BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016K13

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357131.1|  PREDICTED: probable inactive receptor kinase...    304   3e-95   Solanum tuberosum [potatoes]
ref|XP_009617928.1|  PREDICTED: probable inactive receptor kinase...    297   9e-93   Nicotiana tomentosiformis
ref|XP_009620632.1|  PREDICTED: probable inactive receptor kinase...    296   3e-92   Nicotiana tomentosiformis
emb|CDP02178.1|  unnamed protein product                                290   3e-90   Coffea canephora [robusta coffee]
ref|XP_009759220.1|  PREDICTED: probable inactive receptor kinase...    289   8e-90   Nicotiana sylvestris
ref|XP_004233342.1|  PREDICTED: probable inactive receptor kinase...    287   5e-89   Solanum lycopersicum
ref|XP_011098550.1|  PREDICTED: probable inactive receptor kinase...    284   7e-88   Sesamum indicum [beniseed]
ref|XP_004232252.1|  PREDICTED: probable inactive receptor kinase...    280   4e-86   Solanum lycopersicum
ref|XP_006338497.1|  PREDICTED: probable inactive receptor kinase...    279   9e-86   Solanum tuberosum [potatoes]
ref|XP_006431036.1|  hypothetical protein CICLE_v10011313mg             279   1e-85   Citrus clementina [clementine]
ref|XP_011085787.1|  PREDICTED: probable inactive receptor kinase...    278   1e-85   Sesamum indicum [beniseed]
gb|EYU34688.1|  hypothetical protein MIMGU_mgv1a026965mg                277   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_006482508.1|  PREDICTED: probable inactive receptor kinase...    277   6e-85   Citrus sinensis [apfelsine]
ref|XP_003633815.1|  PREDICTED: probable inactive receptor kinase...    270   3e-82   Vitis vinifera
ref|XP_011047296.1|  PREDICTED: probable inactive receptor kinase...    266   5e-81   Populus euphratica
ref|XP_007032365.1|  Leucine-rich repeat protein kinase family pr...    265   2e-80   
gb|KDP45434.1|  hypothetical protein JCGZ_09683                         265   2e-80   Jatropha curcas
ref|XP_002298520.1|  leucine-rich repeat transmembrane protein ki...    265   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_004302375.1|  PREDICTED: probable inactive receptor kinase...    264   3e-80   Fragaria vesca subsp. vesca
ref|XP_010091928.1|  putative inactive receptor kinase                  264   3e-80   Morus notabilis
ref|XP_007044441.1|  Leucine-rich repeat protein kinase family pr...    264   5e-80   
ref|XP_008458707.1|  PREDICTED: probable inactive receptor kinase...    261   5e-79   Cucumis melo [Oriental melon]
ref|XP_002517430.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    261   8e-79   Ricinus communis
ref|XP_004148679.1|  PREDICTED: probable inactive receptor kinase...    259   3e-78   Cucumis sativus [cucumbers]
ref|XP_006438525.1|  hypothetical protein CICLE_v10030999mg             259   4e-78   Citrus clementina [clementine]
ref|XP_007216971.1|  hypothetical protein PRUPE_ppa003100mg             259   4e-78   Prunus persica
dbj|BAF00829.1|  putative receptor kinase                               250   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230695.1|  PREDICTED: probable inactive receptor kinase...    258   1e-77   Prunus mume [ume]
gb|KDO82668.1|  hypothetical protein CISIN_1g007423mg                   258   1e-77   Citrus sinensis [apfelsine]
ref|XP_010272145.1|  PREDICTED: probable inactive receptor kinase...    257   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_011009041.1|  PREDICTED: probable inactive receptor kinase...    257   2e-77   Populus euphratica
ref|XP_011038318.1|  PREDICTED: probable inactive receptor kinase...    256   5e-77   Populus euphratica
ref|XP_002323813.1|  leucine-rich repeat transmembrane protein ki...    256   7e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010498954.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010477749.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_002305238.2|  leucine-rich repeat transmembrane protein ki...    255   1e-76   Populus trichocarpa [western balsam poplar]
gb|KJB11418.1|  hypothetical protein B456_001G257700                    254   1e-76   Gossypium raimondii
ref|XP_002268171.1|  PREDICTED: probable inactive receptor kinase...    254   2e-76   Vitis vinifera
ref|XP_006303937.1|  hypothetical protein CARUB_v10008631mg             254   2e-76   Capsella rubella
ref|XP_010043841.1|  PREDICTED: probable inactive receptor kinase...    254   3e-76   Eucalyptus grandis [rose gum]
ref|XP_010460207.1|  PREDICTED: probable inactive receptor kinase...    253   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_011043889.1|  PREDICTED: probable inactive receptor kinase...    253   5e-76   Populus euphratica
ref|XP_002890616.1|  hypothetical protein ARALYDRAFT_889992             251   3e-75   Arabidopsis lyrata subsp. lyrata
