGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGKHQLI  282
            LGKQA+ G  + EGGFD +AVATANILE+ST  VGGK YY I+VLTRTADGDEGGKHQLI
Sbjct  1    LGKQAFFGNAN-EGGFDADAVATANILESSTTTVGGKPYYTITVLTRTADGDEGGKHQLI  59

Query  281  TASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            TA+V++GKLYICK QAGDKRWFKGARK+VE
Sbjct  60   TAAVADGKLYICKVQAGDKRWFKGARKYVE  89



>gb|ACF24545.1| photosystem II oxygen evolving enhancer protein 2 [Gymnochlora 
stellata]
Length=289

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 100/166 (60%), Gaps = 1/166 (1%)
 Frame = -2

Query  710  PRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  531
            P   FG+   +  F+P   D +   +PSKW  S E +F   + RY+DNFD  +   ++  
Sbjct  97   PANVFGRTTNSKGFIPTKRDDYSFLLPSKWIYSSERDFDDIIERYQDNFDAVNFGTIIKK  156

Query  530  PTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGG  354
               K SI   GSPEEFL   ++LLGKQ + G+T SEGGF P +VA  +IL+ +      G
Sbjct  157  SVGKSSIDQLGSPEEFLKSCEFLLGKQTWQGETKSEGGFRPGSVAAVSILDVAEKSDKKG  216

Query  353  KQYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWF  216
             +YY   +L+RTADGDEGG+H+LIT  V NG LYI   Q GDKRWF
Sbjct  217  TKYYQYELLSRTADGDEGGRHKLITGGVENGNLYILYIQVGDKRWF  262



>emb|CAA44291.1| 23-dDa polypeptide of Photosystem II oxygen-evolving complex 
[Nicotiana tabacum]
Length=166

 Score =   139 bits (350),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPK NT+FL   GDGFKLQVP+KWNPSKEVEFPGQVLRYEDNFD TSN+ V VTPTDK
Sbjct  91   FGKPKQNTDFLAYNGDGFKLQVPAKWNPSKEVEFPGQVLRYEDNFDSTSNLIVTVTPTDK  150

Query  518  KSITDYGSPEEFLAQV  471
            KSIT YGSPEEFL+QV
Sbjct  151  KSITGYGSPEEFLSQV  166


 Score = 44.7 bits (104),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRK  691
            IGAAAV  KVSPADAAYGEAANVF K
Sbjct  68   IGAAAVVSKVSPADAAYGEAANVFGK  93



>ref|XP_006437084.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
 gb|ESR50324.1| hypothetical protein CICLE_v10032502mg [Citrus clementina]
Length=195

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDPNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQV  471
            KSITDYGSPEEFL++V
Sbjct  145  KSITDYGSPEEFLSKV  160


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGE+ANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYN  98



>gb|KDO44764.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
 gb|KDO44765.1| hypothetical protein CISIN_1g025092mg [Citrus sinensis]
Length=223

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  698  FGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK  519
            FGKPKTNT+FLP  GDGFKL +PSKWNPSKE EFPGQVLRYEDNFD  SN+ V++TPTDK
Sbjct  85   FGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDK  144

Query  518  KSITDYGSPEEFLAQV  471
            KSITDYGSPEEFL++V
Sbjct  145  KSITDYGSPEEFLSKV  160


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEAANVFRKAE-NKHRIPAN  661
            IGAAAVG KVSPADAAYGE+ANVF K + N   +P N
Sbjct  62   IGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYN  98



>gb|ABS71999.1| putative chloroplast photosystem II 23kDa protein [Olea europaea]
Length=76

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  575  EDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVA  396
            EDNFD  SN+ V+VTPTDKKSI D+GSPE FL+QVDYLLGKQAY GKT+SEGGFD NAVA
Sbjct  1    EDNFDSNSNVSVMVTPTDKKSIADFGSPENFLSQVDYLLGKQAYFGKTESEGGFDANAVA  60

Query  395  TANILETSTPVVGGKQ  348
            TANILET TPV+GGKQ
Sbjct  61   TANILETDTPVIGGKQ  76



>ref|XP_005844169.1| hypothetical protein CHLNCDRAFT_139312 [Chlorella variabilis]
 gb|EFN52067.1| hypothetical protein CHLNCDRAFT_139312 [Chlorella variabilis]
Length=205

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 88/170 (52%), Gaps = 46/170 (27%)
 Frame = -2

Query  707  RMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTP  528
            R+F G     + F+P  GDGF + +PSKWNPSKE +FPG VLR           C     
Sbjct  69   RVFAGSITNKSGFIPYAGDGFAVLIPSKWNPSKEQDFPGVVLR----------CC-----  113

Query  527  TDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPV-VGGK  351
                                           T SEGGF PN  A A++L+        GK
Sbjct  114  ------------------------------PTLSEGGFAPNKTAAASVLDVQEATDKKGK  143

Query  350  QYYFISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARK  201
            +YY   VLTR ADGDEGG+HQL+ A+VSNG LY+ K Q GDKRWFKGA+K
Sbjct  144  KYYKFEVLTRAADGDEGGRHQLVAATVSNGNLYLLKVQCGDKRWFKGAKK  193



>ref|NP_001183682.1| uncharacterized protein LOC100502276 [Zea mays]
 gb|ACR37955.1| unknown [Zea mays]
Length=306

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%), Gaps = 0/176 (0%)
 Frame = +3

Query  171  AERTGRALDKLPRSLEPSLVACLCLADVKLSIGNAGSDQLVLPTFIAIRCSCQHRNEVVL  350
            AE  G  LD LP +LEP LVA L LADV+L++G+ G D+LVL   +A+R   QH + VVL
Sbjct  36   AEGGGGLLDALPGALEPPLVAGLRLADVELAVGDGGGDELVLAALVAVRRPGQHGDAVVL  95

