BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016P06

Length=816
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC47163.2|  CDPK1                                                   303   8e-96   Ipomoea nil [qian niu]
ref|XP_009620189.1|  PREDICTED: calcium-dependent protein kinase 3      292   1e-91   Nicotiana tomentosiformis
ref|XP_004244622.1|  PREDICTED: calcium-dependent protein kinase 3      290   9e-91   Solanum lycopersicum
ref|XP_006352261.1|  PREDICTED: calcium-dependent protein kinase ...    289   2e-90   Solanum tuberosum [potatoes]
ref|XP_009786035.1|  PREDICTED: calcium-dependent protein kinase 3      288   6e-90   Nicotiana sylvestris
gb|KHN25667.1|  Calcium-dependent protein kinase 3                      280   1e-88   Glycine soja [wild soybean]
gb|ACH85192.1|  calcium-dependent protein kinase CDPK5                  284   1e-88   Nicotiana tabacum [American tobacco]
gb|KDP25359.1|  hypothetical protein JCGZ_20515                         283   3e-88   Jatropha curcas
gb|KHN35055.1|  Calcium-dependent protein kinase 3                      278   1e-87   Glycine soja [wild soybean]
emb|CDP12100.1|  unnamed protein product                                278   1e-87   Coffea canephora [robusta coffee]
emb|CBI34415.3|  unnamed protein product                                278   2e-87   Vitis vinifera
ref|XP_003517491.2|  PREDICTED: calcium-dependent protein kinase ...    281   2e-87   
ref|XP_008239005.1|  PREDICTED: calcium-dependent protein kinase 3      277   4e-87   
gb|KHN16773.1|  Calcium-dependent protein kinase 3                      271   5e-87   Glycine soja [wild soybean]
emb|CAN61364.1|  hypothetical protein VITISV_032639                     278   1e-86   Vitis vinifera
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      280   1e-86   Eucalyptus grandis [rose gum]
ref|XP_004164365.1|  PREDICTED: calcium-dependent protein kinase ...    272   1e-86   
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...    279   1e-86   Sesamum indicum [beniseed]
ref|XP_003538256.1|  PREDICTED: calcium-dependent protein kinase ...    278   2e-86   Glycine max [soybeans]
gb|AGS15000.1|  calcium-dependent protein kinase 3                      278   3e-86   Vitis amurensis
ref|XP_002272270.1|  PREDICTED: calcium-dependent protein kinase 3      278   3e-86   Vitis vinifera
ref|XP_003525360.1|  PREDICTED: calcium-dependent protein kinase ...    278   3e-86   Glycine max [soybeans]
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      278   3e-86   Cucumis melo [Oriental melon]
ref|XP_009334485.1|  PREDICTED: calcium-dependent protein kinase 3      277   8e-86   Pyrus x bretschneideri [bai li]
ref|XP_002509886.1|  calcium-dependent protein kinase, putative         275   4e-85   Ricinus communis
ref|XP_007040387.1|  Calcium-dependent protein kinase 6 isoform 1       275   5e-85   
ref|XP_007209903.1|  hypothetical protein PRUPE_ppa004162mg             274   1e-84   Prunus persica
ref|XP_007160124.1|  hypothetical protein PHAVU_002G294500g             273   2e-84   Phaseolus vulgaris [French bean]
gb|KDO76376.1|  hypothetical protein CISIN_1g010013mg                   273   2e-84   Citrus sinensis [apfelsine]
ref|XP_006476469.1|  PREDICTED: calcium-dependent protein kinase ...    273   2e-84   Citrus sinensis [apfelsine]
ref|XP_006439443.1|  hypothetical protein CICLE_v10019724mg             273   2e-84   Citrus clementina [clementine]
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       273   3e-84   Cucumis sativus [cucumbers]
ref|XP_010676387.1|  PREDICTED: calcium-dependent protein kinase 3      273   3e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007158545.1|  hypothetical protein PHAVU_002G161200g             272   4e-84   Phaseolus vulgaris [French bean]
gb|KJB52214.1|  hypothetical protein B456_008G251000                    268   4e-84   Gossypium raimondii
ref|XP_004298849.1|  PREDICTED: calcium-dependent protein kinase 3      271   1e-83   Fragaria vesca subsp. vesca
ref|XP_004503656.1|  PREDICTED: calcium-dependent protein kinase ...    270   2e-83   Cicer arietinum [garbanzo]
ref|XP_010261434.1|  PREDICTED: calcium-dependent protein kinase ...    271   3e-83   Nelumbo nucifera [Indian lotus]
ref|XP_002298000.1|  calcium-dependent protein kinase 1                 270   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011026960.1|  PREDICTED: calcium-dependent protein kinase 3      270   3e-83   Populus euphratica
emb|CAC83060.1|  calcium dependent calmodulin independent protein...    267   3e-83   Cucumis sativus [cucumbers]
gb|KHG11508.1|  Calcium-dependent protein kinase 3                      270   4e-83   Gossypium arboreum [tree cotton]
ref|XP_003611046.1|  Calcium dependent protein kinase                   270   5e-83   Medicago truncatula
gb|KEH21166.1|  calmodulin-domain kinase CDPK protein                   270   6e-83   Medicago truncatula
gb|KJB52213.1|  hypothetical protein B456_008G251000                    270   6e-83   Gossypium raimondii
ref|XP_002304529.2|  hypothetical protein POPTR_0003s13380g             269   1e-82   
ref|XP_011022588.1|  PREDICTED: calcium-dependent protein kinase ...    268   2e-82   Populus euphratica
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            268   2e-82   Cucumis sativus [cucumbers]
ref|XP_010251583.1|  PREDICTED: calcium-dependent protein kinase ...    268   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_004511540.1|  PREDICTED: calcium-dependent protein kinase ...    267   4e-82   Cicer arietinum [garbanzo]
ref|XP_010106587.1|  Calcium-dependent protein kinase 3                 270   4e-82   
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    264   1e-80   Phoenix dactylifera
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    261   9e-80   Elaeis guineensis
ref|XP_006849377.1|  hypothetical protein AMTR_s00158p00082100          261   2e-79   Amborella trichopoda
gb|KHG03431.1|  Calcium-dependent protein kinase 3                      262   3e-79   Gossypium arboreum [tree cotton]
ref|XP_011080890.1|  PREDICTED: calcium-dependent protein kinase 3      255   7e-78   Sesamum indicum [beniseed]
gb|KJB19075.1|  hypothetical protein B456_003G084000                    256   7e-78   Gossypium raimondii
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg                256   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    256   2e-77   Elaeis guineensis
ref|XP_009406794.1|  PREDICTED: calcium-dependent protein kinase ...    252   1e-76   
ref|XP_009137376.1|  PREDICTED: calcium-dependent protein kinase 3      249   2e-76   Brassica rapa
emb|CDY10955.1|  BnaA03g46140D                                          249   2e-76   Brassica napus [oilseed rape]
ref|XP_010541306.1|  PREDICTED: calcium-dependent protein kinase 3      251   7e-76   Tarenaya hassleriana [spider flower]
ref|XP_010433881.1|  PREDICTED: calcium-dependent protein kinase ...    251   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010509303.1|  PREDICTED: calcium-dependent protein kinase 3      251   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006283520.1|  hypothetical protein CARUB_v10004572mg             251   2e-75   Capsella rubella
gb|AGF69185.1|  calcium-dependent protein kinase 3-like 1               241   2e-75   Triticum aestivum [Canadian hard winter wheat]
gb|KFK28919.1|  hypothetical protein AALP_AA7G065000                    249   4e-75   Arabis alpina [alpine rockcress]
ref|XP_009137374.1|  PREDICTED: calcium-dependent protein kinase ...    249   7e-75   Brassica rapa
ref|XP_010529626.1|  PREDICTED: calcium-dependent protein kinase ...    248   8e-75   Tarenaya hassleriana [spider flower]
emb|CDY62741.1|  BnaC07g50270D                                          251   9e-75   Brassica napus [oilseed rape]
ref|XP_008656081.1|  PREDICTED: calcium-dependent protein kinase ...    249   9e-75   Zea mays [maize]
gb|AGG35973.1|  calcium-dependent protein kinase 3                      248   9e-75   Brassica napus [oilseed rape]
ref|XP_010439150.1|  PREDICTED: calcium-dependent protein kinase ...    249   9e-75   Camelina sativa [gold-of-pleasure]
emb|CDY44125.1|  BnaA01g13330D                                          248   1e-74   Brassica napus [oilseed rape]
ref|XP_006655639.1|  PREDICTED: calcium-dependent protein kinase ...    247   1e-74   
gb|EEE64852.1|  hypothetical protein OsJ_19709                          248   1e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137281.1|  PREDICTED: calcium-dependent protein kinase ...    248   2e-74   Brassica rapa
ref|XP_003567831.1|  PREDICTED: calcium-dependent protein kinase ...    248   2e-74   Brachypodium distachyon [annual false brome]
gb|EEC79771.1|  hypothetical protein OsI_21169                          244   2e-74   Oryza sativa Indica Group [Indian rice]
tpg|DAA58513.1|  TPA: putative calcium-dependent protein kinase f...    241   2e-74   
ref|XP_002441592.1|  hypothetical protein SORBIDRAFT_09g029950          248   3e-74   Sorghum bicolor [broomcorn]
gb|AIU98501.1|  calcium-dependent protein kinase                        247   3e-74   Musa acuminata AAA Group [Cavendish banana]
gb|AIU98505.1|  calcium-dependent protein kinase                        247   3e-74   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002867697.1|  calcium-dependent protein kinase 6                 247   4e-74   
gb|AAL38596.1|AF446863_1  AT4g23650/F9D16_120                           247   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194096.1|  calcium-dependent protein kinase 6                    247   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056455.1|  Os05g0585500                                       247   5e-74   
gb|EMT20115.1|  Calcium-dependent protein kinase 3                      241   7e-74   
ref|XP_006413532.1|  hypothetical protein EUTSA_v10024899mg             246   7e-74   Eutrema salsugineum [saltwater cress]
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...    246   8e-74   Phoenix dactylifera
emb|CDY54853.1|  BnaC01g15460D                                          246   8e-74   Brassica napus [oilseed rape]
ref|XP_004961071.1|  PREDICTED: calcium-dependent protein kinase ...    246   8e-74   Setaria italica
gb|EMT22025.1|  Calcium-dependent protein kinase 3                      245   9e-74   
gb|AHN16201.1|  CPK3-2.1                                                246   1e-73   Brassica napus [oilseed rape]
ref|XP_009416404.1|  PREDICTED: calcium-dependent protein kinase ...    245   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46165.1|  Calcium-dependent protein kinase 3                      240   2e-73   Triticum urartu
dbj|BAJ94561.1|  predicted protein                                      245   2e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569386.1|  PREDICTED: calcium-dependent protein kinase ...    244   3e-73   Brachypodium distachyon [annual false brome]
ref|XP_009386326.1|  PREDICTED: calcium-dependent protein kinase ...    244   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004969206.1|  PREDICTED: calcium-dependent protein kinase ...    244   7e-73   Setaria italica
ref|NP_001152509.1|  calcium-dependent protein kinase, isoform 2        243   9e-73   Zea mays [maize]
gb|EAZ12734.1|  hypothetical protein OsJ_02652                          243   1e-72   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD61167.1|  putative calcium-dependent protein kinase              247   2e-72   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA58514.1|  TPA: putative calcium-dependent protein kinase f...    241   2e-72   
emb|CAF18446.1|  putative calcium-dependent protein kinase              241   5e-72   Triticum aestivum [Canadian hard winter wheat]
gb|KJB39673.1|  hypothetical protein B456_007G025000                    241   6e-72   Gossypium raimondii
ref|NP_001169721.1|  uncharacterized LOC100383602                       241   6e-72   Zea mays [maize]
gb|EEC71113.1|  hypothetical protein OsI_02910                          241   7e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_006644382.1|  PREDICTED: calcium-dependent protein kinase ...    239   8e-72   Oryza brachyantha
ref|XP_002455974.1|  hypothetical protein SORBIDRAFT_03g028340          241   8e-72   Sorghum bicolor [broomcorn]
dbj|BAJ95679.1|  predicted protein                                      241   9e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA81749.1|  calcium-dependent protein kinase                       239   7e-71   Marchantia polymorpha
gb|KHG14847.1|  Calcium-dependent protein kinase 3                      238   1e-70   Gossypium arboreum [tree cotton]
gb|EPS65220.1|  hypothetical protein M569_09555                         236   1e-70   Genlisea aurea
gb|KDO62722.1|  hypothetical protein CISIN_1g0096581mg                  230   2e-70   Citrus sinensis [apfelsine]
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                237   3e-70   Erythranthe guttata [common monkey flower]
gb|ABY59010.1|  calcium-dependent protein kinase                        236   4e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009385897.1|  PREDICTED: calcium-dependent protein kinase ...    236   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    236   4e-70   Nicotiana tomentosiformis
gb|ACA63885.1|  calcium-dependent protein kinase                        236   4e-70   Hordeum vulgare [barley]
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    234   2e-69   Nicotiana sylvestris
dbj|BAA81748.1|  calcium-dependent protein kinase                       234   4e-69   Marchantia polymorpha
ref|XP_011090473.1|  PREDICTED: calcium-dependent protein kinase ...    233   4e-69   Sesamum indicum [beniseed]
gb|KHN11921.1|  Calcium-dependent protein kinase 9                      230   5e-69   Glycine soja [wild soybean]
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    233   8e-69   Nicotiana sylvestris
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     233   8e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-68   Nicotiana tomentosiformis
gb|KJB09335.1|  hypothetical protein B456_001G135000                    232   1e-68   Gossypium raimondii
gb|AAZ76712.1|  calcium-dependent protein kinase 1                      233   1e-68   Petunia integrifolia subsp. inflata
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    233   1e-68   Cucumis melo [Oriental melon]
emb|CDX97174.1|  BnaC09g44510D                                          233   1e-68   
gb|AAC25423.1|  calcium-dependent protein kinase                        233   1e-68   Nicotiana tabacum [American tobacco]
gb|KHN38276.1|  Calcium-dependent protein kinase 33                     229   1e-68   Glycine soja [wild soybean]
emb|CDX70450.1|  BnaC03g05340D                                          233   1e-68   
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    232   1e-68   Brassica rapa
gb|EPS70504.1|  calcium dependent protein kinase 25                     233   1e-68   Genlisea aurea
emb|CDP20327.1|  unnamed protein product                                233   1e-68   Coffea canephora [robusta coffee]
gb|AAL59948.1|  putative calcium-dependent protein kinase               233   1e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78468.1|  BnaA03g03800D                                          232   1e-68   
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             233   2e-68   Capsella rubella
gb|AHG06449.1|  calcium-dependent protein kinase 17                     232   2e-68   Brassica napus [oilseed rape]
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     231   2e-68   Glycine soja [wild soybean]
ref|NP_196779.1|  calcium-dependent protein kinase 17                   232   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871516.1|  calcium-dependent protein kinase 17                232   2e-68   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    232   2e-68   Arabis alpina [alpine rockcress]
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     232   2e-68   Brassica rapa
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    232   2e-68   Sesamum indicum [beniseed]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    232   2e-68   Arabis alpina [alpine rockcress]
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             232   2e-68   Citrus clementina [clementine]
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...    232   3e-68   Nicotiana tomentosiformis
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    233   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    232   3e-68   Prunus mume [ume]
gb|AGG35954.1|  calcium-dependent protein kinase 34                     230   3e-68   Brassica napus [oilseed rape]
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    232   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                232   3e-68   Theobroma cacao [chocolate]
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     231   3e-68   Brassica rapa
emb|CDY44912.1|  BnaA02g04170D                                          231   3e-68   Brassica napus [oilseed rape]
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    232   4e-68   Glycine max [soybeans]
emb|CDY63783.1|  BnaCnng42690D                                          231   4e-68   Brassica napus [oilseed rape]
emb|CDX91168.1|  BnaC02g04290D                                          231   4e-68   
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17     231   5e-68   Tarenaya hassleriana [spider flower]
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         231   5e-68   Jatropha curcas
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     231   6e-68   Brassica rapa
emb|CDY13993.1|  BnaC09g38330D                                          231   6e-68   Brassica napus [oilseed rape]
gb|KJB21813.1|  hypothetical protein B456_004G015100                    231   7e-68   Gossypium raimondii
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17     231   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             231   8e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...    231   8e-68   
ref|XP_002313265.1|  calcium-dependent protein kinase                   230   9e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         230   1e-67   Ricinus communis
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_002873943.1|  calcium-dependent protein kinase 34                230   1e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     230   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                230   1e-67   Morus notabilis
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    230   1e-67   Eucalyptus grandis [rose gum]
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             230   1e-67   Phaseolus vulgaris [French bean]
ref|XP_008384073.1|  PREDICTED: calcium-dependent protein kinase ...    226   1e-67   
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             230   1e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    229   1e-67   Brassica rapa
gb|KHN35744.1|  Calcium-dependent protein kinase 33                     226   1e-67   Glycine soja [wild soybean]
ref|NP_001234806.1|  calcium-dependent protein kinase                   230   1e-67   Solanum lycopersicum
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    230   2e-67   Nicotiana sylvestris
ref|XP_003610427.1|  Calcium-dependent protein kinase                   230   2e-67   
emb|CAG27840.1|  calcium-dependent protein kinase 17                    230   2e-67   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    230   2e-67   Sesamum indicum [beniseed]
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                229   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             229   2e-67   Prunus persica
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    229   2e-67   Populus euphratica
gb|KJB68586.1|  hypothetical protein B456_010G252400                    229   2e-67   Gossypium raimondii
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      229   2e-67   
dbj|BAE71239.1|  putative calcium dependent protein kinase              230   2e-67   Trifolium pratense [peavine clover]
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    229   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase ...    229   3e-67   Cucumis sativus [cucumbers]
gb|KJB35709.1|  hypothetical protein B456_006G124800                    229   3e-67   Gossypium raimondii
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             229   3e-67   Capsella rubella
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      229   3e-67   Cucumis melo [Oriental melon]
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    228   3e-67   
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...    229   4e-67   Solanum lycopersicum
emb|CDX85697.1|  BnaA02g01160D                                          228   4e-67   
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    229   4e-67   Cucumis sativus [cucumbers]
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     227   5e-67   Glycine soja [wild soybean]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    231   5e-67   
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    228   5e-67   Glycine max [soybeans]
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 229   5e-67   Morus notabilis
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    228   6e-67   Sesamum indicum [beniseed]
ref|XP_003622837.1|  Calcium dependent protein kinase                   228   6e-67   
ref|XP_006413708.1|  hypothetical protein EUTSA_v100267671mg            219   7e-67   
gb|ACY78680.1|  calcium-dependent protein kinase 1                      228   7e-67   Panax ginseng [Asiatic ginseng]
ref|XP_007212312.1|  hypothetical protein PRUPE_ppa006748mg             224   7e-67   
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...    228   7e-67   Glycine max [soybeans]
gb|KJB83565.1|  hypothetical protein B456_013G253100                    228   7e-67   Gossypium raimondii
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                228   7e-67   Morus notabilis
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    228   8e-67   Tarenaya hassleriana [spider flower]
ref|XP_003617233.1|  Calcium dependent protein kinase                   228   8e-67   Medicago truncatula
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    228   8e-67   Phoenix dactylifera
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    228   8e-67   Nicotiana sylvestris
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    228   9e-67   Sesamum indicum [beniseed]
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    228   9e-67   Populus euphratica
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             228   9e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    228   1e-66   Populus euphratica
ref|NP_197437.1|  calcium-dependent protein kinase 34                   227   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             227   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    227   1e-66   Glycine max [soybeans]
ref|XP_006845045.1|  hypothetical protein AMTR_s00269p00011940          227   2e-66   Amborella trichopoda
emb|CDP04396.1|  unnamed protein product                                228   2e-66   Coffea canephora [robusta coffee]
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    227   2e-66   Populus euphratica
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    227   2e-66   Nicotiana tomentosiformis
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    227   2e-66   Populus euphratica
gb|AET00506.2|  calcium-dependent kinase                                227   2e-66   Medicago truncatula
emb|CDX79112.1|  BnaA01g11790D                                          228   2e-66   
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     228   2e-66   Brassica rapa
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    227   2e-66   Citrus sinensis [apfelsine]
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   227   3e-66   Citrus sinensis [apfelsine]
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             227   3e-66   Citrus clementina [clementine]
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     226   3e-66   Fragaria vesca subsp. vesca
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...    227   3e-66   
gb|KCW66998.1|  hypothetical protein EUGRSUZ_F007612                    215   4e-66   Eucalyptus grandis [rose gum]
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    226   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    226   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    226   5e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    226   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...    225   6e-66   Cicer arietinum [garbanzo]
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    226   6e-66   
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    226   6e-66   Pyrus x bretschneideri [bai li]
gb|KJB62816.1|  hypothetical protein B456_009G438300                    225   7e-66   Gossypium raimondii
gb|KJB55472.1|  hypothetical protein B456_009G078000                    225   7e-66   Gossypium raimondii
emb|CBI24256.3|  unnamed protein product                                224   7e-66   Vitis vinifera
gb|KJB13679.1|  hypothetical protein B456_002G088800                    226   7e-66   Gossypium raimondii
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      226   7e-66   Gossypium arboreum [tree cotton]
gb|AGG35967.1|  calcium-dependent protein kinase 15                     226   7e-66   Brassica napus [oilseed rape]
emb|CDX82886.1|  BnaC01g13360D                                          226   8e-66   
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    225   8e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    225   9e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          225   1e-65   Sorghum bicolor [broomcorn]
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-65   Glycine max [soybeans]
ref|XP_009350446.1|  PREDICTED: calcium-dependent protein kinase ...    221   1e-65   
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-65   
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    225   1e-65   Prunus mume [ume]
ref|XP_006655439.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-65   
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...    224   1e-65   Solanum tuberosum [potatoes]
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 225   1e-65   Solanum tuberosum [potatoes]
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...    225   1e-65   Vitis vinifera
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         225   1e-65   Ricinus communis
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    225   1e-65   Glycine max [soybeans]
gb|KHN38392.1|  Calcium-dependent protein kinase 17                     224   2e-65   Glycine soja [wild soybean]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     225   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...    224   2e-65   Solanum lycopersicum
gb|KDP20751.1|  hypothetical protein JCGZ_21222                         225   2e-65   Jatropha curcas
gb|KHN12036.1|  Calcium-dependent protein kinase 17                     225   2e-65   Glycine soja [wild soybean]
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    224   2e-65   Phoenix dactylifera
emb|CAN62888.1|  hypothetical protein VITISV_025544                     224   2e-65   Vitis vinifera
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g             224   2e-65   Phaseolus vulgaris [French bean]
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      224   2e-65   Gossypium arboreum [tree cotton]
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...    224   2e-65   Glycine max [soybeans]
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                224   2e-65   
gb|KDP39132.1|  hypothetical protein JCGZ_00889                         224   3e-65   
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g             223   3e-65   
gb|AGT15898.1|  calcium-dependent protein kinase                        224   3e-65   
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    224   3e-65   
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    224   3e-65   
gb|AGT17376.1|  calcium-dependent protein kinase                        224   3e-65   
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     224   4e-65   
emb|CAN60225.1|  hypothetical protein VITISV_039919                     222   4e-65   
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    223   5e-65   
gb|AGT17166.1|  calcium-dependent protein kinase                        222   5e-65   
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      223   5e-65   
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    224   5e-65   
gb|AIO04122.1|  calcium-dependent protein kinase                        224   5e-65   
gb|EEE64198.1|  hypothetical protein OsJ_19030                          223   6e-65   
ref|XP_003568203.1|  PREDICTED: calcium-dependent protein kinase ...    223   6e-65   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             223   6e-65   
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             223   6e-65   
gb|EEC79448.1|  hypothetical protein OsI_20437                          223   7e-65   
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      223   7e-65   
ref|XP_002869856.1|  calcium-dependent protein kinase 15                223   8e-65   
gb|AAT69647.1|  hypothetical protein                                    223   8e-65   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    224   9e-65   
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           223   9e-65   
ref|XP_004972225.1|  PREDICTED: calcium-dependent protein kinase ...    218   9e-65   
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    222   9e-65   
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-64   
gb|KFK28778.1|  hypothetical protein AALP_AA7G046400                    222   1e-64   
gb|ACB71246.2|  calcium-dependent protein kinase 1                      223   1e-64   
ref|NP_001055912.1|  Os05g0491900                                       223   1e-64   
gb|EPS59225.1|  calcium-dependent protein kinase 1                      222   1e-64   
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17     222   1e-64   
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g             221   1e-64   
emb|CBI23246.3|  unnamed protein product                                222   1e-64   
ref|XP_002977722.1|  calcium dependent protein kinase 17                223   1e-64   
gb|AGT16545.1|  calcium-dependent protein kinase 34                     222   1e-64   
ref|NP_193925.1|  calcium-dependent protein kinase 15                   223   1e-64   
ref|NP_001190794.1|  calcium-dependent protein kinase 15                223   1e-64   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...    222   1e-64   
gb|AHN49725.1|  calcium-dependent protein kinase 1                      222   1e-64   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    223   1e-64   
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    222   2e-64   
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase              222   2e-64   
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       222   2e-64   
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         222   2e-64   
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             222   2e-64   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    222   2e-64   
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      222   2e-64   
ref|XP_002989102.1|  calcium dependent protein kinase                   221   2e-64   
gb|EMS56466.1|  Calcium-dependent protein kinase 34                     222   2e-64   
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    221   3e-64   
dbj|BAK07881.1|  predicted protein                                      221   3e-64   
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    222   3e-64   
ref|XP_003617547.1|  Calcium dependent protein kinase                   227   3e-64   
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            221   3e-64   
gb|ACR34538.1|  unknown                                                 221   3e-64   
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    221   3e-64   
emb|CAD70165.1|  calcium-dependent protein kinase                       221   4e-64   
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                221   4e-64   
ref|XP_002979552.1|  calcium dependent protein kinase 17                221   4e-64   
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    221   4e-64   
ref|XP_002983821.1|  calcium dependent protein kinase 3                 221   4e-64   
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      221   4e-64   
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          219   4e-64   
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    220   5e-64   
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      221   5e-64   
gb|AIU98507.1|  calcium-dependent protein kinase                        220   6e-64   
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    220   7e-64   
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    220   8e-64   
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 219   9e-64   
gb|EMT05629.1|  Calcium-dependent protein kinase 34                     219   9e-64   
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    220   9e-64   
ref|XP_006828852.1|  hypothetical protein AMTR_s00001p00158780          220   9e-64   
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    220   1e-63   
ref|NP_001059775.1|  Os07g0515100                                       219   1e-63   
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                220   1e-63   
ref|XP_002869852.1|  hypothetical protein ARALYDRAFT_354567             216   1e-63   
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                219   1e-63   
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     219   1e-63   
emb|CAA57157.1|  calcium-dependent protein kinase                       219   2e-63   
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     219   2e-63   
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    219   2e-63   
ref|XP_011083439.1|  PREDICTED: calcium-dependent protein kinase 29     219   2e-63   
dbj|BAA13440.1|  calcium dependent protein kinase                       219   2e-63   
gb|AGG35970.1|  calcium-dependent protein kinase 21                     219   2e-63   
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             219   2e-63   
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             219   2e-63   
emb|CDP05759.1|  unnamed protein product                                219   2e-63   
gb|KJB81727.1|  hypothetical protein B456_013G159300                    219   2e-63   
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    219   2e-63   
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17     218   3e-63   
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             218   3e-63   
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    218   3e-63   
ref|XP_002874811.1|  calcium-dependent protein kinase 21                218   3e-63   
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             218   3e-63   
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     217   4e-63   
ref|XP_010100127.1|  Calcium-dependent protein kinase 29                218   4e-63   
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...    218   4e-63   
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      218   4e-63   
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    218   4e-63   
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   218   4e-63   
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     218   4e-63   
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    218   5e-63   
emb|CAA65500.1|  protein kinase                                         218   5e-63   
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     218   5e-63   
gb|ABE72958.1|  calcium dependent protein kinase 3                      218   5e-63   
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...    218   5e-63   
ref|NP_001105306.1|  calcium-dependent protein kinase                   218   6e-63   
gb|AAK92828.1|  putative calcium dependent protein kinase               218   6e-63   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     218   6e-63   
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      218   7e-63   
gb|EAY76207.1|  hypothetical protein OsI_04143                          217   7e-63   
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    218   7e-63   
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    218   8e-63   
ref|NP_192381.1|  calcium-dependent protein kinase 21                   218   8e-63   
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    217   8e-63   
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    217   9e-63   
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    218   1e-62   
dbj|BAJ99143.1|  predicted protein                                      217   1e-62   
ref|NP_001044575.1|  Os01g0808400                                       217   1e-62   
gb|ABC59620.1|  calcium-dependent protein kinase                        217   1e-62   
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...    217   1e-62   
gb|ABD98803.1|  calcium-dependent protein kinase                        217   1e-62   
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             217   1e-62   
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             217   1e-62   
gb|ABC59619.1|  calcium-dependent protein kinase                        217   1e-62   
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    218   1e-62   
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    217   1e-62   
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    217   1e-62   
gb|AAD28192.2|  calcium-dependent protein kinase                        217   1e-62   
gb|AGG35971.1|  calcium-dependent protein kinase 29                     217   1e-62   
emb|CDX73219.1|  BnaC06g36670D                                          217   1e-62   
gb|KFK30982.1|  hypothetical protein AALP_AA6G053400                    216   1e-62   
gb|ABD98804.1|  calcium-dependent protein kinase                        216   2e-62   
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      216   2e-62   
gb|ADM14342.1|  calcium-dependent protein kinase 19                     216   2e-62   
emb|CDY36037.1|  BnaC03g41610D                                          216   2e-62   
emb|CDP07348.1|  unnamed protein product                                216   2e-62   
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     216   2e-62   
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      216   2e-62   
gb|AGG35978.1|  calcium-dependent protein kinase 9                      216   3e-62   
gb|EMS46504.1|  Calcium-dependent protein kinase 3                      213   3e-62   
ref|XP_002869854.1|  hypothetical protein ARALYDRAFT_914449             221   3e-62   
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     216   3e-62   
gb|EMT33574.1|  Calcium-dependent protein kinase 34                     214   3e-62   
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    216   3e-62   
ref|NP_177731.2|  calcium-dependent protein kinase 29                   210   3e-62   
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    216   3e-62   
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 216   3e-62   
ref|XP_002891589.1|  calcium-dependent protein kinase 33                216   3e-62   
ref|NP_001275322.1|  calcium-dependent protein kinase                   216   3e-62   
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...    215   4e-62   
gb|EMS58754.1|  Calcium-dependent protein kinase 34                     214   4e-62   
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 215   4e-62   
emb|CDM84631.1|  unnamed protein product                                214   5e-62   
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    215   5e-62   
gb|ABB54456.1|  calcium-dependent protein kinase                        215   5e-62   
ref|NP_175485.1|  calcium-dependent protein kinase 33                   215   5e-62   
emb|CBI26637.3|  unnamed protein product                                210   5e-62   
gb|AAD17800.1|  Ca2+-dependent protein kinase                           215   6e-62   
gb|AFY10519.1|  calcium dependent protein kinase 1                      215   6e-62   
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             215   6e-62   
gb|AAQ17506.1|  calcium dependent protein kinase 3                      215   6e-62   
ref|XP_006302092.1|  hypothetical protein CARUB_v10020082mg             215   7e-62   
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...    214   7e-62   
ref|XP_001771902.1|  predicted protein                                  214   7e-62   
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     214   8e-62   
gb|KJB69279.1|  hypothetical protein B456_011G014200                    215   8e-62   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    214   9e-62   
gb|ABV22575.1|  calcium-dependent protein kinase                        216   1e-61   
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    214   1e-61   
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    213   1e-61   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    214   1e-61   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             218   2e-61   
ref|XP_010428651.1|  PREDICTED: calcium-dependent protein kinase ...    214   2e-61   
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    213   2e-61   
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    218   2e-61   
ref|XP_010471751.1|  PREDICTED: calcium-dependent protein kinase ...    214   2e-61   
ref|XP_006413705.1|  hypothetical protein EUTSA_v10027200mg             208   3e-61   
ref|XP_002456506.1|  hypothetical protein SORBIDRAFT_03g037570          212   3e-61   
ref|XP_010416511.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-61   
ref|XP_010428653.1|  PREDICTED: calcium-dependent protein kinase ...    214   3e-61   
ref|NP_001266856.1|  calcium-dependent protein kinase                   213   4e-61   
emb|CDX82244.1|  BnaA03g35770D                                          213   4e-61   
gb|AES59823.2|  calcium-dependent kinase                                213   4e-61   
ref|XP_001782248.1|  predicted protein                                  212   4e-61   
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...    213   4e-61   
dbj|BAK06838.1|  predicted protein                                      213   4e-61   
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     213   5e-61   
dbj|BAK06618.1|  predicted protein                                      213   5e-61   
tpg|DAA62901.2|  TPA: putative calcium-dependent protein kinase f...    201   5e-61   
ref|XP_001781985.1|  predicted protein                                  211   5e-61   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      213   5e-61   
emb|CBX25340.1|  hypothetical_protein                                   213   5e-61   
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...    211   6e-61   
ref|XP_001768980.1|  predicted protein                                  211   8e-61   
ref|XP_003545013.1|  PREDICTED: calcium-dependent protein kinase ...    212   8e-61   
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    212   1e-60   
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     212   1e-60   
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...    212   1e-60   
gb|AGA83664.1|  calcium-dependent protein kinase 1                      212   1e-60   
ref|XP_009414364.1|  PREDICTED: calcium-dependent protein kinase ...    203   1e-60   
gb|ABV22565.1|  calcium-dependent protein kinase                        212   1e-60   
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     212   1e-60   
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    212   1e-60   
gb|EYU17566.1|  hypothetical protein MIMGU_mgv1a004597mg                211   2e-60   
ref|XP_006596531.1|  PREDICTED: calcium-dependent protein kinase ...    211   2e-60   
gb|ABV22562.1|  calcium-dependent protein kinase                        212   2e-60   
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      211   2e-60   
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    211   2e-60   
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...    211   2e-60   
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34     211   2e-60   
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...    211   2e-60   
sp|Q8RWL2.2|CDPKT_ARATH  RecName: Full=Calcium-dependent protein ...    211   2e-60   
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            209   2e-60   
ref|NP_974150.2|  calcium-dependent protein kinase 29                   211   3e-60   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     210   4e-60   