gb|KDP21268.1|  hypothetical protein JCGZ_21739                         251   5e-75   Jatropha curcas
gb|KJB40809.1|  hypothetical protein B456_007G077900                    249   5e-75   Gossypium raimondii
ref|XP_006372487.1|  leucine-rich repeat transmembrane protein ki...    251   5e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010098246.1|  putative inactive receptor kinase                  250   5e-75   
ref|XP_006416011.1|  hypothetical protein EUTSA_v10009684mg             250   6e-75   Eutrema salsugineum [saltwater cress]
gb|KDO72413.1|  hypothetical protein CISIN_1g035917mg                   250   7e-75   Citrus sinensis [apfelsine]
ref|NP_174039.1|  leucine-rich repeat protein kinase family protein     250   7e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KJB31374.1|  hypothetical protein B456_005G188100                    250   7e-75   Gossypium raimondii
ref|XP_007222048.1|  hypothetical protein PRUPE_ppa003089mg             249   1e-74   Prunus persica
emb|CDY14686.1|  BnaC05g19430D                                          249   2e-74   Brassica napus [oilseed rape]
emb|CDY16228.1|  BnaA09g29620D                                          249   2e-74   Brassica napus [oilseed rape]
gb|KJB40808.1|  hypothetical protein B456_007G077900                    249   2e-74   Gossypium raimondii
ref|XP_008221489.1|  PREDICTED: probable inactive receptor kinase...    249   2e-74   Prunus mume [ume]
ref|XP_009115452.1|  PREDICTED: probable inactive receptor kinase...    249   2e-74   Brassica rapa
gb|KFK44612.1|  hypothetical protein AALP_AA1G281300                    249   3e-74   Arabis alpina [alpine rockcress]
ref|XP_008353487.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    246   2e-73   
ref|XP_008341508.1|  PREDICTED: probable inactive receptor kinase...    246   3e-73   
ref|XP_008361793.1|  PREDICTED: probable inactive receptor kinase...    246   5e-73   
ref|XP_009335793.1|  PREDICTED: probable inactive receptor kinase...    245   6e-73   Pyrus x bretschneideri [bai li]
ref|XP_002883614.1|  hypothetical protein ARALYDRAFT_480045             245   8e-73   
ref|XP_004489358.1|  PREDICTED: probable inactive receptor kinase...    244   1e-72   Cicer arietinum [garbanzo]
ref|XP_008379313.1|  PREDICTED: probable inactive receptor kinase...    244   2e-72   
ref|XP_008389562.1|  PREDICTED: probable inactive receptor kinase...    243   5e-72   Malus domestica [apple tree]
ref|XP_010033235.1|  PREDICTED: probable inactive receptor kinase...    243   6e-72   Eucalyptus grandis [rose gum]
ref|XP_010528295.1|  PREDICTED: probable inactive receptor kinase...    241   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_009360430.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    239   8e-71   Pyrus x bretschneideri [bai li]
ref|XP_010532925.1|  PREDICTED: probable inactive receptor kinase...    239   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_006849112.1|  hypothetical protein AMTR_s00028p00246730          239   2e-70   Amborella trichopoda
ref|XP_010684872.1|  PREDICTED: probable inactive receptor kinase...    238   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004298597.1|  PREDICTED: probable inactive receptor kinase...    238   4e-70   Fragaria vesca subsp. vesca
ref|XP_003618423.1|  LRR receptor-like serine/threonine-protein k...    236   1e-69   Medicago truncatula
ref|XP_009602624.1|  PREDICTED: probable inactive receptor kinase...    234   1e-68   Nicotiana tomentosiformis
gb|EYU34129.1|  hypothetical protein MIMGU_mgv1a027001mg                234   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_010683354.1|  PREDICTED: probable inactive receptor kinase...    233   2e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB75784.1|  hypothetical protein B456_012G058000                    232   2e-68   Gossypium raimondii
gb|KHN34180.1|  Putative inactive receptor kinase                       233   3e-68   Glycine soja [wild soybean]
ref|XP_007151169.1|  hypothetical protein PHAVU_004G023700g             233   3e-68   Phaseolus vulgaris [French bean]
pdb|4L68|A  Chain A, Structure Of The Psedudokinase Domain Of Bir...    225   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357223.1|  PREDICTED: probable inactive receptor kinase...    232   6e-68   Solanum tuberosum [potatoes]
gb|KHN13260.1|  Putative inactive receptor kinase                       232   7e-68   Glycine soja [wild soybean]
ref|XP_002875454.1|  hypothetical protein ARALYDRAFT_484619             231   9e-68   
ref|XP_010502845.1|  PREDICTED: probable inactive receptor kinase...    231   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010425626.1|  PREDICTED: probable inactive receptor kinase...    231   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010514548.1|  PREDICTED: probable inactive receptor kinase...    230   3e-67   Camelina sativa [gold-of-pleasure]