Query  351  LSSDHWS*CLQYVCGGHSIRIKSSL*IGFARVGLFPKQIVHLSKEFlrgtvvgdgllvgg  530
            L+  H    LQ+V GGH + ++ +L +G A VGL  +Q+V L +E L G V+GDGLL GG
Sbjct  96   LAVHHGGGALQHVGGGHGVGLEPALGVGLAAVGLLAEQVVDLREELLGGAVLGDGLLGGG  155

Query  531  SDQDADVAGLVKVVFVSENLTGKLNFLARVPL*GNLQLESVSGDWQEFCVCFRLSE  698
             D D  VA  V+VV V+E+L G+L  LA VPL  + QLE+V+    E  V   L+E
Sbjct  156  LDDDGHVAVGVEVVLVAEHLPGELPLLAGVPLGRDQQLEAVADVGDEVRVLLGLAE  211



>dbj|BAH57013.1| AT1G06680 [Arabidopsis thaliana]
Length=95

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  308  DEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
            DEGGKHQLITA+V+ GKLYICKAQAGDKRWFKGARKFVE
Sbjct  48   DEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVE  86



>ref|WP_009554127.1| PsbP protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ71278.1| PsbP protein [Oscillatoriales cyanobacterium JSC-12]
Length=180

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 68/148 (46%), Gaps = 18/148 (12%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTD-KKSITDYGSPEEFLA  477
            DG++   P+ W   K  + P  V  + D  +QT N+ V++ P   +KS+ D G P     
Sbjct  35   DGYQFLYPNGWLEIKVSDGPDVV--FHDIIEQTENVSVVINPVSGEKSLKDLGDP----G  88

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
            QV Y L K A +          P +   A ++      V GKQYY +    + +D  E  
Sbjct  89   QVGYKLSKTAIA---------PPGSGREAELVSAEAREVDGKQYYLLEYFVKLSDNQE--  137

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFK  213
            +H L + +VS GKLY   A   + RW K
Sbjct  138  RHNLASVAVSRGKLYTFNASTPEARWEK  165



>ref|XP_002279556.1| PREDICTED: psbP-like protein 2, chloroplastic [Vitis vinifera]
 emb|CBI31729.3| unnamed protein product [Vitis vinifera]
Length=235

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 63/146 (43%), Gaps = 21/146 (14%)
 Frame = -2

Query  656  GDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLA  477
             DG+    P  W   +E EF G    ++D + Q  N+ V   PTDK+ I D G  EE + 
Sbjct  92   SDGYSYYYPLDW---REFEFRGHDSAFKDRYLQLQNVRVSFIPTDKRDIHDLGPMEEVVP  148

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
                 L K  Y+          PN +AT  IL+    VV GK YY +     +A+     
Sbjct  149  N----LVKNVYAA---------PNQIAT--ILDMQEKVVDGKNYYTVEYELTSANFSRAS  193

Query  296  KHQLITASVSNGKLYICKAQAGDKRW  219
                +  ++ NG+ Y     A ++RW
Sbjct  194  ---FVILAIGNGRFYTLNVGANERRW  216



>emb|CCC15105.1| oxygen-evolving enhancer protein 2 [Lepidodinium chlorophorum]
Length=191

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -2

Query  704  MFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT  525
            +F G+    + F   +GDGF L +PSKWNPSKE +F G VLRYE+N D+++++  L    
Sbjct  125  IFAGRATNPSGFSAYSGDGFSLLLPSKWNPSKEKDFDGVVLRYENNADRSNDLMGLKIKN  184

Query  524  DKKSITD  504
             K  + D
Sbjct  185  AKNKMED  191



>ref|XP_009612833.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=227

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 74/175 (42%), Gaps = 26/175 (15%)
 Frame = -2

Query  710  PRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  531
            P +  GKP+ N E      DG+    PS W   +E +F G    ++D + Q  N+ +   
Sbjct  67   PLLAQGKPE-NYEIFVDKQDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFI  122

Query  530  PTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGK  351
            PTDK  I D G  EE +A     L K  YS          PN VA  NI+E       GK
Sbjct  123  PTDKSDIRDLGPIEEVVAN----LVKHVYSA---------PNQVA--NIMEMRERSTDGK  167

Query  350  QYY-FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRW--FKGARKFV  195
             Y  F  VLT         +    T ++ NG+ Y     A ++RW  F+   K V
Sbjct  168  HYCTFEYVLT----SPNFSRAAFATIAIGNGRYYTLIVGANERRWRKFRNKLKLV  218



>ref|WP_041456005.1| photosystem II oxygen evolving complex protein PsbP [Anabaena 
variabilis]
Length=181

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P  D KS+ + G+P E 
Sbjct  34   TADGYEFLYPNGWLQVKVANGPDVV--FHDLIEISENISVVISPVPDDKSLKELGTPTE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +          P++  +A ++  S     GK YY +  L +  +  E
Sbjct  91   ---VGYKLGKAALA---------PPDSGRSAELVNASEYESEGKTYYHLEYLVKLPNQQE  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H + + +VS GKL+   A   +KRW K
Sbjct  139  --RHNIASVAVSRGKLFTFNASIPEKRWRK  166



>gb|ABA20458.1| Photosystem II oxygen evolving complex protein PsbP [Anabaena 
variabilis ATCC 29413]
Length=199

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P  D KS+ + G+P E 
Sbjct  52   TADGYEFLYPNGWLQVKVANGPDVV--FHDLIEISENISVVISPVPDDKSLKELGTPTE-  108

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +          P++  +A ++  S     GK YY +  L +  +  E
Sbjct  109  ---VGYKLGKAALA---------PPDSGRSAELVNASEYESEGKTYYHLEYLVKLPNQQE  156

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H + + +VS GKL+   A   +KRW K
Sbjct  157  --RHNIASVAVSRGKLFTFNASIPEKRWRK  184