>gb|ABC47163.2| CDPK1 [Ipomoea nil]
 gb|AFO63177.1| calcium dependent protein kinase 1 [Ipomoea nil]
Length=514

 Score =   303 bits (775),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG
Sbjct  359  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  418

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE
Sbjct  419  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  478

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            II EVDTDNDGKINYDEFVAMMRKGTPDLV
Sbjct  479  IIVEVDTDNDGKINYDEFVAMMRKGTPDLV  508



>ref|XP_009620189.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana tomentosiformis]
Length=514

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG
Sbjct  359  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  418

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMHMNR+EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKE
Sbjct  419  TIDYLEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKE  478

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTDNDG+INYDEF AMMRKG PD V
Sbjct  479  IIAEVDTDNDGRINYDEFAAMMRKGNPDFV  508



>ref|XP_004244622.1| PREDICTED: calcium-dependent protein kinase 3 [Solanum lycopersicum]
Length=516

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDDSGTIT+EELKAGLTKMGTKLSESEVRQLMEAADVDGNG
Sbjct  361  ENLSEEEIIGLKEMFKSIDTDDSGTITFEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  420

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YNITD+KTIKE
Sbjct  421  TIDYLEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNITDDKTIKE  480

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTDNDG+INYDEF AMMRKG PD V
Sbjct  481  IIAEVDTDNDGRINYDEFAAMMRKGNPDFV  510



>ref|XP_006352261.1| PREDICTED: calcium-dependent protein kinase 3-like [Solanum tuberosum]
Length=517

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDDSGTIT+EELKAGLTKMGTKLSESEVRQLMEAADVDGNG
Sbjct  362  ENLSEEEIIGLKEMFKSIDTDDSGTITFEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMH+NR+EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YNITDEKTIKE
Sbjct  422  TIDYLEFITATMHLNRMEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNITDEKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTDNDG+INYDEF  MMRKG PD V
Sbjct  482  IIAEVDTDNDGRINYDEFATMMRKGNPDFV  511



>ref|XP_009786035.1| PREDICTED: calcium-dependent protein kinase 3 [Nicotiana sylvestris]
Length=514

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG
Sbjct  359  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  418

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMHMNR+EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKE
Sbjct  419  TIDYLEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKE  478

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTDNDG+INYDEF AMMRKG  D V
Sbjct  479  IIAEVDTDNDGRINYDEFAAMMRKGNLDFV  508



>gb|KHN25667.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=383

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  228  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNG  287

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  288  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSGYITMEELESTLKKYNMGDEKTIKE  347

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVDTDNDG+INYDEFVAMMRKG PDLVT
Sbjct  348  IIVEVDTDNDGRINYDEFVAMMRKGKPDLVT  378



>gb|ACH85192.1| calcium-dependent protein kinase CDPK5 [Nicotiana tabacum]
Length=514

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKSIDTDD+GTITYEELKAGLTKMGTKLSESEVRQL+EAADVDGNG
Sbjct  359  ENLSEEEIIGLKEMFKSIDTDDNGTITYEELKAGLTKMGTKLSESEVRQLVEAADVDGNG  418

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMHMNR+EREDHLYKAFEYFDKDKSGYITM+ELEH+LKKYNI+DEKTIKE
Sbjct  419  TIDYLEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMDELEHALKKYNISDEKTIKE  478

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTDNDG+INYDEF AMMRKG  D V
Sbjct  479  IIAEVDTDNDGRINYDEFAAMMRKGNLDFV  508



>gb|KDP25359.1| hypothetical protein JCGZ_20515 [Jatropha curcas]
Length=525

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  370  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  429

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D KTIKE
Sbjct  430  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEHALKQYNMGDSKTIKE  489

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDGKINY+EFVAMMRKG PDLVT
Sbjct  490  IIAEVDTDNDGKINYEEFVAMMRKGNPDLVT  520



>gb|KHN35055.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=373

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  218  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNG  277

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKD+SGYIT+EELE +LKKYN+ DEKTIKE
Sbjct  278  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSGYITVEELESALKKYNMGDEKTIKE  337

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVD DNDG+INYDEFVAMMRKG PDLV 
Sbjct  338  IIAEVDADNDGRINYDEFVAMMRKGNPDLVN  368



>emb|CDP12100.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  245  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  304