gb|KFK33740.1|  hypothetical protein AALP_AA5G053600                    230   4e-67   Arabis alpina [alpine rockcress]
ref|XP_009129373.1|  PREDICTED: probable inactive receptor kinase...    228   1e-66   Brassica rapa
ref|XP_006395364.1|  hypothetical protein EUTSA_v10003844mg             228   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_009799074.1|  PREDICTED: probable inactive receptor kinase...    228   2e-66   Nicotiana sylvestris
emb|CDY04020.1|  BnaC02g37350D                                          228   2e-66   
gb|KFK41423.1|  hypothetical protein AALP_AA2G128900                    226   9e-66   Arabis alpina [alpine rockcress]
ref|XP_002888749.1|  hypothetical protein ARALYDRAFT_894788             226   1e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_006301045.1|  hypothetical protein CARUB_v10021437mg             225   2e-65   Capsella rubella
ref|XP_006290709.1|  hypothetical protein CARUB_v10016807mg             226   2e-65   
emb|CDY47244.1|  BnaA02g29300D                                          225   3e-65   Brassica napus [oilseed rape]
ref|NP_189486.1|  leucine-rich repeat protein kinase-like protein       224   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008800372.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Phoenix dactylifera
emb|CDY11627.1|  BnaC06g31120D                                          221   6e-64   Brassica napus [oilseed rape]
ref|XP_010415671.1|  PREDICTED: probable LRR receptor-like serine...    219   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004238738.1|  PREDICTED: probable inactive receptor kinase...    219   3e-63   Solanum lycopersicum
ref|XP_010551471.1|  PREDICTED: probable inactive receptor kinase...    219   4e-63   Tarenaya hassleriana [spider flower]
emb|CDX85198.1|  BnaC07g25090D                                          214   4e-63   
ref|XP_009151873.1|  PREDICTED: probable inactive receptor kinase...    216   3e-62   Brassica rapa
ref|XP_010912844.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    214   6e-61   
gb|ABR16721.1|  unknown                                                 213   1e-60   Picea sitchensis
ref|XP_010512071.1|  PREDICTED: probable LRR receptor-like serine...    213   1e-60   Camelina sativa [gold-of-pleasure]
gb|AAB61113.1|  Similar to Arabidopsis receptor-like protein kina...    211   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177157.1|  putative LRR receptor-like serine/threonine-pro...    211   4e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38780.1|  BnaA07g28520D                                          209   2e-59   Brassica napus [oilseed rape]
ref|XP_009105677.1|  PREDICTED: probable LRR receptor-like serine...    208   4e-59   Brassica rapa
ref|XP_010471000.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004978090.1|  PREDICTED: probable inactive receptor kinase...    204   3e-57   Setaria italica
ref|XP_008670287.1|  PREDICTED: probable inactive receptor kinase...    194   2e-56   
gb|AEW22944.1|  leucine-rich repeat receptor-like protein kinase        201   3e-56   Cenchrus ciliaris [African foxtail grass]
ref|XP_003580015.1|  PREDICTED: probable inactive receptor kinase...    200   6e-56   Brachypodium distachyon [annual false brome]
ref|XP_006653547.1|  PREDICTED: probable inactive receptor kinase...    197   4e-55   Oryza brachyantha
ref|XP_006390935.1|  hypothetical protein EUTSA_v10018330mg             196   9e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009385796.1|  PREDICTED: probable inactive receptor kinase...    196   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK03355.1|  predicted protein                                      195   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001143239.1|  uncharacterized protein LOC100275764 precursor     192   5e-54   
ref|XP_008669246.1|  PREDICTED: probable inactive receptor kinase...    194   9e-54   Zea mays [maize]
ref|XP_010251401.1|  PREDICTED: probably inactive leucine-rich re...    194   1e-53   Nelumbo nucifera [Indian lotus]
dbj|BAJ90680.1|  predicted protein                                      188   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001067622.1|  Os11g0249900                                       191   2e-53   
ref|XP_010242455.1|  PREDICTED: probably inactive leucine-rich re...    194   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009799665.1|  PREDICTED: probably inactive leucine-rich re...    193   2e-53   Nicotiana sylvestris
ref|XP_002446698.1|  hypothetical protein SORBIDRAFT_06g020750          193   3e-53   Sorghum bicolor [broomcorn]
gb|EAY80522.1|  hypothetical protein OsI_35701                          191   4e-53   Oryza sativa Indica Group [Indian rice]
gb|KJB10817.1|  hypothetical protein B456_001G226700                    191   6e-53   Gossypium raimondii