>ref|WP_044521617.1| photosystem II oxygen evolving complex protein PsbP [Nostoc sp. 
PCC 7120]
Length=181

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P  D KS+ + G+P E 
Sbjct  34   TADGYEFSYPNGWLQVKVANGPDVV--FHDLIEISENISVVISPVPDDKSLQELGTPTE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +          P++  +A ++  S     G+ YY +  L +  +  E
Sbjct  91   ---VGYKLGKAALA---------PPDSGRSAELVNASEYESEGRTYYHLEYLVKLPNQQE  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H + + +VS GKL+   A   +KRW K
Sbjct  139  --RHNIASVAVSRGKLFTFNASIPEKRWRK  166



>ref|WP_040554030.1| photosystem II oxygen evolving complex protein PsbP [Raphidiopsis 
brookii]
Length=183

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 73/157 (46%), Gaps = 18/157 (11%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + N+ V+++P  + KS+T+ G+P E 
Sbjct  36   TEDGYQFSYPNGWLQVKVANGPDVV--FHDLIEVSENVSVVISPVPQGKSLTELGTPTE-  92

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A + +             +A ++  +   + G  YYF+    +  +G  
Sbjct  93   ---VGYKLGKSALAPEGSGR---------SAELVNVAQKEINGNNYYFLEYAVKLGNGQS  140

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H + + +VS GKL+   A   ++RW K  R   E
Sbjct  141  --RHNVASVAVSRGKLFTFNASVPERRWRKLQRTIDE  175



>ref|XP_010067371.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X2 [Eucalyptus 
grandis]
 ref|XP_010042548.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW65500.1| hypothetical protein EUGRSUZ_G02907 [Eucalyptus grandis]
Length=237

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 66/153 (43%), Gaps = 21/153 (14%)
 Frame = -2

Query  656  GDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLA  477
             DG+    PS W   +E +F G    ++D + Q  N+ V   PTDKK I D G  +E ++
Sbjct  94   SDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRVRFIPTDKKDIHDMGPMDEVVS  150

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
                 L K  Y+          PN +A  NI +T    V G+ YY      R+ +     
Sbjct  151  N----LVKNIYAT---------PNQIA--NIFDTQERTVDGRDYYTFEYELRSPNF---A  192

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
                 T +V+NG+ Y     A ++RW +   K 
Sbjct  193  SCSFATIAVANGRFYTLTVAANERRWRRVRNKL  225



>ref|XP_010067370.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X1 [Eucalyptus 
grandis]
 ref|XP_010042547.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X1 [Eucalyptus 
grandis]
Length=239

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 66/153 (43%), Gaps = 21/153 (14%)
 Frame = -2

Query  656  GDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLA  477
             DG+    PS W   +E +F G    ++D + Q  N+ V   PTDKK I D G  +E ++
Sbjct  96   SDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRVRFIPTDKKDIHDMGPMDEVVS  152

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
                 L K  Y+          PN +A  NI +T    V G+ YY      R+ +     
Sbjct  153  N----LVKNIYAT---------PNQIA--NIFDTQERTVDGRDYYTFEYELRSPNF---A  194

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
                 T +V+NG+ Y     A ++RW +   K 
Sbjct  195  SCSFATIAVANGRFYTLTVAANERRWRRVRNKL  227



>ref|WP_006276144.1| Photosystem II oxygen evolving complex protein PsbP [Cylindrospermopsis 
raciborskii]
 gb|EFA70961.1| Photosystem II oxygen evolving complex protein PsbP [Cylindrospermopsis 
raciborskii CS-505]
Length=186

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 72/153 (47%), Gaps = 18/153 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + N+ V+++P  + KS+T+ G+P E 
Sbjct  39   TEDGYQFSYPNGWLQVKVANGPDVV--FHDLIEVSENVSVVISPVPQGKSLTELGTPTE-  95

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A + +             +A ++  +   + G  YYF+    +  +G  
Sbjct  96   ---VGYKLGKSALAPEGSGR---------SAELVNVAQKEINGNNYYFLEYAVKLGNGQS  143

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGAR  204
              +H + + +VS GKL+   A   ++RW K  R
Sbjct  144  --RHNVASVAVSRGKLFTFNASVPERRWRKLQR  174



>gb|EFA72028.1| Photosystem II oxygen evolving complex protein PsbP [Raphidiopsis 
brookii D9]
Length=199

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 72/153 (47%), Gaps = 18/153 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + N+ V+++P  + KS+T+ G+P E 
Sbjct  52   TEDGYQFSYPNGWLQVKVANGPDVV--FHDLIEVSENVSVVISPVPQGKSLTELGTPTE-  108

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A + +             +A ++  +   + G  YYF+    +  +G  
Sbjct  109  ---VGYKLGKSALAPEGSGR---------SAELVNVAQKEINGNNYYFLEYAVKLGNGQS  156

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGAR  204
              +H + + +VS GKL+   A   ++RW K  R
Sbjct  157  --RHNVASVAVSRGKLFTFNASVPERRWRKLQR  187



>ref|WP_024969103.1| PsbP [Microcystis aeruginosa]
Length=182

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPIPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + GK YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGKDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>dbj|BAB74775.1| all3076 [Nostoc sp. PCC 7120]
Length=246

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P  D KS+ + G+P E 
Sbjct  99   TADGYEFSYPNGWLQVKVANGPDVV--FHDLIEISENISVVISPVPDDKSLQELGTPTE-  155

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +          P++  +A ++  S     G+ YY +  L +  +  E
Sbjct  156  ---VGYKLGKAALA---------PPDSGRSAELVNASEYESEGRTYYHLEYLVKLPNQQE  203

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H + + +VS GKL+   A   +KRW K
Sbjct  204  --RHNIASVAVSRGKLFTFNASIPEKRWRK  231