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNRVEREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKE
Sbjct  305  TIDYIEFITATMHMNRVEREDHLYRAFEYFDKDKSGYITMEELEHALKEYNMGDEKTIKE  364

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVDTD+DG+INYDEFVAMMRKG P++
Sbjct  365  IIAEVDTDHDGRINYDEFVAMMRKGQPEM  393



>emb|CBI34415.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  244  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNG  303

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKE
Sbjct  304  TIDYIEFISATMHMNRMEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKE  363

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EF AMMRKG PDL+T
Sbjct  364  IIAEVDTDHDGRINYEEFAAMMRKGNPDLIT  394



>ref|XP_003517491.2| PREDICTED: calcium-dependent protein kinase 3-like [Glycine max]
Length=528

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  373  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  433  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSGYITMEELESTLKKYNMGDEKTIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVDTDNDG+INYDEFVAMMRKG PDLVT
Sbjct  493  IIVEVDTDNDGRINYDEFVAMMRKGKPDLVT  523



>ref|XP_008239005.1| PREDICTED: calcium-dependent protein kinase 3 [Prunus mume]
Length=400

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  245  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  304

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELE +LKKYN+ DEKTIKE
Sbjct  305  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEQALKKYNMGDEKTIKE  364

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INYDEF AMMRKG P+LVT
Sbjct  365  IIAEVDTDLDGRINYDEFAAMMRKGDPELVT  395



>gb|KHN16773.1| Calcium-dependent protein kinase 3 [Glycine soja]
Length=249

 Score =   271 bits (694),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLMEAAD+DGNG
Sbjct  92   ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMEAADIDGNG  151

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+ERED LYKAFEYFD DKSGYITMEELE +LKKYN+ DEKTIKE
Sbjct  152  TIDYIEFITATMHMNRMEREDRLYKAFEYFDNDKSGYITMEELESALKKYNMGDEKTIKE  211

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVD+DNDG+INYDEFVAMMRKG PD+
Sbjct  212  IIAEVDSDNDGRINYDEFVAMMRKGNPDI  240



>emb|CAN61364.1| hypothetical protein VITISV_032639 [Vitis vinifera]
Length=482

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  327  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNG  386

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKE
Sbjct  387  TIDYIEFISATMHMNRMEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKE  446

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EF AMMRKG PDL+T
Sbjct  447  IIAEVDTDHDGRINYEEFAAMMRKGNPDLIT  477



>ref|XP_010055801.1| PREDICTED: calcium-dependent protein kinase 3 [Eucalyptus grandis]
 gb|KCW72352.1| hypothetical protein EUGRSUZ_E00806 [Eucalyptus grandis]
Length=539

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLK MFKS+DTD+SGTITYEELKAGL K+GTKLSESEV+QLMEAADVDGNG
Sbjct  379  ENLSEEEIMGLKAMFKSMDTDNSGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNG  438

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMH+NRVEREDHLYKAFEYFDKDKSGYITMEELEH+LKKYN+ DEKTIKE
Sbjct  439  TIDYLEFITATMHLNRVEREDHLYKAFEYFDKDKSGYITMEELEHALKKYNMGDEKTIKE  498

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INYDEFVAMMRKG PD+  
Sbjct  499  IIAEVDTDHDGRINYDEFVAMMRKGNPDMAP  529



>ref|XP_004164365.1| PREDICTED: calcium-dependent protein kinase 3-like [Cucumis sativus]
Length=304

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  149  ENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  208

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMHMNRVEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKE
Sbjct  209  SIDYIEFITATMHMNRVEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKE  268

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDEFVAMMRKG  +L T
Sbjct  269  IIAEVDTDNDGRINYDEFVAMMRKGNQELTT  299



>ref|XP_011073451.1| PREDICTED: calcium-dependent protein kinase 3-like [Sesamum indicum]
Length=517

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNG
Sbjct  362  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D KTIKE
Sbjct  422  TIDYIEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDAKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            I+AEVDTD+DGKINYDEFVAMMRKG PD+ T
Sbjct  482  ILAEVDTDHDGKINYDEFVAMMRKGNPDIGT  512



>ref|XP_003538256.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=505

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  350  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKVSESEVRQLMEAADVDGNG  409

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKD+SGYIT+EELE +LKKYN+ DEKTIKE
Sbjct  410  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSGYITVEELESALKKYNMGDEKTIKE  469

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVD DNDG+INYDEFVAMMRKG PDLV
Sbjct  470  IIAEVDADNDGRINYDEFVAMMRKGNPDLV  499



>gb|AGS15000.1| calcium-dependent protein kinase 3 [Vitis amurensis]
Length=528

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  373  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKE
Sbjct  433  TIDYIEFISATMHMNRMEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EF AMMRKG PDL+T
Sbjct  493  IIAEVDTDHDGRINYEEFAAMMRKGNPDLIT  523



>ref|XP_002272270.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
 ref|XP_010658560.1| PREDICTED: calcium-dependent protein kinase 3 [Vitis vinifera]
Length=528

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELK GL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  373  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKNGLPKLGTKLSESEVRQLMEAADVDGNG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+EREDHLY+AFEYFDKDKSGYITMEELEH+LK+YN+ DEKTIKE
Sbjct  433  TIDYIEFISATMHMNRMEREDHLYRAFEYFDKDKSGYITMEELEHALKRYNMGDEKTIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EF AMMRKG PDL+T
Sbjct  493  IIAEVDTDHDGRINYEEFAAMMRKGNPDLIT  523



>ref|XP_003525360.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 1 
[Glycine max]
Length=518

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  361  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  420

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFD DKSGYITMEELE +LKKYN+ DEKTIKE
Sbjct  421  TIDYIEFITATMHMNRMEREDHLYKAFEYFDNDKSGYITMEELESALKKYNMGDEKTIKE  480

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVDTDNDG+INYDEFVAMMRKG PD+
Sbjct  481  IIAEVDTDNDGRINYDEFVAMMRKGNPDI  509



>ref|XP_008451994.1| PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo]
Length=527

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  372  ENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMHMNRVEREDHL++AFEYFDKDKSGYITMEELE +LKKYN+ DEKTIKE
Sbjct  432  SIDYIEFITATMHMNRVEREDHLFRAFEYFDKDKSGYITMEELETALKKYNMGDEKTIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDEFVAMMRKG P+L T
Sbjct  492  IIAEVDTDNDGRINYDEFVAMMRKGNPELTT  522



>ref|XP_009334485.1| PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri]
Length=525

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  370  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  429

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLY AFEYFDKDKSGYIT+EELE +LKKYN+ DEKTIKE
Sbjct  430  TIDYIEFITATMHMNRMEREDHLYTAFEYFDKDKSGYITVEELEQALKKYNMGDEKTIKE  489

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INYDEF AMMRKG P+LVT
Sbjct  490  IIAEVDTDRDGRINYDEFAAMMRKGNPELVT  520



>ref|XP_002509886.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51273.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=528

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD++GTITYEELKAGL K+GTKLSESEV+QLMEAADVDGNG
Sbjct  373  ENLSEEEIMGLKEMFKSMDTDNNGTITYEELKAGLPKLGTKLSESEVKQLMEAADVDGNG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELEH+LK+YN+ D +TIKE
Sbjct  433  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEHALKEYNMGDARTIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMRKG P+LVT
Sbjct  493  IIAEVDTDHDGRINYEEFVAMMRKGNPELVT  523



>ref|XP_007040387.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
 gb|EOY24888.1| Calcium-dependent protein kinase 6 isoform 1 [Theobroma cacao]
Length=531

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  376  ENLSEEEIIGLKEMFKSMDTDNSGTITYEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  435

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+ERE+HLY AF+YFDKD SGYITMEELE +L+KYN+ DEKTIKE
Sbjct  436  TIDYIEFITATMHMNRMEREEHLYTAFQYFDKDNSGYITMEELEQALRKYNMGDEKTIKE  495

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTD DG+INYDEFVAMMRKG PDLV
Sbjct  496  IIAEVDTDRDGRINYDEFVAMMRKGNPDLV  525



>ref|XP_007209903.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
 gb|EMJ11102.1| hypothetical protein PRUPE_ppa004162mg [Prunus persica]
Length=526

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  371  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  430

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYIT+EELE +LKKYN+ DEKTIKE
Sbjct  431  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITVEELEQALKKYNMGDEKTIKE  490

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVDTD DG+INYDEF AMMRKG P+LVT
Sbjct  491  IIVEVDTDLDGRINYDEFAAMMRKGDPELVT  521



>ref|XP_007160124.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
 gb|ESW32118.1| hypothetical protein PHAVU_002G294500g [Phaseolus vulgaris]
Length=519

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLM+AADVDGNG
Sbjct  362  ESLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMDAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFD D+SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  422  TIDYIEFITATMHMNRMEREDHLYKAFEYFDNDRSGYITMEELESALKKYNMGDEKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVDTDNDG+INYDEFVAMMRKG PD+
Sbjct  482  IIAEVDTDNDGRINYDEFVAMMRKGNPDI  510



>gb|KDO76376.1| hypothetical protein CISIN_1g010013mg [Citrus sinensis]
Length=520

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNG
Sbjct  365  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNG  424

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNRVERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKE
Sbjct  425  TIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKE  484

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVD DNDG+INY+EF AMMRKG PD+V
Sbjct  485  IIAEVDIDNDGRINYEEFAAMMRKGNPDMV  514



>ref|XP_006476469.1| PREDICTED: calcium-dependent protein kinase 3-like [Citrus sinensis]
Length=520

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNG
Sbjct  365  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNG  424

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNRVERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKE
Sbjct  425  TIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKE  484

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVD DNDG+INY+EF AMMRKG PD+V
Sbjct  485  IIAEVDIDNDGRINYEEFAAMMRKGNPDMV  514



>ref|XP_006439443.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
 gb|ESR52683.1| hypothetical protein CICLE_v10019724mg [Citrus clementina]
Length=520

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GT+LSESEVRQLMEAADVDGNG
Sbjct  365  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTRLSESEVRQLMEAADVDGNG  424

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNRVERE+HLYKAFEYFDKD SGYITMEELEH+LKKYN+ D KTIKE
Sbjct  425  TIDYIEFITATMHMNRVEREEHLYKAFEYFDKDNSGYITMEELEHALKKYNMGDAKTIKE  484

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVD DNDG+INY+EF AMMRKG PD+V
Sbjct  485  IIAEVDIDNDGRINYEEFAAMMRKGNPDMV  514



>gb|KGN53365.1| hypothetical protein Csa_4G050200 [Cucumis sativus]
Length=527

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  372  ENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMHMNRVEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKE
Sbjct  432  SIDYIEFITATMHMNRVEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDEFVAMMRKG  +L T
Sbjct  492  IIAEVDTDNDGRINYDEFVAMMRKGNQELTT  522



>ref|XP_010676387.1| PREDICTED: calcium-dependent protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=526

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  371  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  430

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+EDHLYKAFEYFD+DKSGYIT EELE +LKKYN+ DEKTI+E
Sbjct  431  TIDYMEFITATMHMNRMEKEDHLYKAFEYFDEDKSGYITTEELEQALKKYNMGDEKTIRE  490

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDEF AMM+KG PDLV+
Sbjct  491  IIAEVDTDNDGRINYDEFAAMMKKGNPDLVS  521



>ref|XP_007158545.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
 gb|ESW30539.1| hypothetical protein PHAVU_002G161200g [Phaseolus vulgaris]
Length=502

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 145/151 (96%), Gaps = 1/151 (1%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++GTIT+EELKAGL K+GTK+SESEV QLMEAADVDGNG
Sbjct  349  ENLSEEEIIGLKEMFKSMDTDNNGTITFEELKAGLPKLGTKISESEVSQLMEAADVDGNG  408

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKD+SGYITMEELE +LKKYN+ DEK IKE
Sbjct  409  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDRSGYITMEELESALKKYNMGDEK-IKE  467

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDEFVAMMRKG PDLVT
Sbjct  468  IIAEVDTDNDGRINYDEFVAMMRKGNPDLVT  498



>gb|KJB52214.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=374

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSE EVRQLMEAADVDGNG
Sbjct  219  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSEHEVRQLMEAADVDGNG  278

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNR+EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  279  AIDYIEFITATMHMNRMEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKE  338

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INYDEFVAMMRKG P+L  
Sbjct  339  IIAEVDTDRDGRINYDEFVAMMRKGNPELAN  369



>ref|XP_004298849.1| PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSE+EIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  364  ENLSEDEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR++REDHLY AFEYFDKDKSGYITMEELE +LKKYN+ DE+TIKE
Sbjct  424  TIDYIEFITATMHMNRMDREDHLYTAFEYFDKDKSGYITMEELEQALKKYNMGDEQTIKE  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVDTD DG+INYDEFVAMMRKG P+LVT
Sbjct  484  IITEVDTDLDGRINYDEFVAMMRKGNPELVT  514



>ref|XP_004503656.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=511

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+G+K+SESEVRQLMEAADVDGNG
Sbjct  357  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGSKMSESEVRQLMEAADVDGNG  416

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFD+DKSG+IT EELE +LKKYN+ DEKTIKE
Sbjct  417  TIDYIEFITATMHMNRMEREDHLYKAFEYFDQDKSGFITKEELESALKKYNMGDEKTIKE  476

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVDTDND +INYDEFVAMMRKG PD+
Sbjct  477  IIAEVDTDNDARINYDEFVAMMRKGNPDI  505



>ref|XP_010261434.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=531

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+G+KLSESEVRQLMEAADVDGNG
Sbjct  376  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGSKLSESEVRQLMEAADVDGNG  435

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+E+HLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKE
Sbjct  436  TIDYIEFITATMHMNRMEKEEHLYKAFEYFDKDKSGYITMEELEQALTKYNMGDMKTIKE  495

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINYDEFVAMM+KG P+LVT
Sbjct  496  IIAEVDTDHDGKINYDEFVAMMKKGNPELVT  526



>ref|XP_002298000.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
 gb|EEE82805.1| calcium-dependent protein kinase 1 [Populus trichocarpa]
Length=515

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  360  ENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  419

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKE
Sbjct  420  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKE  479

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMRKG P+L +
Sbjct  480  IIAEVDTDHDGRINYEEFVAMMRKGNPELAS  510



>ref|XP_011026960.1| PREDICTED: calcium-dependent protein kinase 3 [Populus euphratica]
Length=515

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  360  ENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  419

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKE
Sbjct  420  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDSKTIKE  479

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMRKG P+L +
Sbjct  480  IIAEVDTDHDGRINYEEFVAMMRKGNPELAS  510



>emb|CAC83060.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
Length=413

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  258  ENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  317

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITA MHMNRVEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKE
Sbjct  318  SIDYIEFITAAMHMNRVEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKE  377

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDE VAMMRKG  +L T
Sbjct  378  IIAEVDTDNDGRINYDEVVAMMRKGNQELTT  408



>gb|KHG11508.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=534

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSE+EVRQLMEAADVDGNG
Sbjct  379  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSENEVRQLMEAADVDGNG  438

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNR+EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  439  AIDYIEFITATMHMNRMEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKE  498

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTD DG+INYDEFVAMMRKG P+L 
Sbjct  499  IIAEVDTDRDGRINYDEFVAMMRKGNPELA  528



>ref|XP_003611046.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AES94004.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=517

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  362  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH+NR+EREDHLYKAFEYFD DKSGYIT EELE +L KYN+ DEKTIKE
Sbjct  422  TIDYIEFITATMHLNRMEREDHLYKAFEYFDNDKSGYITKEELESALTKYNMGDEKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVD+DNDG+INY+EFVAMMRKG PDL+T
Sbjct  482  IIDEVDSDNDGRINYEEFVAMMRKGNPDLIT  512



>gb|KEH21166.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=516

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+G+K+SESEVRQLMEAADVDGNG
Sbjct  362  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGSKMSESEVRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFD+DKSGYIT EELE +LKKYN+ DE TIKE
Sbjct  422  TIDYIEFITATMHMNRMEREDHLYKAFEYFDQDKSGYITKEELESALKKYNMGDENTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            IIAEVDTDND +INYDEFVAMMRKG PD+
Sbjct  482  IIAEVDTDNDARINYDEFVAMMRKGNPDI  510



>gb|KJB52213.1| hypothetical protein B456_008G251000 [Gossypium raimondii]
Length=534

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSE EVRQLMEAADVDGNG
Sbjct  379  ENLSEEEIIGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSEHEVRQLMEAADVDGNG  438

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNR+EREDHLY AF+YFDKD SGYITMEELE +LKKYN+ DEKTIKE
Sbjct  439  AIDYIEFITATMHMNRMEREDHLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKTIKE  498

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTD DG+INYDEFVAMMRKG P+L 
Sbjct  499  IIAEVDTDRDGRINYDEFVAMMRKGNPELA  528



>ref|XP_002304529.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
 gb|EEE79508.2| hypothetical protein POPTR_0003s13380g [Populus trichocarpa]
Length=523

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  368  ENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKE
Sbjct  428  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEQALVKYNMGDTKTIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMRKG P+L  
Sbjct  488  IIAEVDTDHDGRINYEEFVAMMRKGNPELAP  518



>ref|XP_011022588.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022589.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
 ref|XP_011022590.1| PREDICTED: calcium-dependent protein kinase 3-like [Populus euphratica]
Length=517

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD++GTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  362  ENLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+EREDHLYKAFEYFDKDKSGYITMEELE +L KYN+ D KTIKE
Sbjct  422  TIDYIEFITATMHMNRMEREDHLYKAFEYFDKDKSGYITMEELEQALMKYNMGDTKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMRKG P+L  
Sbjct  482  IIAEVDTDHDGRINYEEFVAMMRKGNPELAP  512



>ref|NP_001267714.1| calcium-dependent protein kinase 3-like [Cucumis sativus]
 emb|CAC44471.1| calcium dependent calmodulin independent protein kinase [Cucumis 
sativus]
 gb|AAK26164.2| calcium-dependent calmodulin-independent protein kinase 5 [Cucumis 
sativus]
Length=514

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTKLSESEVRQLMEAADVDGNG
Sbjct  359  ENLSEEEIVGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKLSESEVRQLMEAADVDGNG  418

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITA MHMNRVEREDHL+KAFEYFDKDKSGYITMEELE +LKKYN+ DE TIKE
Sbjct  419  SIDYIEFITAAMHMNRVEREDHLFKAFEYFDKDKSGYITMEELETALKKYNMGDETTIKE  478

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INYDE VAMMRKG  +L T
Sbjct  479  IIAEVDTDNDGRINYDEVVAMMRKGNQELTT  509



>ref|XP_010251583.1| PREDICTED: calcium-dependent protein kinase 3-like [Nelumbo nucifera]
Length=522

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT+EELK GL K+GTK+SESEV+QLMEAADVDGNG
Sbjct  367  ENLSEEEIMGLKEMFKSMDTDNSGTITFEELKVGLPKLGTKVSESEVKQLMEAADVDGNG  426

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+E+HLYKAFEYFDKDKSGYITMEELE +LKKYN+ D KTIKE
Sbjct  427  TIDYIEFITATMHMNRMEKEEHLYKAFEYFDKDKSGYITMEELEQALKKYNMGDTKTIKE  486

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INYDEFVAMMRKG P+L T
Sbjct  487  IIAEVDTDHDGRINYDEFVAMMRKGNPELTT  517



>ref|XP_004511540.1| PREDICTED: calcium-dependent protein kinase 3-like [Cicer arietinum]
Length=509