>ref|WP_002796693.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 emb|CCI24008.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa PCC 9809]
Length=182

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 67/152 (44%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W   +  +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVEVKKVAGVDVVFHDLIETSENLSVIINPIPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>gb|KDO67745.1| hypothetical protein CISIN_1g026701mg [Citrus sinensis]
Length=235

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 67/153 (44%), Gaps = 23/153 (15%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQ  474
            DG+    PS W    E EF G    ++D + Q  N+ V   PTDKK + D G  EE ++ 
Sbjct  93   DGYSYVYPSDWT---EFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEVVSN  149

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY-FISVLTRTADGDEGG  297
                L +  Y+          PN VA  +IL+     V GK YY F  +LT         
Sbjct  150  ----LARHVYAA---------PNQVA--DILDMQEKSVDGKNYYTFEYILT----SPNYS  190

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
               + T +++NG+ Y     A ++RW +   K 
Sbjct  191  SASIATIAIANGRYYTLIVGANERRWKRVRNKL  223



>ref|XP_006436071.1| hypothetical protein CICLE_v10032629mg [Citrus clementina]
 ref|XP_006486047.1| PREDICTED: psbP-like protein 2, chloroplastic-like [Citrus sinensis]
 gb|ESR49311.1| hypothetical protein CICLE_v10032629mg [Citrus clementina]
Length=235

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 67/153 (44%), Gaps = 23/153 (15%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQ  474
            DG+    PS W    E EF G    ++D + Q  N+ V   PTDKK + D G  EE ++ 
Sbjct  93   DGYSYVYPSDWT---EFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEVVSN  149

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY-FISVLTRTADGDEGG  297
                L +  Y+          PN VA  +IL+     V GK YY F  +LT         
Sbjct  150  ----LARHVYAA---------PNQVA--DILDMQEKSVDGKNYYTFEYILT----SPNYS  190

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
               + T +++NG+ Y     A ++RW +   K 
Sbjct  191  SASIATIAIANGRYYTLIVGANERRWKRVRNKL  223



>ref|WP_039715871.1| PsbP [Scytonema millei]
 gb|KIF18345.1| PsbP [Scytonema millei VB511283]
Length=181

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 71/153 (46%), Gaps = 18/153 (12%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLV-TPTDKKSITDYGSPEEFLA  477
            DG++   P+ W P K  + P  VL   D  + T N+ V++ +  D K++ D G+P +   
Sbjct  36   DGYEFLYPNGWLPVKVTDGPDIVL--HDLIETTENVSVVIGSIADGKTLADLGTPGD---  90

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
             V Y LGK A +          P++   A ++        GK YY +    +  D  +  
Sbjct  91   -VGYKLGKSAIA---------PPDSGREAELINAGQQDYNGKTYYILEYAVKLPDRQQ--  138

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            +H L + +VS GKL+   A   ++RW K A K 
Sbjct  139  RHNLASVAVSRGKLFTFNASTTEQRWQKAAPKL  171



>ref|XP_009762547.1| PREDICTED: psbP-like protein 2, chloroplastic [Nicotiana sylvestris]
Length=228

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 72/172 (42%), Gaps = 24/172 (14%)
 Frame = -2

Query  710  PRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  531
            P +  GKP+ N E      DG+    PS W   +E +F G    ++D + Q  N+ +   
Sbjct  67   PLLAQGKPE-NYEIFVDKQDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFI  122

Query  530  PTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGK  351
            P+DK  I D G  EE +A     L K  YS          PN VA  NI+E       GK
Sbjct  123  PSDKSDIHDLGPIEEVVAN----LVKHVYSA---------PNQVA--NIMEMRERSTDGK  167

Query  350  QYY-FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
             Y  F  VLT         +    T ++ NG+ Y     A ++RW K   K 
Sbjct  168  NYCTFEYVLT----SPNFSRAAFATIAIGNGRYYTLIVGANERRWRKFRNKL  215



>ref|WP_017291288.1| hypothetical protein [Leptolyngbya boryana]
Length=183

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 18/150 (12%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLA  477
            DG++   P+ W   K    P  V  + D  +QT NI +++ P   KK ++D G+P +   
Sbjct  38   DGYRFLYPNGWLSVKVANGPDVV--FHDIIEQTENISMVINPVPGKKKLSDLGTPSD---  92

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
             V Y LGK A +          P++   A ++      +  + YY +  L    + ++  
Sbjct  93   -VGYQLGKSAIA---------PPDSGRKAELISAEERQIADRTYYLLEYLVTLPNQEQ--  140

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGA  207
            +H L +A V  GKLY   A   + RW K A
Sbjct  141  RHNLASAIVYRGKLYTMNASTSETRWEKMA  170



>ref|WP_015202023.1| photosystem II oxygen evolving complex protein PsbP [Crinalium 
epipsammum]
 gb|AFZ11901.1| photosystem II oxygen evolving complex protein PsbP [Crinalium 
epipsammum PCC 9333]
Length=181

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (47%), Gaps = 19/150 (13%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            T D ++   P+ W   K     G  + + D  + T N+ V+++P  + K++ D G+P E 
Sbjct  35   TTDSYRFFYPNGWVAVKVKN--GADIVFHDIIEPTENVSVVISPVSRDKNLADLGTPGE-  91

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +          P++  TA ++      VG K YY +    +  + + 
Sbjct  92   ---VGYKLGKSAIA---------PPDSGRTAELVNAEAREVGAKNYYMLEYAVKLPNQE-  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H L + ++S GKLY   A   +KRW K
Sbjct  139  --RHNLASVAISRGKLYTFNASTTEKRWNK  166



>ref|WP_028083101.1| photosystem II oxygen evolving complex protein PsbP [Dolichospermum 
circinale]
Length=181

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (48%), Gaps = 18/157 (11%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            + DG++   P+ W   K  + P  V  + D  + + N+ V+++P    K++++ G+P E 
Sbjct  34   SADGYQFNYPNGWLQVKVADGPDVV--FHDLIEVSENVSVIISPVPAGKTLSELGTPSE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +   DS          TA ++  +   + GK YYF+    +  +G +
Sbjct  91   ---VGYKLGKAALA-PVDSG--------RTAELINAAQREINGKIYYFLEYEVKLPNGQK  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H + + +VS GKL+   A    KRW K  R   E
Sbjct  139  --RHNISSVAVSRGKLFTFNASVPQKRWKKIQRMIDE  173



>ref|WP_002801162.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 emb|CCI38767.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa PCC 9701]
Length=182

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_008205525.1| Genome sequencing data, contig C315 [Microcystis sp. T1-4]
 emb|CCI33813.1| Genome sequencing data, contig C315 [Microcystis sp. T1-4]
Length=182

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_002792247.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 emb|CCI21744.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa PCC 9808]
Length=182

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_016517298.1| PsbP [Microcystis aeruginosa]
 gb|EPF16051.1| PsbP [Microcystis aeruginosa SPC777]
Length=182

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_009632926.1| PsbP [Synechocystis sp. PCC 7509]
Length=181

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 74/153 (48%), Gaps = 18/153 (12%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLA  477
             G++   P+ W P K     G  + + D  + + N+ V+V+P  + K++ + G+P E   
Sbjct  36   SGYEFLYPNGWQPVKVAN--GADVVFHDLIEISENVSVVVSPVANGKTLAELGTPTE---  90

Query  476  QVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGG  297
             V Y L K A +          P++   A ++  ++  V GK+YY +    +  +  E  
Sbjct  91   -VGYKLSKSAIA---------PPDSGREAELVNAASREVKGKKYYLLEYAVKLPNQQE--  138

Query  296  KHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            +H L + +VS GKLY   A   ++RW K  ++F
Sbjct  139  RHNLASVAVSRGKLYTFNASTPERRWQKVQKQF  171



>ref|XP_006360615.1| PREDICTED: psbP-like protein 2, chloroplastic-like isoform X1 
[Solanum tuberosum]
Length=226

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 72/172 (42%), Gaps = 24/172 (14%)
 Frame = -2

Query  710  PRMFFGKPKTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVT  531
            P +  G P+ N E      DG+    PS W   +E +F G    ++D + Q  N+ +   
Sbjct  66   PLLAQGVPE-NYEIFVDKRDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFI  121

Query  530  PTDKKSITDYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGK  351
            PTDK  I D G  EE +      L K  YS          PN VA  NI+E       GK
Sbjct  122  PTDKSDIHDLGPMEEVVPD----LVKHVYSA---------PNQVA--NIMEMKERTTDGK  166

Query  350  QYY-FISVLTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
             Y+ F  VLT         +    T +++NG+ Y     A ++RW K   K 
Sbjct  167  NYFTFEYVLT----SPNFSRAAFATIAIANGRHYTLIVGANERRWRKFRNKL  214



>gb|AFZ03570.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
sp. PCC 6303]
Length=192

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 69/155 (45%), Gaps = 18/155 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P    KS+ + G+P E 
Sbjct  45   TTDGYQFSYPNGWVQVKVSNGPDVV--FHDIIEPSENISVVISPVPGGKSLVELGTPGE-  101

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A + +              A ++      V GKQYY +  L    +  +
Sbjct  102  ---VGYKLGKNALAPEGSGR---------QAELVNAGQREVEGKQYYKLEYLITLPNQQK  149

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
              +H L   SVS GKL+   A   DKRW K  R+ 
Sbjct  150  --RHNLAIVSVSRGKLFTFNASVTDKRWSKVKRQM  182



>ref|WP_012265569.1| photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 dbj|BAG02248.1| photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa NIES-843]
Length=182

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPIPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>dbj|BAH57265.1| AT1G06680 [Arabidopsis thaliana]
Length=168

 Score = 43.9 bits (102),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  691  SRKQTQNSCQSPETDSSCRFPQSGTLARKLSFPVRFSDTKTTLTKPATSASW  536
            S+++TQ SC + E  S CRF Q+GT A++LS   +   +KTT    A S SW
Sbjct  92   SQRRTQTSCHTMEMGSKCRFQQNGTQAKRLSIQDKSLGSKTTSMLLAISMSW  143


 Score = 40.4 bits (93),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/20 (90%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = -1

Query  768  IGAAAVGXKVSPADAAYGEA  709
            +GAAAVG KVSPADAAYGEA
Sbjct  63   VGAAAVGSKVSPADAAYGEA  82



>ref|WP_028089888.1| photosystem II oxygen evolving complex protein PsbP [Dolichospermum 
circinale]
Length=181

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (48%), Gaps = 18/157 (11%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            + DG++   P+ W   K  + P  V  + D  + + N+ V+++P    K++++ G+P E 
Sbjct  34   SADGYQFNYPNGWLQVKVADGPDVV--FHDLIEVSENVSVIISPVPAGKTLSELGTPSE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +   DS          TA ++  +   + GK YYF+    +  +G +
Sbjct  91   ---VGYKLGKAALA-PVDSG--------RTAELINAAQREINGKIYYFLEYEVKLPNGQK  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H + + +VS GKL+   A    KRW K  R   E
Sbjct  139  --RHNISSVAVSRGKLFTFNASIPQKRWKKIQRMIDE  173



>ref|WP_041740865.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
parietina]
Length=181

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 69/155 (45%), Gaps = 18/155 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + NI V+++P    KS+ + G+P E 
Sbjct  34   TTDGYQFSYPNGWVQVKVSNGPDVV--FHDIIEPSENISVVISPVPGGKSLVELGTPGE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A + +              A ++      V GKQYY +  L    +  +
Sbjct  91   ---VGYKLGKNALAPEGSGR---------QAELVNAGQREVEGKQYYKLEYLITLPNQQK  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
              +H L   SVS GKL+   A   DKRW K  R+ 
Sbjct  139  --RHNLAIVSVSRGKLFTFNASVTDKRWSKVKRQM  171