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+S TIT+EELK GL+K+GTK+SESEVRQLMEAADVDGNG
Sbjct  354  ENLSEEEIIGLKEMFKSMDTDNSRTITFEELKDGLSKLGTKISESEVRQLMEAADVDGNG  413

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH+NR+ERE+HLYKAFEYFD DKSGYIT EELE +LKKYN+ DEKTIKE
Sbjct  414  TIDYIEFITATMHLNRMERENHLYKAFEYFDNDKSGYITKEELESALKKYNMGDEKTIKE  473

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVD+DNDG+INY+EFVAMMRKG PDLVT
Sbjct  474  IIAEVDSDNDGRINYEEFVAMMRKGNPDLVT  504



>ref|XP_010106587.1| Calcium-dependent protein kinase 3 [Morus notabilis]
 gb|EXC10841.1| Calcium-dependent protein kinase 3 [Morus notabilis]
Length=639

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLKEMFKS+DTD+SGTITYEELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  484  ESLSEEEIMGLKEMFKSMDTDNSGTITYEELKAGLPKLGTKISESEVRQLMEAADVDGNG  543

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH+NR+ERE+HLY AFEYFDKDKSGYITMEELE +L KYNI DEKTIKE
Sbjct  544  TIDYIEFITATMHLNRMEREEHLYTAFEYFDKDKSGYITMEELEQALIKYNIGDEKTIKE  603

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INY+EFVAMMRKG PD+V 
Sbjct  604  IIAEVDTDRDGRINYEEFVAMMRKGNPDMVP  634



>ref|XP_008792394.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=531

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMF+S+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  376  ENLSEEEIMGLKEMFRSMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNG  435

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNRVE+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKE
Sbjct  436  AIDYIEFITATMHMNRVEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKE  495

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINY+EF AMMRK +P +V 
Sbjct  496  IIAEVDTDHDGKINYEEFAAMMRKDSPAIVP  526



>ref|XP_010924783.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Elaeis guineensis]
Length=527

 Score =   261 bits (668),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  372  ESLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKE
Sbjct  432  TIDYIEFISATMHMNRMEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY+EFVAMMR+ +P +V 
Sbjct  492  IIAEVDTDHDGRINYEEFVAMMRQDSPAMVA  522



>ref|XP_006849377.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
 gb|ERN10958.1| hypothetical protein AMTR_s00158p00082100 [Amborella trichopoda]
Length=538

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMF+S+DTD+SGTIT+EELKAGL K+GT++SESEVRQLMEAADVDGNG
Sbjct  374  ENLSEEEIMGLKEMFRSMDTDNSGTITFEELKAGLPKLGTRISESEVRQLMEAADVDGNG  433

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH+NR+E+EDHLY AFEYFDKDKSGYITMEELE +LKKYN+ DEKTI E
Sbjct  434  TIDYIEFITATMHLNRMEKEDHLYTAFEYFDKDKSGYITMEELEQALKKYNMGDEKTINE  493

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INYDEFV MMRKG  D+  
Sbjct  494  IIAEVDTDRDGRINYDEFVTMMRKGNQDMAA  524



>gb|KHG03431.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=604

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTI++EELK GL K+GTKLSESEVRQLMEAAD DGNG
Sbjct  364  ENLSEEEIIGLKEMFKSMDTDNSGTISFEELKTGLPKLGTKLSESEVRQLMEAADFDGNG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNR ERE+HLY AF+YFD+D SG+ITMEELE +L+KYN+ DEKTIKE
Sbjct  424  AIDYIEFITATMHMNRTEREEHLYTAFQYFDEDNSGFITMEELEQALRKYNMGDEKTIKE  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DG+INYDEFVAMMRKG P+LV 
Sbjct  484  IIAEVDTDRDGRINYDEFVAMMRKGNPELVA  514



>ref|XP_011080890.1| PREDICTED: calcium-dependent protein kinase 3 [Sesamum indicum]
Length=481

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD+SGTITYEELK  L K+GTK SES VRQL+EAADVDGNG
Sbjct  330  ENLSEEEIIGLKEMFKSLDTDNSGTITYEELKTALPKLGTKFSESVVRQLIEAADVDGNG  389

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATM+M+RVERED L KAFEYFDKDKSGYITMEELEH+L +YN+ D KT+KE
Sbjct  390  TIDYIEFITATMNMSRVEREDRLDKAFEYFDKDKSGYITMEELEHALNEYNMGDAKTMKE  449

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDL  334
            I+AEVDTD+DGKINYDEFVAMMRKG PDL
Sbjct  450  ILAEVDTDHDGKINYDEFVAMMRKGNPDL  478



>gb|KJB19075.1| hypothetical protein B456_003G084000 [Gossypium raimondii]
Length=508

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+ TD+SGTI +EELK GL K+GTKLSESEVRQLM AAD DGNG
Sbjct  353  ENLSEEEIIGLKEMFKSMGTDNSGTICFEELKTGLPKLGTKLSESEVRQLMGAADFDGNG  412

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
             IDY+EFITATMHMNR EREDH Y AF+YFD+D SG+ITMEELE +L+KYN+ DEKTIKE
Sbjct  413  AIDYIEFITATMHMNRTEREDHFYTAFQYFDEDNSGFITMEELEQALRKYNMGDEKTIKE  472

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IIAEVDTD DG+INYDEFVAMMRKG P+LV
Sbjct  473  IIAEVDTDRDGRINYDEFVAMMRKGNPELV  502



>gb|EYU23402.1| hypothetical protein MIMGU_mgv1a004683mg [Erythranthe guttata]
Length=515

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+D D++G IT+EELK G++K+ TK+SESEVRQLMEAADVDGNG
Sbjct  357  ENLSEEEIVGLKEMFKSMDADNNGMITFEELKTGVSKLNTKISESEVRQLMEAADVDGNG  416

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+ERED LYKAFEYFDKD SGYIT EELEH+LK+YNI D K IKE
Sbjct  417  TIDYIEFITATMHMNRMEREDRLYKAFEYFDKDSSGYITTEELEHALKEYNIGDAKIIKE  476

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            I+AEVD D+DGKINYDEFVAMMRKG  DLVT
Sbjct  477  ILAEVDIDHDGKINYDEFVAMMRKGNTDLVT  507



>ref|XP_010924782.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Elaeis guineensis]
Length=531

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 145/155 (94%), Gaps = 4/155 (3%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+GTK+SESEVRQLMEAADVDGNG
Sbjct  372  ESLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGTKISESEVRQLMEAADVDGNG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDHLYKAFEYFDKDKSGYIT+EELE +L+KYN+ D+KTIKE
Sbjct  432  TIDYIEFISATMHMNRMEKEDHLYKAFEYFDKDKSGYITVEELEQALRKYNMGDDKTIKE  491

Query  420  IIAEVDTDN----DGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+    DG+INY+EFVAMMR+ +P +V 
Sbjct  492  IIAEVDTDHLMLQDGRINYEEFVAMMRQDSPAMVA  526



>ref|XP_009406794.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 3/153 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSE+EI+GLKEMFKSIDTD+SGTIT+EELKAGL K+G    K+SESEVRQLMEAADVD
Sbjct  303  ESLSEDEIMGLKEMFKSIDTDNSGTITFEELKAGLPKLGNLGIKISESEVRQLMEAADVD  362

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDY+EFITATMHMNRVEREDHLYKAFEYFD+DKSGYIT+EELE +LKKYN+ DEKT
Sbjct  363  GNGSIDYIEFITATMHMNRVEREDHLYKAFEYFDEDKSGYITVEELEQALKKYNMGDEKT  422

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IKEIIAEVDTD DG+INYDEFV MMRK + + +
Sbjct  423  IKEIIAEVDTDKDGRINYDEFVTMMRKDSSEAI  455



>ref|XP_009137376.1| PREDICTED: calcium-dependent protein kinase 3 [Brassica rapa]
Length=376

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  219  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  278

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  279  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  338

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  339  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  369



>emb|CDY10955.1| BnaA03g46140D [Brassica napus]
Length=376

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  219  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  278

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  279  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  338

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  339  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  369



>ref|XP_010541306.1| PREDICTED: calcium-dependent protein kinase 3 [Tarenaya hassleriana]
Length=521

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMF+S+D+D+SGTIT EE++AGL K+G+K++E+E+RQLMEAADVDG+G
Sbjct  364  ENLSEEEIVGLKEMFRSLDSDNSGTITLEEMRAGLPKLGSKITEAEIRQLMEAADVDGDG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNIT--DEKTI  427
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+   ++K+I
Sbjct  424  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNVGGDEKKSI  483

Query  426  KEIIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            KEIIAEVDTD+DG+INY+EFVAMM+KG PD+VT
Sbjct  484  KEIIAEVDTDHDGRINYEEFVAMMKKGNPDMVT  516



>ref|XP_010433881.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  372  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  432  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  492  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  522



>ref|XP_010509303.1| PREDICTED: calcium-dependent protein kinase 3 [Camelina sativa]
Length=529

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  374  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  433

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  434  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  493

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  494  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  524



>ref|XP_006283520.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
 gb|ACC91261.1| putative calcium-dependent protein kinase [Capsella rubella]
 gb|EOA16418.1| hypothetical protein CARUB_v10004572mg [Capsella rubella]
Length=529

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G K+SE+E+RQLMEAAD+DG+G
Sbjct  373  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGNKISEAEIRQLMEAADMDGDG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  433  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  493  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  523



>gb|AGF69185.1| calcium-dependent protein kinase 3-like 1, partial [Triticum 
aestivum]
Length=226

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GL+EMFKS+DTD+SGTIT +EL+AGL+K+GTK++ESE+RQLMEA DVDG+G
Sbjct  70   ESLSEEEIVGLREMFKSLDTDNSGTITLDELRAGLSKLGTKITESEIRQLMEAVDVDGDG  129

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+
Sbjct  130  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKD  189

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINY EFVAMM+  +P++V 
Sbjct  190  IIAEVDTDHDGKINYQEFVAMMKNNSPEIVP  220



>gb|KFK28919.1| hypothetical protein AALP_AA7G065000 [Arabis alpina]
Length=529

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEIIGLKEMFKS+DTD++G +T EE++ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  372  ESLSEEEIIGLKEMFKSLDTDNNGIVTLEEMRTGLPKLGSKISEAEIRQLMEAADMDGDG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  432  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  492  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  522



>ref|XP_009137374.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
 ref|XP_009137377.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=532

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  375  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  434

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  435  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  494

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  495  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  525



>ref|XP_010529626.1| PREDICTED: calcium-dependent protein kinase 3-like [Tarenaya 
hassleriana]
Length=513

 Score =   248 bits (634),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMFKS+DTD+SGTIT EEL+ G+ K+G+K++E E+RQLMEAADVDG+G
Sbjct  358  ENLSEEEIKGLKEMFKSLDTDNSGTITLEELRDGVPKLGSKITEEEIRQLMEAADVDGDG  417

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI++TMHMNR+ERED LY AF+YFDKD SGYITMEELE +LKKYN+ DEK+IKE
Sbjct  418  SIDYLEFISSTMHMNRIEREDRLYTAFQYFDKDNSGYITMEELEQALKKYNMGDEKSIKE  477

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            I+AEVDTD+DG+INY+EFVAMM+KG PD+VT
Sbjct  478  ILAEVDTDHDGRINYEEFVAMMKKGNPDMVT  508



>emb|CDY62741.1| BnaC07g50270D [Brassica napus]
Length=615

 Score =   251 bits (640),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E+RQLMEAAD+DG+G
Sbjct  458  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIRQLMEAADMDGDG  517

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  518  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  577

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  578  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  608



>ref|XP_008656081.1| PREDICTED: calcium-dependent protein kinase 3-like [Zea mays]
 gb|AFW81270.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW81271.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=539

 Score =   249 bits (635),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  383  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESEIRQLMEAADVDGNG  442

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SG+IT++ELE +LKKY++ DE T+KE
Sbjct  443  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGHITVDELEEALKKYDMGDEATVKE  502

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMM+  +P++V 
Sbjct  503  IIAEVDTDHDGRINYQEFVAMMKNNSPEIVP  533



>gb|AGG35973.1| calcium-dependent protein kinase 3, partial [Brassica napus]
Length=525

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G
Sbjct  368  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  428  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  488  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  518



>ref|XP_010439150.1| PREDICTED: calcium-dependent protein kinase 3-like [Camelina 
sativa]
Length=528

 Score =   249 bits (635),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  372  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  431

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++ KYN+ D+K+IKE
Sbjct  432  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMTKYNMGDDKSIKE  491

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  492  IIAEVDTDRDGKINYEEFVAMMKKGNPELVT  522



>emb|CDY44125.1| BnaA01g13330D [Brassica napus]
Length=525

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G
Sbjct  368  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  428  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  488  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  518



>ref|XP_006655639.1| PREDICTED: calcium-dependent protein kinase 3-like, partial [Oryza 
brachyantha]
Length=470

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  314  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNG  373

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMHMNR+E+EDH+YKAFEYFDKD SG+IT++ELE +LKKY++ DE TIKE
Sbjct  374  SIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGFITVDELEEALKKYDMGDEATIKE  433

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+I+Y EFVAMM+  +P++V 
Sbjct  434  IIAEVDTDHDGRIDYQEFVAMMKNNSPEIVP  464



>gb|EEE64852.1| hypothetical protein OsJ_19709 [Oryza sativa Japonica Group]
Length=543

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  387  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNG  446

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMHMNR+E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKE
Sbjct  447  SIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKE  506

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMM+  +P++V 
Sbjct  507  IIAEVDTDHDGRINYQEFVAMMKNNSPEIVP  537



>ref|XP_009137281.1| PREDICTED: calcium-dependent protein kinase 3-like [Brassica 
rapa]
Length=525

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  368  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFDKD SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  428  SIDYLEFISATMHMNRIEREDHLYTAFQYFDKDNSGYITMEELEQAMKKYNMGDDKSIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  488  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  518



>ref|XP_003567831.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=548

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLK+MFKS+DTD+SGTIT EEL+AGL K+GTK++ESE+RQLMEAADVDGNG
Sbjct  392  ESLSEEEIVGLKQMFKSLDTDNSGTITLEELRAGLPKLGTKITESEIRQLMEAADVDGNG  451

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIKE
Sbjct  452  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKE  511

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINY EFVAMM+  +P++V 
Sbjct  512  IIAEVDTDHDGKINYQEFVAMMKNNSPEIVP  542



>gb|EEC79771.1| hypothetical protein OsI_21169 [Oryza sativa Indica Group]
Length=401

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  245  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESELMQLMEAADVDGNG  304

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMHMNR+E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKE
Sbjct  305  SIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKE  364

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMM+  +P++V 
Sbjct  365  IIAEVDTDHDGRINYQEFVAMMKNNSPEIVP  395



>tpg|DAA58513.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=302

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  146  ENLSDEEIMGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  205

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  206  TIDYAEFISATMHLNRLEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  265

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  TP++V 
Sbjct  266  IIAEVDTDHDGRINYQEFVAMMRNNTPEIVP  296



>ref|XP_002441592.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
 gb|EES20022.1| hypothetical protein SORBIDRAFT_09g029950 [Sorghum bicolor]
Length=541

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  385  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESEIRQLMEAADVDGNG  444

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SG+IT++ELE +LKKY++ DE TIKE
Sbjct  445  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGHITVDELEEALKKYDMGDEATIKE  504

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMM+  + D+V 
Sbjct  505  IIAEVDTDHDGRINYQEFVAMMKNNSSDIVP  535



>gb|AIU98501.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=521

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSE+EI+GLKEMFKSIDTD+SGTITYEELKAGL K+G    K+SESEVRQLMEAADVD
Sbjct  363  ESLSEDEIMGLKEMFKSIDTDNSGTITYEELKAGLPKLGNLGIKISESEVRQLMEAADVD  422

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDY+EFITATMHMNR+E+EDHLY+AFEYFD+DKSGYIT+EELE +LKKYN+ DEKT
Sbjct  423  GNGSIDYIEFITATMHMNRMEKEDHLYRAFEYFDEDKSGYITVEELEQALKKYNMGDEKT  482

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMRK  349
            IKEII EVDTD DG+INYDEF  MMRK
Sbjct  483  IKEIITEVDTDRDGRINYDEFATMMRK  509



>gb|AIU98505.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=517

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSEEEI+GLKEMFKS+DTD+SGTIT+EELKAGL K+G    K+SESE+RQLMEAADVD
Sbjct  358  ESLSEEEIMGLKEMFKSMDTDNSGTITFEELKAGLPKLGNLGIKISESEIRQLMEAADVD  417

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDY+EFITATMHMNR+EREDHLYKAFE FDKDKSGYIT+EELE +LKKYN+ DEKT
Sbjct  418  GNGSIDYIEFITATMHMNRMEREDHLYKAFECFDKDKSGYITVEELEQALKKYNMGDEKT  477

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMRK  349
            IKEI+AEVD D DG+INYDEFV MMRK
Sbjct  478  IKEILAEVDIDKDGRINYDEFVTMMRK  504



>ref|XP_002867697.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43956.1| calcium-dependent protein kinase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  364  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  424  SIDYLEFISATMHMNRIEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKE  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LV 
Sbjct  484  IIAEVDTDRDGKINYEEFVAMMKKGNPELVP  514



>gb|AAL38596.1|AF446863_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAK96512.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
Length=529

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  374  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  433

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  434  SIDYLEFISATMHMNRIEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKE  493

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LV 
Sbjct  494  IIAEVDTDRDGKINYEEFVAMMKKGNPELVP  524



>ref|NP_194096.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
 sp|Q42479.1|CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3; AltName: Full=Calcium-dependent 
protein kinase isoform CDPK6; Short=AtCDPK6 
[Arabidopsis thaliana]
 gb|AAK60302.1|AF385710_1 AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAA67654.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAA67656.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 emb|CAA23031.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 emb|CAB79320.1| calcium-dependent protein kinase (CDPK6) [Arabidopsis thaliana]
 gb|AAL87385.1| AT4g23650/F9D16_120 [Arabidopsis thaliana]
 gb|AAM65176.1| calcium-dependent protein kinase CDPK6 [Arabidopsis thaliana]
 gb|AAN31878.1| putative calcium-dependent protein kinase (CDPK6) [Arabidopsis 
thaliana]
 gb|AEE84789.1| calcium-dependent protein kinase 6 [Arabidopsis thaliana]
Length=529

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E+RQLMEAAD+DG+G
Sbjct  374  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMDGDG  433

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF++FD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  434  SIDYLEFISATMHMNRIEREDHLYTAFQFFDNDNSGYITMEELELAMKKYNMGDDKSIKE  493

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LV 
Sbjct  494  IIAEVDTDRDGKINYEEFVAMMKKGNPELVP  524



>ref|NP_001056455.1| Os05g0585500 [Oryza sativa Japonica Group]
 gb|AAT47064.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18369.1| Os05g0585500 [Oryza sativa Japonica Group]
Length=542

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+AGL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  386  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRAGLPKLGTKISESELRQLMEAADVDGNG  445

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMHMNR+E+EDH+YKAFEYFDKD SG+IT++ELE +L KY++ DE TIKE
Sbjct  446  SIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGFITVDELEEALTKYDMGDEATIKE  505

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMM+  +P++V 
Sbjct  506  IIAEVDTDHDGRINYQEFVAMMKNNSPEIVP  536



>gb|EMT20115.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=353

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  197  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  256

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+
Sbjct  257  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKD  316

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  317  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  347