>ref|XP_006360616.1| PREDICTED: psbP-like protein 2, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=223

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 68/164 (41%), Gaps = 23/164 (14%)
 Frame = -2

Query  686  KTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSIT  507
            + N E      DG+    PS W   +E +F G    ++D + Q  N+ +   PTDK  I 
Sbjct  70   QENYEIFVDKRDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFIPTDKSDIH  126

Query  506  DYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY-FISV  330
            D G  EE +      L K  YS          PN VA  NI+E       GK Y+ F  V
Sbjct  127  DLGPMEEVVPD----LVKHVYSA---------PNQVA--NIMEMKERTTDGKNYFTFEYV  171

Query  329  LTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            LT         +    T +++NG+ Y     A ++RW K   K 
Sbjct  172  LT----SPNFSRAAFATIAIANGRHYTLIVGANERRWRKFRNKL  211



>ref|XP_006574866.1| PREDICTED: psbP-like protein 1, chloroplastic-like isoform X2 
[Glycine max]
Length=247

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 69/155 (45%), Gaps = 23/155 (15%)
 Frame = -2

Query  671  FLPITG--DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            FLP+    DG+    P  W   +EV   GQ   ++D  +   N+ V V PT K+ IT++G
Sbjct  97   FLPVLDKKDGYSFLYPFGW---QEVVIEGQDKVFKDVIEPLENVSVNVIPTGKQDITEFG  153

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
            SP+E    V   L K+  +          PN      I+E     V GK+YY    +   
Sbjct  154  SPQE----VAETLIKKVLA---------PPN--QKTKIVEAKELDVEGKKYYQFEFI---  195

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFK  213
            A      +H L T S+ NGK Y     A ++RW K
Sbjct  196  AQAPNYTRHALSTVSIGNGKFYTLTTGANERRWVK  230



>ref|XP_003518660.2| PREDICTED: psbP-like protein 1, chloroplastic-like isoform X1 
[Glycine max]
Length=248

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 69/155 (45%), Gaps = 23/155 (15%)
 Frame = -2

Query  671  FLPITG--DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            FLP+    DG+    P  W   +EV   GQ   ++D  +   N+ V V PT K+ IT++G
Sbjct  98   FLPVLDKKDGYSFLYPFGW---QEVVIEGQDKVFKDVIEPLENVSVNVIPTGKQDITEFG  154

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
            SP+E    V   L K+  +          PN      I+E     V GK+YY    +   
Sbjct  155  SPQE----VAETLIKKVLA---------PPN--QKTKIVEAKELDVEGKKYYQFEFI---  196

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFK  213
            A      +H L T S+ NGK Y     A ++RW K
Sbjct  197  AQAPNYTRHALSTVSIGNGKFYTLTTGANERRWVK  231



>ref|WP_002789162.1| Genome sequencing data, contig C315 [Microcystis aeruginosa]
 emb|CCI19132.1| Genome sequencing data, contig C315 [Microcystis aeruginosa PCC 
9807]
Length=182

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNHKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_002758996.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 emb|CCH96737.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa PCC 9717]
Length=182

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNHKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_039201026.1| photosystem II oxygen evolving complex protein PsbP [Aphanizomenon 
flos-aquae]
 gb|KHG39995.1| photosystem II oxygen evolving complex protein PsbP [Aphanizomenon 
flos-aquae 2012/KM1/D3]
 gb|KHG42067.1| photosystem II oxygen evolving complex protein PsbP [Aphanizomenon 
flos-aquae 2012/KM1/D3]
Length=181

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 18/157 (11%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            + DG++   P+ W   K  + P  V  + D  + + N+ V+++P    K++ + G+P E 
Sbjct  34   SADGYQFDYPNGWLQVKVGDGPDVV--FHDLIEVSENVSVVISPVASGKTLAELGTPTE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +               TA ++  +   V GK YYF+    +  +G E
Sbjct  91   ---VGYKLGKAALAPVGSDR---------TAELINAAEREVNGKIYYFLEYAVKFPNGQE  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H + + ++S GKL+   A   +KRW K  R   E
Sbjct  139  --RHNISSVAISRGKLFTFNASVPEKRWKKLQRMIDE  173



>ref|WP_002740438.1| psbP protein [Microcystis aeruginosa]
 emb|CAO90668.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS50130.1| psbP protein [Microcystis aeruginosa DIANCHI905]
Length=182

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    + A+G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQIKLANGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNHKLYSFNLSTSQKRWTQIQELF  172



>ref|XP_009612834.1| PREDICTED: psbP-like protein 2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=224

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 69/167 (41%), Gaps = 25/167 (15%)
 Frame = -2

Query  686  KTNTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSIT  507
            + N E      DG+    PS W   +E +F G    ++D + Q  N+ +   PTDK  I 
Sbjct  71   QENYEIFVDKQDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFIPTDKSDIR  127

Query  506  DYGSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY-FISV  330
            D G  EE +A     L K  YS          PN VA  NI+E       GK Y  F  V
Sbjct  128  DLGPIEEVVAN----LVKHVYSA---------PNQVA--NIMEMRERSTDGKHYCTFEYV  172

Query  329  LTRTADGDEGGKHQLITASVSNGKLYICKAQAGDKRW--FKGARKFV  195
            LT         +    T ++ NG+ Y     A ++RW  F+   K V
Sbjct  173  LT----SPNFSRAAFATIAIGNGRYYTLIVGANERRWRKFRNKLKLV  215