>ref|XP_006413532.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
 gb|ESQ54985.1| hypothetical protein EUTSA_v10024899mg [Eutrema salsugineum]
Length=527

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFKS+DTD++G +T EEL+ GL K+G+K+SE+E++QLMEAAD+DG+G
Sbjct  370  ENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIKQLMEAADMDGDG  429

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  430  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  489

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD D KINY+EFVAMM+KG P+LVT
Sbjct  490  IIAEVDTDRDEKINYEEFVAMMKKGNPELVT  520



>ref|XP_008802050.1| PREDICTED: calcium-dependent protein kinase 3-like [Phoenix dactylifera]
Length=525

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGT+T+EEL AG+ K+GTK+SESEVRQLMEAADVDGNG
Sbjct  366  ENLSEEEIMGLKEMFKSMDTDNSGTVTFEELNAGIPKLGTKISESEVRQLMEAADVDGNG  425

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+ED L+KAFEYFD+DKSGYIT++ELE +LKKYN+ D+K IKE
Sbjct  426  TIDYIEFITATMHMNRMEKEDRLFKAFEYFDQDKSGYITLKELEQALKKYNVVDKKAIKE  485

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            II EVDTD+DG+INY+EFV MMR+   +++ 
Sbjct  486  IITEVDTDHDGRINYEEFVVMMRQDNSEIIA  516



>emb|CDY54853.1| BnaC01g15460D [Brassica napus]
Length=525

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  368  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  428  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  488  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  518



>ref|XP_004961071.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=546

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFKS+DTD+SGTIT EEL+ GL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  390  ENLSEEEIVGLKEMFKSLDTDNSGTITLEELRTGLPKLGTKISESEIRQLMEAADVDGNG  449

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH+YKAFEYFDKD SG+IT++ELE +LKKY++ DE TIKE
Sbjct  450  TIDYVEFISATMHMNRLEKEDHIYKAFEYFDKDHSGHITVDELEEALKKYDMGDEATIKE  509

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+I+Y EFVAMM+  +P++V 
Sbjct  510  IIAEVDTDHDGRIDYQEFVAMMKNNSPEIVP  540



>gb|EMT22025.1| Calcium-dependent protein kinase 3 [Aegilops tauschii]
Length=481

 Score =   245 bits (625),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GL+EMFKS+DTD+SGTIT +EL+AGL K+GTK++ESE+RQLMEAADVDGNG
Sbjct  325  ESLSEEEIVGLREMFKSLDTDNSGTITLDELRAGLPKLGTKITESEIRQLMEAADVDGNG  384

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+
Sbjct  385  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKD  444

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINY EFVAMM+  +P++V 
Sbjct  445  IIAEVDTDHDGKINYQEFVAMMKNNSPEIVP  475



>gb|AHN16201.1| CPK3-2.1 [Brassica napus]
Length=527

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEIIGLKEMFK++DTD +G +T EEL+ GL K+G K+SE+E++QLMEAAD+DG+G
Sbjct  370  ENLSEEEIIGLKEMFKALDTDKNGIVTLEELRTGLPKLGNKISEAEIKQLMEAADMDGDG  429

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMHMNR+EREDHLY AF+YFD D SGYITMEELE ++KKYN+ D+K+IKE
Sbjct  430  SIDYLEFISATMHMNRIEREDHLYTAFQYFDNDNSGYITMEELEQAMKKYNMGDDKSIKE  489

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD DGKINY+EFVAMM+KG P+LVT
Sbjct  490  IIAEVDTDRDGKINYEEFVAMMKKGHPELVT  520



>ref|XP_009416404.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSE+EI+GLKEMFKSIDTD+SGTITYEELKAGL K+G    K+SESEVRQLMEAADVD
Sbjct  361  ESLSEDEIMGLKEMFKSIDTDNSGTITYEELKAGLPKLGNLGIKISESEVRQLMEAADVD  420

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDY+EFITATMHMNR+E+EDHLY+AFEYFD+DKSGYIT+EELE +LKKYN+ DEKT
Sbjct  421  GNGSIDYIEFITATMHMNRMEKEDHLYRAFEYFDEDKSGYITVEELEQALKKYNMGDEKT  480

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMRK  349
            IKEII EVDTD DG+INY+EF  MMRK
Sbjct  481  IKEIITEVDTDRDGRINYEEFATMMRK  507



>gb|EMS46165.1| Calcium-dependent protein kinase 3 [Triticum urartu]
Length=350

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  194  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  253

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+
Sbjct  254  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKD  313

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  314  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  344



>dbj|BAJ94561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GL+EMFKS+DTD+SGTIT +EL+AGL K+GTK++ESE+RQLMEAADVDGNG
Sbjct  371  ESLSEEEIVGLREMFKSLDTDNSGTITLDELRAGLPKLGTKITESEIRQLMEAADVDGNG  430

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMHMNR+E+EDH++KAFEYFDKD SGYIT++ELE +LKKY++ DE TIK+
Sbjct  431  TIDYVEFISATMHMNRLEKEDHIFKAFEYFDKDHSGYITVDELEEALKKYDMGDEATIKD  490

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DGKINY EFVAMM+  +P++V 
Sbjct  491  IIAEVDTDHDGKINYQEFVAMMKNNSPEIVP  521



>ref|XP_003569386.1| PREDICTED: calcium-dependent protein kinase 3-like [Brachypodium 
distachyon]
Length=526

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  370  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  429

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  430  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  489

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTDNDG+INY EFVAMMR  +P++V 
Sbjct  490  IIAEVDTDNDGRINYQEFVAMMRNNSPEIVP  520



>ref|XP_009386326.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 3/153 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSEEEI+GLKEMFKS+DTD++GTIT+EELKAGL K+G    K+SESE+RQLMEAADVD
Sbjct  358  ESLSEEEIMGLKEMFKSMDTDNNGTITFEELKAGLPKLGNLGIKISESEIRQLMEAADVD  417

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDY+EFITATMHMNR+EREDHLYKAFE FDKDKSGYIT+EELE +LKKYN+ DEKT
Sbjct  418  GNGSIDYIEFITATMHMNRMEREDHLYKAFECFDKDKSGYITVEELEQALKKYNMGDEKT  477

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            IKEI+AEVD D DG+INYDEFV MM+K T + +
Sbjct  478  IKEILAEVDIDKDGRINYDEFVTMMKKDTSEAI  510



>ref|XP_004969206.1| PREDICTED: calcium-dependent protein kinase 3-like [Setaria italica]
Length=522

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+D D+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  366  ENLSDEEIMGLKEMFRSLDADNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNG  425

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  426  TIDYAEFISATMHLNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  485

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  486  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  516



>ref|NP_001152509.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|ACG47976.1| calcium-dependent protein kinase, isoform 2 [Zea mays]
 gb|AFW83318.1| putative calcium-dependent protein kinase family protein isoform 
1 [Zea mays]
 gb|AFW83319.1| putative calcium-dependent protein kinase family protein isoform 
2 [Zea mays]
Length=530

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  374  ENLSDEEIMGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  433

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  434  TIDYAEFISATMHLNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  493

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  494  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  524



>gb|EAZ12734.1| hypothetical protein OsJ_02652 [Oryza sativa Japonica Group]
 dbj|BAH01699.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  362  ENLSDEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  422  TIDYAEFISATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR   P++  
Sbjct  482  IIAEVDTDHDGRINYQEFVAMMRNNNPEIAP  512



>dbj|BAD61167.1| putative calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
Length=713

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  557  ENLSDEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNG  616

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  617  TIDYAEFISATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  676

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR   P++  
Sbjct  677  IIAEVDTDHDGRINYQEFVAMMRNNNPEIAP  707



>tpg|DAA58514.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=460

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  304  ENLSDEEIMGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  363

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  364  TIDYAEFISATMHLNRLEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  423

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  TP++V 
Sbjct  424  IIAEVDTDHDGRINYQEFVAMMRNNTPEIVP  454



>emb|CAF18446.1| putative calcium-dependent protein kinase [Triticum aestivum]
 emb|CDM83446.1| unnamed protein product [Triticum aestivum]
Length=518

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  362  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+
Sbjct  422  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKD  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  482  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  512



>gb|KJB39673.1| hypothetical protein B456_007G025000 [Gossypium raimondii]
Length=530

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFK +DTD+S TITY+ELKAGL K+GT +SESEVR LMEA D+DGNG
Sbjct  375  ENLSEEEIVGLKEMFKLMDTDNSRTITYDELKAGLCKLGTNVSESEVRLLMEATDIDGNG  434

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+E  LY AF++FDKD SGYITMEEL+ +L+KYN  DEKTI E
Sbjct  435  TIDYVEFITATMHMNRMEKEKRLYTAFQHFDKDNSGYITMEELKQALQKYNTRDEKTINE  494

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            I+AEVD D DG+INYDEFVAMMRKG P+LV
Sbjct  495  ILAEVDIDKDGRINYDEFVAMMRKGNPELV  524



>ref|NP_001169721.1| uncharacterized LOC100383602 [Zea mays]
 gb|ACN34646.1| unknown [Zea mays]
 tpg|DAA58515.1| TPA: putative calcium-dependent protein kinase family protein 
[Zea mays]
Length=524

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  368  ENLSDEEIMGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  427

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+ED + KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  428  TIDYAEFISATMHLNRLEKEDRILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  487

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  TP++V 
Sbjct  488  IIAEVDTDHDGRINYQEFVAMMRNNTPEIVP  518



>gb|EEC71113.1| hypothetical protein OsI_02910 [Oryza sativa Indica Group]
Length=520

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  364  ENLSDEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  424  TIDYAEFISATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR   P++  
Sbjct  484  IIAEVDTDHDGRINYQEFVAMMRNNNPEIAP  514



>ref|XP_006644382.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006644383.1| PREDICTED: calcium-dependent protein kinase 3-like isoform X2 
[Oryza brachyantha]
Length=460

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+RQLMEAADVDGNG
Sbjct  304  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIRQLMEAADVDGNG  363

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMHMN++E+EDH+ KAFEYFDKD SG IT++ELE +LKKY++ D+KTIKE
Sbjct  364  TIDYAEFISATMHMNKLEKEDHILKAFEYFDKDHSGCITVDELEEALKKYDMGDDKTIKE  423

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR   P++  
Sbjct  424  IIAEVDTDHDGRINYQEFVAMMRNNNPEIAP  454



>ref|XP_002455974.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
 gb|EES01094.1| hypothetical protein SORBIDRAFT_03g028340 [Sorghum bicolor]
Length=525

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS+EEI+GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE++QLMEAADVDGNG
Sbjct  369  ENLSDEEIMGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEIKQLMEAADVDGNG  428

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EFI+ATMH+NR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIKE
Sbjct  429  TIDYGEFISATMHLNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKE  488

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVD+D+DG+INY EFVAMMR  +P++V 
Sbjct  489  IIAEVDSDHDGRINYQEFVAMMRNNSPEIVP  519



>dbj|BAJ95679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  364  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KTIK+
Sbjct  424  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTIKD  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  484  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  514



>dbj|BAA81749.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81751.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLKEMFKS+DTD+SGTIT+EELK GL K G+ L+ESEVRQLM AADVDGNG
Sbjct  377  ESLSEEEIMGLKEMFKSMDTDNSGTITFEELKDGLQKQGSNLAESEVRQLMAAADVDGNG  436

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMH+N++E+EDHLY AF++FD+D SG+ITMEELE +L K+ + D  T+KE
Sbjct  437  TIDYLEFITATMHLNKIEKEDHLYAAFQHFDEDSSGFITMEELEQALIKHGMGDPDTLKE  496

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II EVDTD+DG+INYDEFVAMMRKGTP
Sbjct  497  IIREVDTDHDGRINYDEFVAMMRKGTP  523



>gb|KHG14847.1| Calcium-dependent protein kinase 3 [Gossypium arboreum]
Length=530

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI+GLKEMFK +DTD+S TIT++ELKAGL K+GT +SESEVR LMEA D+DGNG
Sbjct  375  ENLSEEEIVGLKEMFKLMDTDNSQTITFDELKAGLCKLGTNVSESEVRLLMEATDIDGNG  434

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMHMNR+E+E  LY AF++FDKD SGYIT+EEL+ +L+KYN  DEKTI E
Sbjct  435  TIDYVEFITATMHMNRMEKEKRLYAAFQHFDKDNSGYITIEELKQALQKYNTRDEKTINE  494

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            I+AEVDTD DG+INYDEFVAMMRK  P+LV
Sbjct  495  ILAEVDTDKDGRINYDEFVAMMRKSNPELV  524



>gb|EPS65220.1| hypothetical protein M569_09555, partial [Genlisea aurea]
Length=457

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEIIGLKE+FKS+DTD+SGT+T+EELK GL K+GTKLSE EVR+ MEAADVDGNG
Sbjct  313  ESLSEEEIIGLKEIFKSMDTDNSGTLTFEELKVGLPKLGTKLSEKEVREFMEAADVDGNG  372

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EF+TATMH NR+ER DHLYKAFE+ D DKSGYIT EELEH LK Y+  D K +KE
Sbjct  373  SIDYMEFVTATMHANRMERGDHLYKAFEFLDADKSGYITPEELEHVLKDYDTGDGKAVKE  432

Query  420  IIAEVDTDNDGKINYDEFVAMMRKG  346
            I++EVDTD DGKINYDEFVAMMRKG
Sbjct  433  ILSEVDTDQDGKINYDEFVAMMRKG  457



>gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
 gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis]
Length=293

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK+MF +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  141  ENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNG  200

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKE
Sbjct  201  TIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKE  260

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INYDEF AMMR GT
Sbjct  261  IISEVDTDNDGRINYDEFCAMMRSGT  286



>gb|EYU35947.1| hypothetical protein MIMGU_mgv1a004350mg [Erythranthe guttata]
Length=532

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMF+ +DTD SGTIT EELK GL+K GTKL+ESEV+QLMEAAD DGNGTI
Sbjct  372  LSEEEIMGLKEMFRGMDTDSSGTITLEELKQGLSKQGTKLTESEVKQLMEAADADGNGTI  431

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT+EELE +L+++ + D+K IKEII
Sbjct  432  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITIEELEQALREFGMGDDKDIKEII  491

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEF AMM+KG PD+V 
Sbjct  492  SEVDADNDGRINYDEFAAMMKKGNPDMVA  520



>gb|ABY59010.1| calcium-dependent protein kinase [Triticum aestivum]
Length=518

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  362  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  421

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++AT+HMNR+E+EDH+ KAFEYFDKD SGYIT++ELE +LKKY++ D+KT K+
Sbjct  422  TIDYSEFVSATIHMNRLEKEDHILKAFEYFDKDHSGYITVDELEEALKKYDMGDDKTNKD  481

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  482  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  512



>ref|XP_009385897.1| PREDICTED: calcium-dependent protein kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 136/146 (93%), Gaps = 3/146 (2%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGT---KLSESEVRQLMEAADVD  610
            E+LSEEEI+GLKEMFKS+DTD+SGT+T EELKAGL K+G    K+SESEV+QL+EAADVD
Sbjct  350  ESLSEEEIMGLKEMFKSMDTDNSGTLTVEELKAGLPKLGNLGIKISESEVKQLIEAADVD  409

Query  609  GNGTIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKT  430
            GNG+IDYLEFITATMHMN++E+EDHL+KAFEYFDKDKSGYIT+EELE +L KYN+ D++T
Sbjct  410  GNGSIDYLEFITATMHMNKMEKEDHLFKAFEYFDKDKSGYITIEELEQALTKYNMGDQQT  469

Query  429  IKEIIAEVDTDNDGKINYDEFVAMMR  352
            IKEIIAEVD +NDG+INY+EFVAMMR
Sbjct  470  IKEIIAEVDINNDGRINYEEFVAMMR  495



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MF+ +DTD+SGTIT EELK GL K G KLS+ E++QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKQMFRGMDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLYKAF+YFDKDKSGYITMEELE +L+++ + D K IKEII
Sbjct  437  DYEEFITATMHMNRMDREEHLYKAFQYFDKDKSGYITMEELEQALREFGMNDAKDIKEII  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD+DNDG+INYDEFVAMM+KG P+  T
Sbjct  497  SEVDSDNDGRINYDEFVAMMKKGNPEAAT  525



>gb|ACA63885.1| calcium-dependent protein kinase [Hordeum vulgare]
Length=520

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLKEMF+S+DTD+SGTIT EEL++GL K+GTK+SESE+ QLMEAADVDGNG
Sbjct  364  ENLSEEEITGLKEMFRSLDTDNSGTITLEELRSGLPKLGTKISESEITQLMEAADVDGNG  423

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY EF++ATMHMNR+E+EDH+ KAFEYFDKD SGYI ++ELE  LKKY++ D+K IK+
Sbjct  424  TIDYSEFVSATMHMNRLEKEDHILKAFEYFDKDHSGYIPVDELEEVLKKYDMGDDKPIKD  483

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            IIAEVDTD+DG+INY EFVAMMR  +P++V 
Sbjct  484  IIAEVDTDHDGRINYQEFVAMMRNNSPEIVP  514



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MF+ +DTD+SGTIT EELK GL K G KLS+ E++QLMEAAD DGNGTI
Sbjct  373  LSEEEIMGLKQMFRGMDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMEAADADGNGTI  432

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLYKAF+YFDKD SGYITMEELE +L+++ + D K IKEII
Sbjct  433  DYEEFITATMHMNRMDREEHLYKAFQYFDKDNSGYITMEELEQALREFGMNDAKDIKEII  492

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD+DNDG+INYDEFVAMM+KG P+  T
Sbjct  493  SEVDSDNDGRINYDEFVAMMKKGNPEAAT  521



>dbj|BAA81748.1| calcium-dependent protein kinase [Marchantia polymorpha]
 dbj|BAA81750.1| calcium-dependent protein kinase [Marchantia polymorpha]
Length=548

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI+GLKEMFKS+DTD+SGTIT+EELK GL K G+ L+ESEVRQLM AADVDG+G
Sbjct  377  ESLSEEEIMGLKEMFKSMDTDNSGTITFEELKDGLQKQGSNLAESEVRQLMAAADVDGDG  436

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDYLEFITATMH+N++++EDHLY AF++FD D SG+ITMEELE +L K+ + D  T+KE
Sbjct  437  TIDYLEFITATMHLNKIDKEDHLYAAFQHFDGDNSGFITMEELEQALIKHGMGDPDTLKE  496

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II EVDTD+DG+INYDEFVAMMRKGTP
Sbjct  497  IIREVDTDHDGRINYDEFVAMMRKGTP  523



>ref|XP_011090473.1| PREDICTED: calcium-dependent protein kinase 17-like [Sesamum 
indicum]
Length=488

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEIIGLKEMFKS+D+D +GTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  329  LSEEEIIGLKEMFKSMDSDGNGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTI  388

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT+EELE +L+++ + D K IKEI+
Sbjct  389  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITIEELEQALREFGMGDGKDIKEIV  448

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVDTDNDG+INYDEF AMM+KG P++V 
Sbjct  449  SEVDTDNDGRINYDEFAAMMKKGNPEIVA  477



>gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=404

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEEL+AGL ++G+KL+E+EVRQLM+AADVDGNG
Sbjct  252  ENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQRLGSKLTETEVRQLMDAADVDGNG  311

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TI+E
Sbjct  312  TIDYIEFITATMHRHRLERDEHLYKAFQYFDKDGSGYITRDELEIAMKEYGMGDEATIRE  371

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY+EF  MMR GT
Sbjct  372  IISEVDTDNDGRINYEEFCTMMRSGT  397



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  390  ENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNG  449

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKE
Sbjct  450  TIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKE  509

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTDNDG+INY+EF AMMR GT
Sbjct  510  IIAEVDTDNDGRINYEEFCAMMRSGT  535



>ref|XP_010247475.1| PREDICTED: calcium-dependent protein kinase 34 [Nelumbo nucifera]
Length=521

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SGTIT EELK GL+K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  365  LSEEEIMGLKQMFKSMDTDNSGTITLEELKQGLSKQGTKLSEYEVKQLMEAADADGNGTI  424

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT EELE +L+++ + D + IKEI+
Sbjct  425  DYDEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITTEELEQALREFGMHDGRDIKEIL  484

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG P+
Sbjct  485  SEVDSDNDGRINYDEFVAMMRKGNPE  510



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  382  ENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNG  441

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKE
Sbjct  442  TIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKE  501

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTDNDG+INY+EF AMMR GT
Sbjct  502  IIAEVDTDNDGRINYEEFCAMMRSGT  527



>gb|KJB09335.1| hypothetical protein B456_001G135000 [Gossypium raimondii]
Length=513

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  357  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  416

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++REDHLY AF++FDKD SGYIT EEL+ +L++Y + D++ IKEII
Sbjct  417  DYDEFITATMHMNRMDREDHLYHAFQHFDKDNSGYITTEELDQALREYGMHDDQDIKEII  476

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  477  SEVDIDNDGRINYDEFVAMMRKGNPE  502



>gb|AAZ76712.1| calcium-dependent protein kinase 1 [Petunia integrifolia subsp. 
inflata]
Length=532

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTI
Sbjct  372  LSEEEIMGLKQMFKSMDTDNSGAITLEELKTGLAKQGTKLSDYEIQQLMEAADADGNGTI  431

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+++E+HLY AF+YFDKD SGYIT+EELE +L+++ ITD K IK+I+
Sbjct  432  DYEEFITATMHMNRMDKEEHLYTAFQYFDKDNSGYITVEELEQALREFGITDGKDIKDIV  491

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD++NDG+INYDEFVAMM+KGTPD
Sbjct  492  AEVDSNNDGRINYDEFVAMMKKGTPD  517



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  369  LSEEEIQGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  428

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  429  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  488

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG PD
Sbjct  489  SEVDSDNDGRINYDEFVAMMRKGNPD  514



>ref|XP_008449648.1| PREDICTED: calcium-dependent protein kinase 34-like [Cucumis 
melo]
Length=535

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  379  LSEEEIMGLKQMFKSMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  438

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF+YFDKD SGYIT EELE +L++Y + D + IKEI+
Sbjct  439  DYDEFITATMHLNRMDREEHLYTAFQYFDKDNSGYITTEELEQALREYGMHDGRDIKEIL  498

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  499  SEVDADNDGRINYDEFVAMMRKGNPE  524



>emb|CDX97174.1| BnaC09g44510D [Brassica napus]
 emb|CDX69700.1| BnaA10g20490D [Brassica napus]
Length=522

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  365  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  424

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  425  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  484

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  485  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  513



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  388  ENLSEEEIKGLKAMFANIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNG  447

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HL+KAF+YFDKD SG+IT +ELE ++K+Y + DE TIKE
Sbjct  448  TIDYIEFITATMHRHRLERDEHLFKAFQYFDKDHSGFITRDELESAMKEYGMGDEATIKE  507

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTDNDG+INY+EF AMMR GT
Sbjct  508  IIAEVDTDNDGRINYEEFCAMMRSGT  533



>gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=391

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEEL+AGL ++G+KL+E+EV+QLM+AADVDGNG
Sbjct  239  ENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNG  298

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HL+KAF+YFDKD SGYIT +ELE ++K+Y + DE TI+E
Sbjct  299  TIDYIEFITATMHRHRLERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGDEATIRE  358

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INYDEF  MMR GT
Sbjct  359  IISEVDTDNDGRINYDEFCTMMRSGT  384



>emb|CDX70450.1| BnaC03g05340D [Brassica napus]
Length=523

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  486  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  514



>ref|XP_009131258.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=523

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  486  SEVDGDNDGRINYDEFVAMMRKGNPDQIP  514



>gb|EPS70504.1| calcium dependent protein kinase 25 [Genlisea aurea]
Length=527

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GLT  GTKL+E+EV+QL+EAAD DGNGTI
Sbjct  367  LSEEEIMGLKEMFKGMDTDNSGTITLEELKHGLTNQGTKLTETEVKQLLEAADSDGNGTI  426

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT+EELE +L+ Y + D K I EI+
Sbjct  427  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITIEELEQALRDYGMADGKNITEIV  486

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMM+KG P+LV 
Sbjct  487  SEVDADNDGRINYDEFVAMMKKGNPELVA  515



>emb|CDP20327.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFK +DTD+SGTIT EELK GL + GTKLSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKQMFKGMDTDNSGTITLEELKQGLAEQGTKLSEYEVKQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF+YFDKD SGYIT+EELE +L+ + ++D K IKEII
Sbjct  431  DYEEFITATMHLNRMDREEHLYTAFQYFDKDNSGYITIEELEQALRDFGMSDGKDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMM+KG PD  T
Sbjct  491  SEVDADNDGRINYDEFVAMMKKGQPDAPT  519



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  431  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  491  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  519



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  486  SEVDGDNDGRINYDEFVAMMRKGNPDQIP  514



>ref|XP_006289327.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
 gb|EOA22225.1| hypothetical protein CARUB_v10002812mg [Capsella rubella]
Length=530

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  373  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  432

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  433  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  492

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  493  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  521



>gb|AHG06449.1| calcium-dependent protein kinase 17 [Brassica napus]
Length=523

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  486  SEVDGDNDGRINYDEFVAMMRKGNPDQIP  514



>gb|KHN23929.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=474

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMF+ +DTD+SGTIT EELK GL K GTKL+E EV+QLMEAAD DGNGTI
Sbjct  314  LSEEEIMGLKEMFRGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGTI  373

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+ RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+
Sbjct  374  DYDEFITATMHMNRMNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEIL  433

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+++T
Sbjct  434  QEVDGDNDGRINYDEFAAMMRKGNPEVMT  462



>ref|NP_196779.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
 sp|Q9FMP5.1|CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17 [Arabidopsis 
thaliana]
 dbj|BAB10036.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAU95457.1| At5g12180 [Arabidopsis thaliana]
 gb|AED91771.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
Length=528

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  431  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  491  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  519



>ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47775.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. 
lyrata]
Length=530

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  373  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  432

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  433  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  492

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  493  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  521



>gb|KFK25494.1| hypothetical protein AALP_AA8G122000 [Arabis alpina]
Length=528

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  431  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  491  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  519



>ref|XP_009121874.1| PREDICTED: calcium-dependent protein kinase 17 [Brassica rapa]
Length=522

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  365  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  424

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  425  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  484

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  485  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  513



>ref|XP_011080420.1| PREDICTED: calcium-dependent protein kinase 34-like [Sesamum 
indicum]
Length=532

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +D+D+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  372  LSEEEIMGLKEMFKGMDSDNSGTITLEELKRGLAKQGTKLSEYEVKQLMEAADADGNGTI  431

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+++E+HLY AF+YFDKDKSGYIT+EELE +L+++ + D K IK+II
Sbjct  432  DYEEFITATMHMNRMDKEEHLYTAFQYFDKDKSGYITVEELEQALREFGMDDGKDIKDII  491

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEF AMMRKG PD
Sbjct  492  SEVDSDNDGRINYDEFAAMMRKGNPD  517



>gb|KFK26202.1| hypothetical protein AALP_AA8G215800 [Arabis alpina]
Length=523

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMF+ +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFRGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG PD
Sbjct  486  SEVDSDNDGRINYDEFVAMMRKGNPD  511



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK+MF +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  377  ENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNG  436

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKE
Sbjct  437  TIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKE  496

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INYDEF AMMR GT
Sbjct  497  IISEVDTDNDGRINYDEFCAMMRSGT  522



>ref|XP_009630031.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKQMFKSMDTDNSGAITLEELKQGLAKQGTKLSDYEIQQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+++E+HLY AF+YFDKD SGYIT+EELE +L+++ +TD K IKEI+
Sbjct  437  DYEEFITATMHMNRMDKEEHLYTAFQYFDKDNSGYITIEELEQALREFGMTDGKDIKEIV  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD++NDG+INY+EFVAMMRKGTP+
Sbjct  497  AEVDSNNDGRINYEEFVAMMRKGTPE  522



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  405  LSEEEIQGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  464

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  465  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  524

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG PD
Sbjct  525  SEVDSDNDGRINYDEFVAMMRKGNPD  550



>ref|XP_008227265.1| PREDICTED: calcium-dependent protein kinase 34-like [Prunus mume]
Length=534

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFKSIDTD+SGTIT EELK GL K GTKLSE E +QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKEMFKSIDTDNSGTITLEELKQGLAKQGTKLSEFEAKQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + I EII
Sbjct  437  DYDEFITATMHLNRMDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDILEII  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD DNDG+INYDEF AMMRKG PD
Sbjct  497  AEVDADNDGRINYDEFCAMMRKGNPD  522



>gb|AGG35954.1| calcium-dependent protein kinase 34 [Brassica napus]
Length=484

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  327  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  386

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  387  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  446

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  447  SEVDGDNDGRINYEEFVAMMRKGNPD  472



>ref|XP_010673770.1| PREDICTED: calcium-dependent protein kinase 17-like [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFKS+D D+SG+IT EELK G+ K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKEMFKSMDADNSGSITLEELKQGMQKQGTKLSEYEVKQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYITMEELE +L+++ + D + IKEI+
Sbjct  437  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITMEELEQALQEFGMHDGRDIKEIV  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  497  SEVDGDNDGRINYDEFVAMMRKGNPE  522



>ref|XP_007015253.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
 gb|EOY32872.1| Calcium-dependent protein kinase 17 [Theobroma cacao]
Length=535

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMF+ +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  379  LSEEEIMGLKEMFRGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  438

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++REDHLY AF++FDKD SGYIT EELE  L++Y + D + IKEI+
Sbjct  439  DYDEFITATMHMNRMDREDHLYHAFQHFDKDNSGYITTEELEQVLREYGMHDGRDIKEIL  498

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG P+
Sbjct  499  SEVDSDNDGRINYDEFVAMMRKGNPE  524



>ref|XP_009126355.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
Length=517

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  360  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  419

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  420  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  479

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  480  SEVDGDNDGRINYEEFVAMMRKGNPD  505



>emb|CDY44912.1| BnaA02g04170D [Brassica napus]
Length=517

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  360  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  419

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  420  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  479

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  480  SEVDGDNDGRINYEEFVAMMRKGNPD  505



>ref|XP_003556786.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=546

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMF+ +DTD+SGTIT EELK GL K GTKL+E EV+QLMEAAD DGNGTI
Sbjct  386  LSEEEIMGLKEMFRGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGTI  445

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+ RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+
Sbjct  446  DYDEFITATMHMNRMNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEIL  505

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+++T
Sbjct  506  QEVDGDNDGRINYDEFAAMMRKGNPEVMT  534



>emb|CDY63783.1| BnaCnng42690D [Brassica napus]
Length=517

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  360  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  419

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  420  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  479

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  480  SEVDGDNDGRINYEEFVAMMRKGNPD  505



>emb|CDX91168.1| BnaC02g04290D [Brassica napus]
Length=523

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  306  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  365

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  366  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  425

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  426  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  454



>ref|XP_010536137.1| PREDICTED: calcium-dependent protein kinase 17 [Tarenaya hassleriana]
Length=521

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  364  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  423

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + I EII
Sbjct  424  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDITEII  483

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+DNDG+INYDEFVAMMRKG PD
Sbjct  484  SEVDSDNDGRINYDEFVAMMRKGNPD  509



>gb|KDP43197.1| hypothetical protein JCGZ_22749 [Jatropha curcas]
Length=531

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK IDTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  374  LSEEEIMGLKEMFKGIDTDNSGTITLEELKQGLAKQGTKLSEFEVKQLMEAADADGNGTI  433

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + IKEII
Sbjct  434  DYDEFITATMHMNRMDREEHLYTAFQHFDKDNSGFITTEELEQALREYGMHDGRDIKEII  493

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  494  SEVDGDNDGRINYDEFVAMMRKGNPE  519



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  358  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  417

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HL+ AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  418  DYGEFIAATMHINRLDREEHLFSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  477

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  478  SEVDGDNDGRINYEEFVAMMRKGNPD  503



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTDDSGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  358  LSEEEIMGLKEMFKGMDTDDSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  417

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HL+ AF++FDKD SGYITMEELE +L+++ ++D + IKEII
Sbjct  418  DYGEFIAATMHINRLDREEHLFSAFQHFDKDNSGYITMEELEQALREFGMSDGRDIKEII  477

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  478  SEVDGDNDGRINYEEFVAMMRKGNPD  503



>gb|KJB21813.1| hypothetical protein B456_004G015100 [Gossypium raimondii]
Length=538

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK+ID+D+SGTIT EELK GL K GTKL+E EV+QLMEAAD D NGTI
Sbjct  377  LSEEEIQGLKEMFKTIDSDNSGTITLEELKQGLAKQGTKLTEYEVKQLMEAADADSNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY+AF++FDKD SGYIT+EELE +L++Y + D K IKEII
Sbjct  437  DYEEFITATMHMNRMDREEHLYRAFQHFDKDNSGYITIEELEQALREYGMHDGKDIKEII  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDGKINYDEFVAMMR+G P+
Sbjct  497  SEVDNDNDGKINYDEFVAMMRRGNPE  522



>ref|XP_010453282.1| PREDICTED: calcium-dependent protein kinase 17 [Camelina sativa]
Length=530

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  373  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  432

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR+++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  433  DYGEFIAATMHINRLDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  492

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  493  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  521



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score =   231 bits (588),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  431  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INY+EFVAMMRKG PD + 
Sbjct  491  SEVDGDNDGRINYEEFVAMMRKGNPDPIP  519



>ref|XP_010419805.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Camelina sativa]
 ref|XP_010491975.1| PREDICTED: calcium-dependent protein kinase 17-like [Camelina 
sativa]
Length=527

 Score =   231 bits (588),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  370  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  429

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR+++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  430  DYGEFIAATMHINRLDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  489

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  490  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  518



>ref|XP_002313265.1| calcium-dependent protein kinase [Populus trichocarpa]
 gb|EEE87220.1| calcium-dependent protein kinase [Populus trichocarpa]
Length=525

 Score =   230 bits (587),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  368  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  427

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII
Sbjct  428  DYDEFITATMHMNRMDREEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEII  487

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  488  SEVDADNDGRINYDEFVAMMRKGNPE  513



>ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=536

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK IDTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  379  LSEEEIMGLKEMFKGIDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  438

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + IKEII
Sbjct  439  DYDEFITATMHLNRMDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDIKEII  498

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD+D+DG+INYDEFVAMMRKG P+
Sbjct  499  SEVDSDHDGRINYDEFVAMMRKGNPE  524



>ref|XP_010492994.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=525

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  368  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  427

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  428  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  487

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  488  SEVDGDNDGRINYEEFVAMMRKGNPD  513



>ref|XP_010419806.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Camelina sativa]
Length=528

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR+++E+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  431  DYGEFIAATMHINRLDKEEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMMRKG PD + 
Sbjct  491  SEVDGDNDGRINYDEFVAMMRKGNPDPIP  519



>ref|XP_010420737.1| PREDICTED: calcium-dependent protein kinase 34-like [Camelina 
sativa]
Length=523

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  486  SEVDGDNDGRINYEEFVAMMRKGNPD  511



>ref|XP_002873943.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50202.1| calcium-dependent protein kinase 34 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  368  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  427

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  428  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  487

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  488  SEVDGDNDGRINYEEFVAMMRKGNPD  513



>ref|XP_010454209.1| PREDICTED: calcium-dependent protein kinase 34 [Camelina sativa]
Length=523

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  486  SEVDGDNDGRINYEEFVAMMRKGNPD  511



>ref|XP_010106395.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXC10389.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFK++DTD+SGTIT EELK GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  381  LSEEEIMGLKQMFKAMDTDNSGTITLEELKQGLAKQGTRLSELEVKQLMEAADADGNGTI  440

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SG+IT EELE +L+++ + D + IKEII
Sbjct  441  DYDEFITATMHMNRMDREEHLYTAFQHFDKDNSGFITTEELEQALREFGMHDGRDIKEII  500

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG PD
Sbjct  501  SEVDADNDGRINYDEFVAMMRKGNPD  526



>ref|XP_010031714.1| PREDICTED: calcium-dependent protein kinase 34-like [Eucalyptus 
grandis]
 gb|KCW51080.1| hypothetical protein EUGRSUZ_J00686 [Eucalyptus grandis]
Length=534

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL+K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  378  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLSKQGTRLSEYEVKQLMEAADADGNGTI  437

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMHMNR++RE+HLY AF+YFDKD SG+IT EELE +L+ + + D + IKEI+
Sbjct  438  DYDEFIAATMHMNRMDREEHLYTAFQYFDKDNSGFITTEELEQALRDFGMHDGRDIKEIL  497

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG PD
Sbjct  498  SEVDADNDGRINYDEFVAMMRKGNPD  523



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG
Sbjct  387  ENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNG  446

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMH +R+ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKE
Sbjct  447  SIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKE  506

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF AMMR G P
Sbjct  507  IISEVDTDNDGRINYEEFCAMMRSGMP  533



>ref|XP_008384073.1| PREDICTED: calcium-dependent protein kinase 33-like [Malus domestica]
Length=397

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD+SGTITYEELK GL ++G++LSE+EVRQLM+AADVDGNG
Sbjct  245  ENLSEEEIKGLKTMFTNMDTDNSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNG  304

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + D+ TI+E
Sbjct  305  SIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSGYITRDELEAAMKEYGMGDDNTIRE  364

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVD DNDGKINY EF AMMR GT
Sbjct  365  IISEVDADNDGKINYSEFCAMMRSGT  390



>ref|XP_006400491.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
 gb|ESQ41944.1| hypothetical protein EUTSA_v10013240mg [Eutrema salsugineum]
Length=527

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  370  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  429

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  430  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  489

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  490  SEVDGDNDGRINYEEFVAMMRKGNPD  515



>ref|XP_009125853.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=522

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  365  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  424

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  425  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  484

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFV MMRKG PD + 
Sbjct  485  SEVDGDNDGRINYDEFVTMMRKGNPDPIP  513



>gb|KHN35744.1| Calcium-dependent protein kinase 33 [Glycine soja]
Length=404

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G++LSE+EV+QLM+AADVDGNG
Sbjct  252  ENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNG  311

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMH +R+ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKE
Sbjct  312  SIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKE  371

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF AMMR G P
Sbjct  372  IISEVDTDNDGRINYEEFCAMMRSGMP  398



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  400  ENLSEEEIKGLKAMFHNIDTDNSGTITYEELKSGLARLGSKLTETEVKQLMEAADVDGNG  459

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMH +R+ER++HL+KAF++FDKD SG+IT +ELE+++K+Y + DE TIKE
Sbjct  460  SIDYIEFITATMHRHRLERDEHLFKAFQHFDKDHSGFITRDELENAMKEYGMGDEATIKE  519

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTDNDG+INY+EF AMMR GT
Sbjct  520  IIAEVDTDNDGRINYEEFCAMMRSGT  545