>ref|WP_027404260.1| photosystem II oxygen evolving complex protein PsbP [Aphanizomenon 
flos-aquae]
Length=181

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 18/157 (11%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            + DG++   P+ W   K  + P  V  + D  + + N+ V+++P    K++ + G+P E 
Sbjct  34   SADGYQFDYPNGWLQVKVGDGPDVV--FHDLIEVSENVSVVISPVASGKTLAELGTPTE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +               TA ++  +   V GK YYF+    +  +G E
Sbjct  91   ---VGYKLGKAALAPVGSDR---------TAELINAAEREVDGKIYYFLEYAVKFPNGQE  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H + + ++S GKL+   A   +KRW K  R   E
Sbjct  139  --RHNISSVAISRGKLFTFNASVPEKRWKKLQRMIDE  173



>ref|XP_003552675.1| PREDICTED: uncharacterized LOC100305918 [Glycine max]
 gb|KHN13868.1| PsbP-like protein 1, chloroplastic [Glycine soja]
Length=236

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 68/153 (44%), Gaps = 23/153 (15%)
 Frame = -2

Query  671  FLPITG--DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            FLP+    DG+    P  W   +EV   GQ   ++D  +   N+ V V PT K+ IT++G
Sbjct  86   FLPVLDKKDGYSFLYPFGW---QEVVIEGQDKVFKDVIEPLENVSVNVIPTGKQDITEFG  142

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
            SP+E    V   L K+  +          PN      I+E     V GK+YY    +   
Sbjct  143  SPQE----VAETLIKKVLA---------PPN--QKTKIVEAKEQDVEGKKYYQFEFI---  184

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGDKRW  219
            A      +H L T S+ NGK Y     A ++RW
Sbjct  185  AKAPNYTRHALSTVSIGNGKFYTLTTGANERRW  217



>ref|WP_011610056.1| photosystem II oxygen evolving complex protein PsbP [Trichodesmium 
erythraeum]
 gb|ABG49658.1| photosystem II oxygen evolving complex protein PsbP [Trichodesmium 
erythraeum IMS101]
Length=180

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 73/155 (47%), Gaps = 18/155 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTP-TDKKSITDYGSPEEF  483
            T DG++   P+ W   K  + P  V  + D  + T N+ V+++P  ++K+++D G+P + 
Sbjct  33   TTDGYEFLYPNGWIEVKVSDGPDVV--FHDLVEATENVSVVISPMVEEKTLSDLGTPTD-  89

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y L K A + K         NA A     E  T     K YY +    + ADG E
Sbjct  90   ---VGYRLSKNAIAPKDSGREAELVNAEAR----EYKT-----KTYYKLEYAVKLADGRE  137

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
              +H L + +VS GKL+       +KRW K   KF
Sbjct  138  --RHNLASVAVSRGKLFTINISTTEKRWEKVNDKF  170



>ref|WP_006104633.1| PsbP [Coleofasciculus chthonoplastes]
 gb|EDX72357.1| PsbP [Coleofasciculus chthonoplastes PCC 7420]
Length=179

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 69/157 (44%), Gaps = 19/157 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W P K  + P  V R  D  +QT N+ V++ P  +  ++TD G+P E 
Sbjct  33   TADGYEFLYPNGWVPIKVTDGPDVVFR--DLIEQTENVSVVINPVPENTTLTDLGTPGE-  89

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y L +   S           N+     +++      G K YY +    +    + 
Sbjct  90   ---VGYQLQQNVLSAA---------NSNRQVELVDAKARDTGDKTYYLLEYSVKLPSQN-  136

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFKGARKFVE  192
              +H L TA +S+ KLY   A   ++RW K    F +
Sbjct  137  --RHDLATAVISHDKLYTLNASTTEERWDKVQDLFTQ  171



>ref|WP_002731843.1| psbP protein [Microcystis aeruginosa]
 gb|ELP55585.1| psbP protein [Microcystis aeruginosa TAIHU98]
Length=182

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W   +  +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVEVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    +  +G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLVNGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNHKLYSFNLSTSQKRWTQIQELF  172



>gb|AFK34664.1| unknown [Lotus japonicus]
Length=240

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 69/153 (45%), Gaps = 23/153 (15%)
 Frame = -2

Query  671  FLPITG--DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYG  498
            FLP+T   DG+    P  W   +EV   GQ   ++D  +   ++ V + PT K++I ++G
Sbjct  90   FLPVTDQKDGYTFIYPFGW---QEVSIEGQDKVFKDVIEPLESVSVNIIPTGKQNIKEFG  146

Query  497  SPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRT  318
             P+    QV   L K+  +          PN      I+E +   V GK YY    +   
Sbjct  147  PPQ----QVGETLIKRVLA---------PPNQ--KTKIIEATEQDVDGKTYYRFEFI---  188

Query  317  ADGDEGGKHQLITASVSNGKLYICKAQAGDKRW  219
            A      +H L T SVSNGK Y     A ++RW
Sbjct  189  AQAPNYTRHALSTVSVSNGKFYTLTTGANERRW  221



>ref|XP_004248685.1| PREDICTED: psbP-like protein 2, chloroplastic [Solanum lycopersicum]
Length=227

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 67/162 (41%), Gaps = 23/162 (14%)
 Frame = -2

Query  680  NTEFLPITGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDY  501
            N E      DG+    PS W   +E +F G    ++D + Q  N+ +   PTDK  I D 
Sbjct  76   NYEIFVDKRDGYSYYYPSDW---REFDFRGHDSAFKDRYLQLQNVRLSFIPTDKTDIHDL  132

Query  500  GSPEEFLAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYY-FISVLT  324
            G  +E +      L K  YS          PN VA  NI+E       GK Y+ F  VLT
Sbjct  133  GPMQEVVPD----LVKHVYSA---------PNQVA--NIMEMKERTTDGKNYFTFEYVLT  177