>ref|XP_009796949.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=537

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SG IT EELK GL K GTKLS+ E++QLMEAAD DGNGTI
Sbjct  378  LSEEEIMGLKQMFKSMDTDNSGAITLEELKQGLAKQGTKLSDYEIQQLMEAADADGNGTI  437

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+++E+HLY AF+YFDKD SG+IT+EELE +L+++ +TD K IKEI+
Sbjct  438  DYEEFITATMHMNRMDKEEHLYTAFQYFDKDNSGFITVEELEQALREFGMTDGKDIKEIV  497

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD++NDG+INY+EFVAMMRKGTP+
Sbjct  498  AEVDSNNDGRINYEEFVAMMRKGTPE  523



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG
Sbjct  387  ENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMEAADVDGNG  446

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMH +R+ER++HLYKAF+YFDKD SG+IT EELE ++ K+ + DE TIKE
Sbjct  447  SIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKE  506

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF AMMR G P
Sbjct  507  IISEVDTDNDGRINYEEFCAMMRSGMP  533



>emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia]
Length=534

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SG IT EELK GL K GTKLS+ E+ QLMEAAD DGNGTI
Sbjct  375  LSEEEIMGLKQMFKSMDTDNSGAITLEELKQGLAKQGTKLSDHEIEQLMEAADADGNGTI  434

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+++E+HLY AF+YFDKD SG+IT+EELE +L+++ +TD K IKEI+
Sbjct  435  DYEEFITATMHMNRMDKEEHLYTAFQYFDKDNSGFITIEELEQALREFGMTDGKDIKEIV  494

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD++NDG+INY+EFVAMMRKGTP+
Sbjct  495  AEVDSNNDGRINYEEFVAMMRKGTPE  520



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ++LSEEEI GLK MF ++DTD SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  391  QSLSEEEIKGLKAMFANMDTDKSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNG  450

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER++HLY AF+YFDKD SGYIT +ELE ++K+Y + DE TIKE
Sbjct  451  TIDYIEFITATMHRHKLERDEHLYSAFQYFDKDSSGYITRDELETAMKEYGMGDEATIKE  510

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            II+EVDTDNDG+INYDEF AMMR GT   V
Sbjct  511  IISEVDTDNDGRINYDEFCAMMRSGTQQPV  540



>gb|EYU46187.1| hypothetical protein MIMGU_mgv1a004352mg [Erythranthe guttata]
Length=531

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT+EELE +L++  + D K I+EII
Sbjct  431  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITIEELEQALREMGMEDGKDIREII  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEF AMM+KG PD
Sbjct  491  SEVDGDNDGRINYDEFAAMMKKGNPD  516



>ref|XP_007213195.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
 gb|EMJ14394.1| hypothetical protein PRUPE_ppa026653mg [Prunus persica]
Length=534

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFKSIDTD+SGTIT EELK GL K GTKLSE E +QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKEMFKSIDTDNSGTITLEELKQGLAKQGTKLSEFEAKQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF++FDKD SGYIT EELE +L++Y + D + I EII
Sbjct  437  DYDEFITATMHLNRMDREEHLYTAFQHFDKDNSGYITTEELEQALREYGMHDGRDILEII  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD DNDG+INYDEF AMMRKG P+
Sbjct  497  AEVDADNDGRINYDEFCAMMRKGNPE  522



>ref|XP_011014420.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  368  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  427

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++R++HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII
Sbjct  428  DYDEFITATMHMNRMDRQEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEII  487

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  488  SEVDADNDGRINYDEFVAMMRKGNPE  513



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK MFK+IDTD+SG+ITYEELK GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  375  ENLSAEEIQGLKAMFKNIDTDESGSITYEELKEGLARLGSKLTEAEVKQLMEAADVDGNG  434

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R+ER++ LYKAF+YFDKD SG+ITM+ELE ++K Y + DE +IK+
Sbjct  435  TIDYIEFISATMHRYRLERDEDLYKAFQYFDKDNSGFITMDELEAAMKDYRMGDEASIKQ  494

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDGKINYDEF AMMR G P
Sbjct  495  IISEVDTDNDGKINYDEFCAMMRGGAP  521



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELKAGL ++G+KLSE+EV+QLM+AADVDGNG
Sbjct  386  ENLSEEEIKGLKAMFTNMDTDKSGTITYEELKAGLARLGSKLSEAEVKQLMQAADVDGNG  445

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +I+E
Sbjct  446  TIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSGYITKDELETAMKEYGMGDEASIRE  505

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            +I+EVDTDNDGKINY+EF  MMR GT
Sbjct  506  VISEVDTDNDGKINYEEFCTMMRSGT  531



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK+GL ++G++LSE EV+QLMEAADVDGNG
Sbjct  406  ENLSEEEIKGLKAMFANMDTDGSGTITYEELKSGLARIGSRLSEPEVKQLMEAADVDGNG  465

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMH +R+ER++HLYKAF+YFDKD SG+IT EELE ++ K+ + DE TIKE
Sbjct  466  SIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSGHITREELETAMTKHGMGDEATIKE  525

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF AMMR G P
Sbjct  526  IISEVDTDNDGRINYEEFCAMMRSGMP  552



>ref|XP_009412989.1| PREDICTED: calcium-dependent protein kinase 17-like [Musa acuminata 
subsp. malaccensis]
Length=523

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK++D+D+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  367  LSEEEIRGLKEMFKNMDSDNSGTITLEELKQGLAKQGTKLSEHEVKQLMEAADADGNGTI  426

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITAT+HMNR++RE+HLY AF+YFDKD SGYITMEELE +LK+  + DEK IK+II
Sbjct  427  DYEEFITATVHMNRMDREEHLYTAFQYFDKDNSGYITMEELEQALKEKGLYDEKEIKDII  486

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +E D DNDG+INYDEF AMMRKG P+
Sbjct  487  SEADVDNDGRINYDEFAAMMRKGNPE  512



>ref|XP_004140192.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 ref|XP_004156049.1| PREDICTED: calcium-dependent protein kinase 17-like [Cucumis 
sativus]
 gb|KGN48093.1| hypothetical protein Csa_6G430690 [Cucumis sativus]
Length=535

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  379  LSEEEIMGLKQMFKSMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  438

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF+YFDKD SG+IT EELE +L++Y + D + IKEI+
Sbjct  439  DYDEFITATMHLNRMDREEHLYTAFQYFDKDNSGFITTEELEQALREYGMHDGRDIKEIL  498

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG INYDEFVAMMRKG P+
Sbjct  499  SEVDGDNDGHINYDEFVAMMRKGNPE  524



>gb|KJB35709.1| hypothetical protein B456_006G124800 [Gossypium raimondii]
Length=524

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  370  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTI  429

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + +KEII
Sbjct  430  DYDEFITATMHMNRMDREEHLYHAFQHFDKDNSGFITTEELEQALREYGMHDGRDLKEII  489

Query  414  AEVDTDNDGKINYDEFVAMMRKGTP  340
            +EVD DNDGKINYDEFVAMMRKG P
Sbjct  490  SEVDIDNDGKINYDEFVAMMRKGNP  514



>ref|XP_006289743.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
 gb|EOA22641.1| hypothetical protein CARUB_v10003311mg [Capsella rubella]
Length=524

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  367  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  426

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+H+Y AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  427  DYGEFIAATMHINRLDREEHIYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  486

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  487  SEVDGDNDGRINYEEFVAMMRKGNPD  512



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG
Sbjct  400  ENLSEEEIKGLKAMFANIDTDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNG  459

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH +R+ER++HLYKAF++FDKD SGYIT +ELE ++K Y + DE +I+E
Sbjct  460  SIDYIEFISATMHRHRLERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIRE  519

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY EF AMMR GT
Sbjct  520  IISEVDTDNDGRINYQEFCAMMRSGT  545



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MF+ IDTD+SGTIT EELK GL K G KLS+ E++QLME+AD DGNGTI
Sbjct  341  LSEEEIMGLKQMFRGIDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMESADADGNGTI  400

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATM MN+++RE+HLYKAF+YFDKD SGYITMEELE +L ++ + D K IKEII
Sbjct  401  DYEEFITATMQMNKMDREEHLYKAFQYFDKDSSGYITMEELEQALIEFGMNDAKDIKEII  460

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD+DNDG+INYDEFVAMM+KG P++ T
Sbjct  461  SEVDSDNDGRINYDEFVAMMKKGNPEVAT  489



>ref|XP_004252886.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum lycopersicum]
Length=535

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MF+ IDTD+SGTIT EELK GL K G KLS+ E++QLME+AD DGNGTI
Sbjct  376  LSEEEIMGLKQMFRGIDTDNSGTITLEELKQGLAKQGNKLSDYEIKQLMESADADGNGTI  435

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATM MN+++RE+HLYKAF+YFDKD SGYITMEELE +L ++ + D K IKEII
Sbjct  436  DYEEFITATMQMNKMDREEHLYKAFQYFDKDSSGYITMEELEQALIEFGMNDAKDIKEII  495

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD+DNDG+INYDEFVAMM+KG P++ T
Sbjct  496  SEVDSDNDGRINYDEFVAMMKKGNPEVAT  524



>emb|CDX85697.1| BnaA02g01160D [Brassica napus]
Length=513

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  306  LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  365

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYITMEELE +L+++ + D + IKEII
Sbjct  366  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMNDGRDIKEII  425

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFV MMRKG PD + 
Sbjct  426  SEVDGDNDGRINYDEFVTMMRKGNPDPIP  454



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis 
sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK GL ++G++LSE+EV+QLMEAADVDGNG
Sbjct  400  ENLSEEEIKGLKAMFANIDTDNSGTITYEELKTGLARLGSRLSEAEVKQLMEAADVDGNG  459

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH +R+ER++HLYKAF++FDKD SGYIT +ELE ++K Y + DE +I+E
Sbjct  460  SIDYIEFISATMHRHRLERDEHLYKAFQFFDKDSSGYITKDELETAMKDYGMGDEASIRE  519

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY EF AMMR GT
Sbjct  520  IISEVDTDNDGRINYQEFCAMMRSGT  545



>gb|KHN28162.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=472

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKL+E EV+QL+EAAD DGNGTI
Sbjct  314  LSEEEIMGLKEMFKGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLLEAADADGNGTI  373

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATM MNR+ RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+
Sbjct  374  DYDEFITATMQMNRMNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEIL  433

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+++T
Sbjct  434  QEVDGDNDGRINYDEFAAMMRKGNPEVMT  462



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK+MF +IDTD+SGTITYEELKAGL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  377  ENLSTEEIQGLKQMFTNIDTDNSGTITYEELKAGLARLGSKLTEAEVQQLMEAADVDGNG  436

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER+DHLYKAF++FDKD SG+IT++ELE ++K Y + D+ TIKE
Sbjct  437  TIDYIEFITATMHRHKLERDDHLYKAFQHFDKDNSGFITIDELEIAMKDYGMGDDDTIKE  496

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INYDEF AMMR GT
Sbjct  497  IISEVDTDNDGRINYDEFCAMMRSGT  522


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 85/182 (47%), Gaps = 48/182 (26%)
 Frame = -1

Query  750  LKEMFKSIDTDDSGTITYEELKAGLTKMGTK-----------------------------  658
            +KE+   +DTD+ G I Y+E  A + + GT+                             
Sbjct  494  IKEIISEVDTDNDGRINYDEFCA-MMRSGTQPQAKSQEYRLTAVPFAVRIPWIFANIRVV  552

Query  657  ---LSESEV-----------RQLMEAADVDGNGTIDYLEFITATMHMNRVEREDHLYKAF  520
               LS+ E            +Q       D +G I Y EF  AT+ M      D  +K  
Sbjct  553  EASLSDEEFNSITTKNSSNHQQPYRKFGSDSDGRISYEEF-CATIAMRLAFDRDQRFKVT  611

Query  519  EYFDKDKSG---YITMEELEHSLKKYNITDEKTIKEIIAEVDTDNDGKINYDEFVAMMRK  349
            E F         +IT++ELE ++K Y + D+ TIKEII+EVDTDNDG+INYDEF AMMR 
Sbjct  612  ELFSFSLQCLYRFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRS  671

Query  348  GT  343
            GT
Sbjct  672  GT  673



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEEL+AGL ++G+KL+E+EV+QLM+AADVDGNG
Sbjct  376  ENLSEEEIQGLKAMFTNIDTDNSGTITYEELRAGLQRLGSKLTEAEVQQLMDAADVDGNG  435

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HL+KAF+YFDKD SGYIT +ELE ++K+Y + +E TI+E
Sbjct  436  TIDYIEFITATMHRHRLERDEHLHKAFQYFDKDGSGYITRDELETAMKEYGMGNEATIRE  495

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INYDEF  MMR GT
Sbjct  496  IISEVDTDNDGRINYDEFCTMMRSGT  521



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITY+ELK+GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  396  ENLSEEEIQGLKAMFTNIDTDNSGTITYDELKSGLARLGSKLTETEVKQLMEAADVDGNG  455

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ERE+HL+KAF++FDKD SG+IT +ELE ++K Y + DE TI+E
Sbjct  456  TIDYIEFITATMHRHRLEREEHLFKAFQFFDKDSSGFITRDELETAMKDYGMGDEATIRE  515

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY EF AMMR GT
Sbjct  516  IISEVDTDNDGRINYSEFCAMMRSGT  541



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK MF ++DTD+SGTITYEELKAGL ++G+KL+E+EVRQLM+AADVDGNG
Sbjct  371  ENLSTEEIQGLKAMFTNMDTDNSGTITYEELKAGLARLGSKLTEAEVRQLMDAADVDGNG  430

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMH +R+ERE++LYKAF+YFDKD SG+IT +ELE ++++Y I D  TIKE
Sbjct  431  SIDYIEFITATMHRHRLEREENLYKAFQYFDKDSSGFITRDELETAMQEYGIGDASTIKE  490

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            IIAEVDTDNDG+INY+EF  MMR G P
Sbjct  491  IIAEVDTDNDGRINYEEFCTMMRTGNP  517



>ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|KEH17263.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=534

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLM+AAD DGNGTI
Sbjct  376  LSEEEIMGLKEMFKGMDTDNSGTITVEELKQGLAKQGTKLSEQEVKQLMDAADADGNGTI  435

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+ RE+HLY AF+YFDKD SG+IT EEL+ +L++YN+ D + IKEI+
Sbjct  436  DYDEFITATMHMNRMNREEHLYTAFQYFDKDNSGFITTEELDQALREYNMHDGRDIKEIL  495

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+  T
Sbjct  496  QEVDGDNDGRINYDEFAAMMRKGNPEAHT  524



>ref|XP_006413708.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
 gb|ESQ55161.1| hypothetical protein EUTSA_v100267671mg, partial [Eutrema salsugineum]
Length=218

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI GLK MF ++DTD SGTITYEELK GL K+G+KLSE+EV+QLMEAADVDGNG
Sbjct  41   ESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLAKLGSKLSEAEVKQLMEAADVDGNG  100

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EF++ATMH   ++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y++ DE +IKE
Sbjct  101  TIDYIEFMSATMH-RYIDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYDMGDEASIKE  159

Query  420  IIAEVDTDNDGKINYDEFVAMMRKG  346
            IIAEVDTDNDG+INY+EF AMMR G
Sbjct  160  IIAEVDTDNDGRINYEEFCAMMRSG  184



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  396  ESLSEEEIKGLKAMFTNIDTDNSGTITYEELKSGLARLGSKLSEAEVQQLMEAADVDGNG  455

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER++HLYKAF+YFDKD SG+IT +ELE ++K+Y + DE TIKE
Sbjct  456  TIDYIEFITATMHRHKLERDEHLYKAFQYFDKDSSGFITRDELESAMKEYGMGDEATIKE  515

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY+EF  MMR GT
Sbjct  516  IISEVDTDNDGRINYEEFCTMMRSGT  541



>ref|XP_007212312.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
 gb|EMJ13511.1| hypothetical protein PRUPE_ppa006748mg [Prunus persica]
Length=397

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G++LSE+EVRQLM+AADVDGNG
Sbjct  245  ENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLARIGSRLSEAEVRQLMDAADVDGNG  304

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K++ + DE TI+E
Sbjct  305  SIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHAMGDENTIRE  364

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVD DNDG+INY EF AMMR GT
Sbjct  365  IISEVDADNDGRINYSEFCAMMRSGT  390



>ref|XP_003528592.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=541

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKL+E EV+QL+EAAD DGNGTI
Sbjct  383  LSEEEIMGLKEMFKGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLLEAADADGNGTI  442

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATM MNR+ RE+HLY AF+YFDKD SG+IT EELE +L++YN+ D + IKEI+
Sbjct  443  DYDEFITATMQMNRMNREEHLYTAFQYFDKDNSGFITTEELEQALREYNMHDGRDIKEIL  502

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+++T
Sbjct  503  QEVDGDNDGRINYDEFAAMMRKGNPEVMT  531



>gb|KJB83565.1| hypothetical protein B456_013G253100 [Gossypium raimondii]
Length=527

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK++DTD+SGTIT EEL+ GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  371  LSEEEIRGLKEMFKAMDTDNSGTITLEELRQGLAKQGTKLSEYEVKQLMEAADADGNGTI  430

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SGYIT EELE +L++Y I D   IK+I+
Sbjct  431  DYDEFITATMHMNRMDREEHLYHAFQHFDKDNSGYITTEELEQALREYGINDSTDIKQIL  490

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMM+KG P+
Sbjct  491  SEVDADNDGRINYDEFVAMMKKGNPE  516



>ref|XP_010099802.1| Calcium-dependent protein kinase 17 [Morus notabilis]
 gb|EXB80470.1| Calcium-dependent protein kinase 17 [Morus notabilis]
Length=538

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MF+++DTD+SGTIT EELK GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  381  LSEEEIMGLKQMFEAMDTDNSGTITLEELKQGLAKQGTRLSELEVKQLMEAADADGNGTI  440

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF++FDKD SG+IT EELE +L+++ + D + IKEII
Sbjct  441  DYDEFITATMHMNRMDREEHLYTAFQHFDKDNSGFITTEELEQALREFGMHDGRDIKEII  500

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG PD
Sbjct  501  SEVDADNDGRINYDEFVAMMRKGNPD  526



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            EN+SEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSESEV+QLMEAADVDGNG
Sbjct  389  ENMSEEEIKGLKTMFANMDTDKSGTITYEELKTGLARLGSKLSESEVKQLMEAADVDGNG  448

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+AT H  R+ER+DHLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +I+E
Sbjct  449  TIDYIEFISATTHRYRMERDDHLYKAFQYFDKDNSGYITRDELETAMKEYGMGDEASIRE  508

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            +IAEVDTDNDG+INY+EF AMMR G+
Sbjct  509  VIAEVDTDNDGRINYEEFCAMMRSGS  534



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFK +DTD+SGTIT EELK GL K GT+LSE+EV+QLMEAAD DGNG I
Sbjct  366  LSEEEIMGLKQMFKGMDTDNSGTITIEELKQGLAKQGTRLSETEVKQLMEAADADGNGII  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR+ RE+H+Y AF++FDKD SGYIT+EELE +L +YN+ D + IKEII
Sbjct  426  DYDEFITATMHMNRLNREEHVYTAFQFFDKDNSGYITIEELEQALHEYNMHDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMM KG P+  T
Sbjct  486  SEVDADNDGRINYDEFVAMMGKGNPEANT  514



>ref|XP_008798404.1| PREDICTED: calcium-dependent protein kinase 17-like [Phoenix 
dactylifera]
Length=525

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFKS+DTD++GTIT+EELK GL+K G+KLSE EV+QLMEAAD DGNGTI
Sbjct  369  LSEEEIMGLKQMFKSMDTDNNGTITFEELKQGLSKQGSKLSEYEVQQLMEAADADGNGTI  428

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT EELE +LK+  + D + IK+II
Sbjct  429  DYEEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITREELEQALKEKGMYDGRDIKDII  488

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AE D DNDG+INYDEFVAMM+KG P+
Sbjct  489  AEADADNDGRINYDEFVAMMKKGNPE  514



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  399  ENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNG  458

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EF+TATMH +R+ER+DHL+KAF++FD D SG+IT +ELE ++K+Y + DE TIKE
Sbjct  459  TIDYIEFVTATMHRHRLERDDHLFKAFQFFDTDHSGFITKDELESAMKEYGMGDEATIKE  518

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTD+DG+INY+EF AMMR GT
Sbjct  519  IIAEVDTDHDGRINYEEFCAMMRSGT  544



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   228 bits (581),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ++LSEEEI GLK MF +IDTD SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  389  QSLSEEEIKGLKAMFTNIDTDRSGTITYEELKSGLARLGSKLSEAEVKQLMEAADVDGNG  448

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +++ER++HL+KAF++FDKD SGYIT +ELE ++K+Y + DE TIKE
Sbjct  449  TIDYIEFITATMHRHKLERDEHLFKAFQFFDKDSSGYITRDELETAMKEYGMGDEATIKE  508

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTPDLV  331
            II+EVDTDNDG+INY+EF AMMR GT   V
Sbjct  509  IISEVDTDNDGRINYEEFCAMMRSGTQQQV  538



>ref|XP_011009111.1| PREDICTED: calcium-dependent protein kinase 34-like [Populus 
euphratica]
Length=525

 Score =   228 bits (580),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  368  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLSEYEVKQLMEAADADGNGTI  427

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMHMNR++R++HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII
Sbjct  428  DYDEFIPATMHMNRMDRQEHLYTAFQHFDKDNSGYITTEELEQALREFGMHDGRDIKEII  487

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  488  SEVDADNDGRINYDEFVAMMRKGNPE  513



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   228 bits (581),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  380  ENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  439

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  ++ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKE
Sbjct  440  SIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKE  499

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVD DNDGKINY+EF AMMR GT
Sbjct  500  IIAEVDADNDGKINYEEFCAMMRSGT  525



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  381  ENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  440

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  ++ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKE
Sbjct  441  SIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKE  500

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVD DNDG+INY+EF AMMR GT
Sbjct  501  IIAEVDADNDGRINYEEFCAMMRSGT  526



>ref|NP_197437.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
 sp|Q3E9C0.1|CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34 [Arabidopsis 
thaliana]
 gb|ABE66169.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AED92691.1| calcium-dependent protein kinase 34 [Arabidopsis thaliana]
Length=523

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EEL+ GL K GT+LSE EV+QLMEAAD DGNGTI
Sbjct  366  LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTI  425

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMH+NR++RE+HLY AF++FDKD SGYIT EELE +L+++ + D + IKEII
Sbjct  426  DYGEFIAATMHINRLDREEHLYSAFQHFDKDNSGYITTEELEQALREFGMNDGRDIKEII  485

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INY+EFVAMMRKG PD
Sbjct  486  SEVDGDNDGRINYEEFVAMMRKGNPD  511



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+ LMEAADVDGNG
Sbjct  380  ENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLARLGSKLSEAEVKNLMEAADVDGNG  439

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  ++ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +IKE
Sbjct  440  SIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKE  499

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            IIAEVD DNDG+INY+EF AMMR GTP
Sbjct  500  IIAEVDADNDGRINYEEFCAMMRSGTP  526



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G++LSE+EV+QLM+AADVDGNG
Sbjct  377  ENLSEEEIKGLKAMFANMDTDSSGTITYEELKTGLARIGSRLSEAEVKQLMDAADVDGNG  436

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDYLEFI+ATMH +R+ER++HLYKAF+YFDKD SGYIT +ELE ++ ++ + DE TIKE
Sbjct  437  SIDYLEFISATMHRHRLERDEHLYKAFQYFDKDNSGYITRDELETAMTQHGMGDEATIKE  496

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF AMMR G P
Sbjct  497  IISEVDTDNDGRINYEEFCAMMRSGMP  523



>ref|XP_006845045.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
 gb|ERN06720.1| hypothetical protein AMTR_s00269p00011940 [Amborella trichopoda]
Length=517

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK++DTD+SGTIT EELK GL+K GTKLSE EV+QLMEAAD DG+GTI
Sbjct  361  LSEEEIMGLKEMFKNMDTDNSGTITLEELKQGLSKQGTKLSEYEVKQLMEAADADGDGTI  420

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++RE+HLY AF+YFDKD SGYIT EELE +L +Y + D + IK+I+
Sbjct  421  DYDEFITATMHMNRMDREEHLYTAFQYFDKDNSGYITPEELEQALLEYGMHDGRDIKDIL  480

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            +EVD DNDG+INYDEFVAMMRKG P+
Sbjct  481  SEVDADNDGRINYDEFVAMMRKGNPE  506



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF +IDTD+SGTITYEELK+GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  397  ENLSEEEIKGLKAMFTNIDTDNSGTITYEELKSGLARLGSKLSENEVKQLMEAADVDGNG  456

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMH +R+ER++HLYKAF++FD D SG+IT +ELE ++ +Y + DE TIKE
Sbjct  457  SIDYIEFITATMHRHRLERDEHLYKAFQHFDTDHSGFITRDELESAMMEYGMGDEATIKE  516

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY+EF AMMR GT
Sbjct  517  IISEVDTDNDGRINYEEFCAMMRSGT  542



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  392  ENLSEEEIKGLKTMFTNMDTDKSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  451

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  ++ER++HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE TIKE
Sbjct  452  SIDYIEFISATMHRYKLERDEHLYKAFQYFDKDSSGYITRDELESAMKEYGMGDEATIKE  511

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVD DNDG+INY+EF AMMR GT
Sbjct  512  IIAEVDADNDGRINYEEFCAMMRSGT  537



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD+SGTITYEELK+GL ++G+KLSE EV+QLMEAADVDGNG
Sbjct  387  ENLSEEEIKGLKAMFANMDTDNSGTITYEELKSGLARLGSKLSEVEVKQLMEAADVDGNG  446

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EF+TATMH +R+ER+DHL+KAF+YFD D SG+IT +ELE ++K+Y + DE TIK+
Sbjct  447  TIDYIEFVTATMHRHRLERDDHLFKAFQYFDTDHSGFITKDELESAMKEYGMGDEATIKD  506

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTD+DG+INY+EF AMMR GT
Sbjct  507  IIAEVDTDHDGRINYEEFCAMMRSGT  532



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV  LMEAADVDGNG
Sbjct  380  ENLSEEEIKGLKAMFTNMDTDKSGTITYEELKTGLARLGSKLSEAEVENLMEAADVDGNG  439

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  ++ERE+HLYKAF+YFDKD SGYIT +ELE ++K+Y + DE +IKE
Sbjct  440  SIDYIEFISATMHRYKLEREEHLYKAFQYFDKDSSGYITRDELELAMKEYGMGDESSIKE  499

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            IIAEVD DNDG+INY+EF AMMR GTP
Sbjct  500  IIAEVDADNDGRINYEEFCAMMRSGTP  526



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK MF ++DTD SGTITYEEL+AGL ++G+KL+E+EVRQLMEAADVDGNG
Sbjct  388  ENLSSEEIQGLKAMFTNMDTDKSGTITYEELRAGLQRLGSKLTEAEVRQLMEAADVDGNG  447

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HLYKAF+YFDKD SG+IT +ELE ++K+Y + DE+TI+E
Sbjct  448  TIDYIEFITATMHRHRLERDEHLYKAFQYFDKDNSGFITRDELETAMKEYGMGDEETIRE  507

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDG+INY+EF  MMR G 
Sbjct  508  IISEVDTDNDGRINYEEFCTMMRSGV  533



>emb|CDX79112.1| BnaA01g11790D [Brassica napus]
Length=563

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  403  ESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  462

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE
Sbjct  463  TIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKE  522

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            +IAEVDTDNDG+INY+EF AMMR GT
Sbjct  523  VIAEVDTDNDGRINYEEFCAMMRSGT  548



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  413  ESLSEEEIKGLKTMFANMDTDQSGTITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  472

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R++R++HL+KAF+YFDKD SG+ITM+ELE ++K+Y + DE +IKE
Sbjct  473  TIDYIEFISATMHRYRLDRDEHLFKAFQYFDKDNSGFITMDELESAMKEYGMGDETSIKE  532

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            +IAEVDTDNDG+INY+EF AMMR GT
Sbjct  533  VIAEVDTDNDGRINYEEFCAMMRSGT  558



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNG
Sbjct  392  EALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNG  451

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKE
Sbjct  452  TIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKE  511

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF  MMR GTP
Sbjct  512  IISEVDTDNDGRINYEEFCTMMRSGTP  538



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNG
Sbjct  392  EALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNG  451

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKE
Sbjct  452  TIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKE  511

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF  MMR GTP
Sbjct  512  IISEVDTDNDGRINYEEFCTMMRSGTP  538



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KLSE+EV+QLM+AADVDGNG
Sbjct  392  EALSEEEIKGLKTMFANMDTDKSGTITYEELKTGLARLGSKLSETEVKQLMDAADVDGNG  451

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K Y I DE +IKE
Sbjct  452  TIDYIEFISATMHRYRLERDEHLYKAFQYFDKDNSGYITRDELETAMKDYGIGDEASIKE  511

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            II+EVDTDNDG+INY+EF  MMR GTP
Sbjct  512  IISEVDTDNDGRINYEEFCTMMRSGTP  538



>ref|XP_004293141.1| PREDICTED: calcium-dependent protein kinase 34 [Fragaria vesca 
subsp. vesca]
Length=531

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFKSIDTD+SGTIT EELK GL K GTKLSE E +QLMEAAD DGNGTI
Sbjct  374  LSEEEIMGLKEMFKSIDTDNSGTITLEELKQGLAKQGTKLSEYEAKQLMEAADADGNGTI  433

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR++RE+HLY AF++FDKD SG+IT EELE +L++Y + D + I+EII
Sbjct  434  DYDEFITATMHLNRMDREEHLYTAFQHFDKDSSGFITTEELESALREYGMHDGRDIREII  493

Query  414  AEVDTDNDGKINYDEFVAMMRKG  346
            AEVD DNDG+INYDEFVAMMRKG
Sbjct  494  AEVDADNDGRINYDEFVAMMRKG  516



>ref|XP_004513232.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=540

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKLSE EV+QLMEAAD DGNGTI
Sbjct  382  LSEEEIMGLKEMFKGMDTDNSGTITIEELKQGLAKQGTKLSEQEVKQLMEAADADGNGTI  441

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR+ RE+HLY AF+YFDKD SG+IT EEL+ +L++YN+ D + IK+I+
Sbjct  442  DYDEFITATMHLNRMNREEHLYTAFQYFDKDNSGFITTEELDQALREYNMHDGRDIKDIL  501

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
             EVD DNDG+INYDEF AMMRKG P+  T
Sbjct  502  QEVDGDNDGRINYDEFAAMMRKGNPEAHT  530



>gb|KCW66998.1| hypothetical protein EUGRSUZ_F007612, partial [Eucalyptus grandis]
Length=170

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEE+I GLK MF ++DTD SGTITYEELK GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  18   ENLSEEDIQGLKAMFANMDTDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNG  77

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFITATMH +++E ++HLYKAF++FDKD SG+ITM+E+E +L+ Y + DE+TI++
Sbjct  78   SIDYIEFITATMHRHKLETDEHLYKAFQHFDKDNSGFITMDEIETALRGYGMGDEETIRD  137

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGTP  340
            IIAEVDTDNDG+I+Y EF AMMR G  
Sbjct  138  IIAEVDTDNDGRIDYQEFCAMMRSGNQ  164



>ref|XP_009404695.1| PREDICTED: calcium-dependent protein kinase 34-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFK++D+D+SGTIT EELK GLTK GTKLSE EV+QL+EAAD DGNGTI
Sbjct  359  LSEEEIKGLKEMFKNMDSDNSGTITVEELKEGLTKQGTKLSEDEVKQLLEAADADGNGTI  418

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITAT+HMNR++RE+HLYKAF+YFDKD SGYIT EELE +LK+  + D + IK+II
Sbjct  419  DYDEFITATVHMNRMDREEHLYKAFQYFDKDNSGYITREELEQALKEKGMYDGQEIKDII  478

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AE D DNDG+INYDEFVAMMRKG P+
Sbjct  479  AEADADNDGRINYDEFVAMMRKGNPE  504



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            E+LSEEEI GLK MF ++DTD SGTITYEELK GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  399  ESLSEEEIKGLKTMFANMDTDKSGTITYEELKTGLARLGSKLTEAEVKQLMEAADVDGNG  458

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFI+ATMH  R +R++H++KAF+YFDKD SG+ITM+ELE ++KKY + DE +IKE
Sbjct  459  TIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSGFITMDELESAMKKYGMGDEASIKE  518

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            IIAEVDTDNDG+INY+EF AMMR GT
Sbjct  519  IIAEVDTDNDGRINYEEFCAMMRSGT  544



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD SG+ITYEELK GL ++G+KLSE+EV+QLMEAADVDGNG
Sbjct  386  ENLSEEEIKGLKAMFTNMDTDKSGSITYEELKTGLARLGSKLSEAEVKQLMEAADVDGNG  445

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HLYKAF+YFDKD SG+IT +ELE ++K+Y + DE +IKE
Sbjct  446  TIDYIEFITATMHRHRLERDEHLYKAFQYFDKDHSGFITRDELETAMKEYGMGDEASIKE  505

Query  420  IIAEVDTDNDGKINYDEFVAMMRKG  346
            II+EVDTDNDG+INY+EF  MMR G
Sbjct  506  IISEVDTDNDGRINYEEFCTMMRSG  530



>ref|XP_009368734.1| PREDICTED: calcium-dependent protein kinase 17-like [Pyrus x 
bretschneideri]
Length=534

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK IDTD+SGTIT EEL+ GL K GTKLSE E +QLMEAAD DGNGTI
Sbjct  377  LSEEEIMGLKEMFKGIDTDNSGTITLEELRQGLAKQGTKLSEVEAQQLMEAADADGNGTI  436

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMH+NR+++E+HLY AF++FDKD SG+IT EELE  L++Y + D + I+EII
Sbjct  437  DYDEFITATMHLNRMDKEEHLYTAFQHFDKDSSGFITTEELEQVLREYGMHDGRDIREII  496

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AE+D DNDG+INYDEFVAMMRKG P+
Sbjct  497  AEIDADNDGRINYDEFVAMMRKGNPE  522



>ref|XP_004491231.1| PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum]
Length=520

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLK+MFK +DTD+SGTIT EELK GL K GT+L+E EV+QLMEAAD DGNG I
Sbjct  363  LSEEEIMGLKQMFKGMDTDNSGTITIEELKQGLAKQGTRLTEQEVKQLMEAADADGNGII  422

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFI ATMHMNR+ RE+H+Y AF+YFDKD SGYIT+EELE +L +YN+ D + IKEII
Sbjct  423  DYDEFIAATMHMNRLNREEHVYTAFQYFDKDNSGYITIEELEQALHEYNMHDGRDIKEII  482

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD DNDG+INYDEFVAMM KG P+  T
Sbjct  483  SEVDADNDGRINYDEFVAMMSKGNPEANT  511



>ref|XP_004961659.1| PREDICTED: calcium-dependent protein kinase 34-like [Setaria 
italica]
Length=573

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI GLKEMFKS+D+D+SGTIT +EL+ GL K GTKLSE+EV+QLMEAAD DGNGTI
Sbjct  414  LSEEEIRGLKEMFKSMDSDNSGTITVDELRRGLAKKGTKLSEAEVQQLMEAADADGNGTI  473

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITATMHMNR++R++HLY AF+YFDKD SGYITMEELE +L++  + D + IK+I+
Sbjct  474  DYEEFITATMHMNRMDRDEHLYTAFQYFDKDNSGYITMEELEQALREKGLLDGRDIKDIV  533

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPD  337
            AEVD DNDG+INY EF AMMRKG PD
Sbjct  534  AEVDADNDGRINYTEFAAMMRKGDPD  559



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLSEEEI GLK MF ++DTD+SGTITYEELK GL ++G++LSE+EVRQLM+AADVDGNG
Sbjct  394  ENLSEEEIKGLKTMFANMDTDNSGTITYEELKTGLARIGSRLSETEVRQLMDAADVDGNG  453

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            +IDY+EFI+ATMH  R+ER++HLYKAF+YFDKD SGYIT +ELE ++K++ + D+ TI+E
Sbjct  454  SIDYIEFISATMHRQRLERDEHLYKAFQYFDKDSSGYITRDELEAAMKEHGMGDDNTIRE  513

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVD DNDGKINY EF AMMR GT
Sbjct  514  IISEVDADNDGKINYSEFCAMMRSGT  539



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  780  ENLSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNG  601
            ENLS EEI GLK+MF +IDTD+SGTITY+ELK GL ++G+KL+E+EV+QLMEAADVDGNG
Sbjct  373  ENLSTEEIQGLKQMFANIDTDNSGTITYDELKNGLARLGSKLTEAEVKQLMEAADVDGNG  432

Query  600  TIDYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKE  421
            TIDY+EFITATMH +R+ER++HLYKAF++FDKD SG+IT +ELE ++K+Y + D+ TIKE
Sbjct  433  TIDYIEFITATMHRHRLERDEHLYKAFQHFDKDNSGHITRDELEAAMKEYGMGDDDTIKE  492

Query  420  IIAEVDTDNDGKINYDEFVAMMRKGT  343
            II+EVDTDNDGKINY+EF AMMR GT
Sbjct  493  IISEVDTDNDGKINYEEFRAMMRSGT  518



>gb|KJB55472.1| hypothetical protein B456_009G078000 [Gossypium raimondii]
Length=532

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -1

Query  774  LSEEEIIGLKEMFKSIDTDDSGTITYEELKAGLTKMGTKLSESEVRQLMEAADVDGNGTI  595
            LSEEEI+GLKEMFK +DTD+SGTIT EELK GL K GTKL+E EV+QLMEAAD DGNGTI
Sbjct  373  LSEEEIMGLKEMFKGMDTDNSGTITLEELKQGLAKQGTKLTEYEVQQLMEAADADGNGTI  432

Query  594  DYLEFITATMHMNRVEREDHLYKAFEYFDKDKSGYITMEELEHSLKKYNITDEKTIKEII  415
            DY EFITAT+HMNR++REDHLY AF++FDKD SGYIT EELE +L+++ + D   IKEI+
Sbjct  433  DYDEFITATVHMNRMDREDHLYHAFQHFDKDNSGYITTEELEQALREHGMHD-ANIKEIV  491

Query  414  AEVDTDNDGKINYDEFVAMMRKGTPDLVT  328
            +EVD+DNDG+INYDEFVAMMRKG P+  T
Sbjct  492  SEVDSDNDGRINYDEFVAMMRKGNPEAHT  520



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1659957175625