Query  323  RTADGDEGGKHQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
                     +    T +++NG+ Y     A ++RW K   K 
Sbjct  178  ----SPNFSRAAFATIAIANGRYYTLIVGANERRWRKFRNKL  215



>ref|WP_002783248.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa]
 emb|CCI12845.1| Photosystem II oxygen-evolving complex 23K protein [Microcystis 
aeruginosa PCC 9806]
Length=182

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 66/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W   +  +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVEVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    +  +G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLPNGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



>ref|WP_015132230.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
sp. PCC 7507]
 gb|AFY36442.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
sp. PCC 7507]
Length=181

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 71/148 (48%), Gaps = 18/148 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + + N+ V+++P    K++T+ G+P E 
Sbjct  34   TIDGYQFLYPNGWVQVKVANGPDVV--FHDLIEVSENVSVVISPVPGGKTLTELGTPTE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LGK A +  TDS            N LE  +    GK+YY +  L +  D  E
Sbjct  91   ---VGYKLGKVALA-PTDSG-----RTAELVNALERES---DGKKYYILEYLVKLPDKQE  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRW  219
              +H + + +VS GKL+   A   +KRW
Sbjct  139  --RHNVASVAVSRGKLFTFNASIPEKRW  164



>ref|WP_035157088.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
sp. 336/3]
 gb|KFB85606.1| photosystem II oxygen evolving complex protein PsbP [Calothrix 
sp. 336/3]
Length=181

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 67/150 (45%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            T DG++   P+ W   K    P  V  + D  + T NI V+++P  K K++ + G+P E 
Sbjct  34   TNDGYQFLYPNGWVQVKVANGPDVV--FHDIIETTENISVVISPVPKGKTLAELGTPGE-  90

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y LG  A + +              A ++      V GK YY +  L    +  +
Sbjct  91   ---VGYKLGNNALAPEGSGR---------KAELVNAEQREVKGKNYYLLEYLVTLPNNKQ  138

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H L + +VS GKL+   A   ++RW K
Sbjct  139  --RHNLASVAVSRGKLFTFNASVSERRWQK  166



>ref|WP_002775529.1| Genome sequencing data, contig C315 [Microcystis aeruginosa]
 emb|CCI05990.1| Genome sequencing data, contig C315 [Microcystis aeruginosa PCC 
7941]
Length=182

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 65/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    +  +G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLVNGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNHKLYSFNLSTSQKRWTQIQELF  172



>ref|XP_007142714.1| hypothetical protein PHAVU_007G010700g [Phaseolus vulgaris]
 gb|ESW14708.1| hypothetical protein PHAVU_007G010700g [Phaseolus vulgaris]
Length=235

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 61/145 (42%), Gaps = 21/145 (14%)
 Frame = -2

Query  653  DGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDKKSITDYGSPEEFLAQ  474
            DG+    P  W   KE +F      ++D   Q  N+ V   PT+KK I D G  EE    
Sbjct  93   DGYSYVYPRDW---KEFDFLAHDSAFKDKLLQLQNVRVRFIPTEKKDIRDLGPMEE----  145

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K  Y+          PN + T N +E  T  + GK YY    +  + +      
Sbjct  146  VIYFLVKHRYAA---------PNQIPTINGMEEKT--IDGKHYYTFEYILTSPNYSSAS-  193

Query  293  HQLITASVSNGKLYICKAQAGDKRW  219
              + T ++ NG+ Y     A ++RW
Sbjct  194  --IATIAIGNGRYYTLIVGANERRW  216



>ref|WP_036535616.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF71829.1| hypothetical protein DO97_14855 [Neosynechococcus sphagnicola 
sy1]
Length=183

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 65/150 (43%), Gaps = 18/150 (12%)
 Frame = -2

Query  659  TGDGFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPTDK-KSITDYGSPEEF  483
            + DG+    P  W P K    P  V  + D  +Q+ N+ V++ P    K++ D G+P E 
Sbjct  35   SSDGYAFLYPVGWAPVKVTSGPDIV--FHDLIEQSENVSVVINPIPAGKTLEDLGTPGE-  91

Query  482  LAQVDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDE  303
               V Y L K A +          P +   A ++      +  K YY +      ++  +
Sbjct  92   ---VGYRLSKAAIA---------PPGSGRQAELVNAEARQIDAKTYYLLEYAVTLSNKQQ  139

Query  302  GGKHQLITASVSNGKLYICKAQAGDKRWFK  213
              +H L +A VS GKLY   A   +KRW K
Sbjct  140  --RHNLASAVVSRGKLYTFNASTTEKRWSK  167



>dbj|GAL95241.1| photosystem II oxygen evolving complex protein PsbP [Microcystis 
aeruginosa NIES-44]
Length=182

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 65/152 (43%), Gaps = 16/152 (11%)
 Frame = -2

Query  650  GFKLQVPSKWNPSKEVEFPGQVLRYEDNFDQTSNICVLVTPT-DKKSITDYGSPEEFLAQ  474
            G++   P  W      +  G  + + D  + + N+ V++ P  D K++TD G+P E    
Sbjct  36   GYQFLYPKGWTQVDVKKVAGVDVVFHDLIETSENLSVIINPVPDNKTLTDLGTPSE----  91

Query  473  VDYLLGKQAYSGKTDSEGGFDPNAVATANILETSTPVVGGKQYYFISVLTRTADGDEGGK  294
            V Y L K             +PN      ++ + +  + G+ YY +    +  +G E  +
Sbjct  92   VGYRLLKN---------NSLNPNLDKEVELIRSESHQIDGQDYYILEYQVKLPNGQE--R  140

Query  293  HQLITASVSNGKLYICKAQAGDKRWFKGARKF  198
            H L + +V+N KLY        KRW +    F
Sbjct  141  HNLASVTVNNNKLYSFNLSTSQKRWTQIQELF  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100