ref|XP_003624238.1|  Probably inactive leucine-rich repeat recept...    191   9e-53   Medicago truncatula
gb|AFW58657.1|  putative leucine-rich repeat transmembrane protei...    191   1e-52   
gb|AAT94042.1|  putative protein kinase                                 191   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006386865.1|  hypothetical protein POPTR_0002s24100g             191   1e-52   Populus trichocarpa [western balsam poplar]
gb|AAX95167.1|  receptor-like protein kinase                            191   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055553.2|  Os05g0414700                                       191   2e-52   
gb|EAZ17993.1|  hypothetical protein OsJ_33541                          191   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011015307.1|  PREDICTED: probably inactive leucine-rich re...    191   2e-52   Populus euphratica
ref|XP_004290111.1|  PREDICTED: probably inactive leucine-rich re...    191   2e-52   Fragaria vesca subsp. vesca
ref|XP_011024726.1|  PREDICTED: probably inactive leucine-rich re...    190   2e-52   Populus euphratica
ref|NP_001239701.1|  probably inactive leucine-rich repeat recept...    190   3e-52   Glycine max [soybeans]
gb|KJB10818.1|  hypothetical protein B456_001G226700                    190   3e-52   Gossypium raimondii
gb|KJB42638.1|  hypothetical protein B456_007G161400                    190   3e-52   Gossypium raimondii
ref|XP_006601824.1|  PREDICTED: probably inactive leucine-rich re...    190   4e-52   Glycine max [soybeans]
ref|XP_004492888.1|  PREDICTED: probably inactive leucine-rich re...    189   4e-52   
ref|XP_010911215.1|  PREDICTED: probably inactive leucine-rich re...    189   5e-52   Elaeis guineensis
gb|EAZ31160.1|  hypothetical protein OsJ_15259                          189   5e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40510.1|  Probably inactive leucine-rich repeat receptor-li...    189   5e-52   Glycine soja [wild soybean]
ref|XP_010095584.1|  Probably inactive leucine-rich repeat recept...    189   6e-52   
gb|KDP45203.1|  hypothetical protein JCGZ_15068                         189   7e-52   Jatropha curcas
ref|XP_009595674.1|  PREDICTED: probably inactive leucine-rich re...    189   7e-52   Nicotiana tomentosiformis
ref|XP_002962989.1|  hypothetical protein SELMODRAFT_165616             189   9e-52   
ref|NP_001053144.1|  Os04g0487200                                       189   9e-52   
ref|XP_004962081.1|  PREDICTED: probably inactive leucine-rich re...    189   9e-52   Setaria italica
dbj|BAJ86446.1|  predicted protein                                      188   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT26982.1|  Putative inactive receptor kinase                       188   1e-51   
emb|CBI35007.3|  unnamed protein product                                187   1e-51   Vitis vinifera
ref|XP_009619663.1|  PREDICTED: probably inactive leucine-rich re...    188   2e-51   Nicotiana tomentosiformis
ref|XP_007139688.1|  hypothetical protein PHAVU_008G050700g             188   2e-51   Phaseolus vulgaris [French bean]
ref|XP_006662858.1|  PREDICTED: probably inactive leucine-rich re...    187   2e-51   Oryza brachyantha
ref|XP_003568447.1|  PREDICTED: probably inactive leucine-rich re...    187   3e-51   Brachypodium distachyon [annual false brome]
dbj|BAJ94386.1|  predicted protein                                      186   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009358936.1|  PREDICTED: probably inactive leucine-rich re...    187   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_008356275.1|  PREDICTED: probably inactive leucine-rich re...    187   3e-51   
ref|XP_008372669.1|  PREDICTED: probably inactive leucine-rich re...    187   3e-51   
ref|XP_002441100.1|  hypothetical protein SORBIDRAFT_09g020410          187   4e-51   Sorghum bicolor [broomcorn]
ref|XP_008788253.1|  PREDICTED: probably inactive leucine-rich re...    186   4e-51   
gb|EYU46077.1|  hypothetical protein MIMGU_mgv1a002955mg                187   4e-51   Erythranthe guttata [common monkey flower]
ref|XP_002527291.1|  ATP binding protein, putative                      181   5e-51   
ref|XP_009767841.1|  PREDICTED: probably inactive leucine-rich re...    187   5e-51   Nicotiana sylvestris
ref|XP_002980343.1|  hypothetical protein SELMODRAFT_112289             186   5e-51   Selaginella moellendorffii
ref|XP_010679004.1|  PREDICTED: probably inactive leucine-rich re...    187   5e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011089586.1|  PREDICTED: probably inactive leucine-rich re...    187   6e-51   Sesamum indicum [beniseed]
gb|KEH18041.1|  LRR receptor-like kinase                                186   6e-51   Medicago truncatula
ref|XP_008788252.1|  PREDICTED: probably inactive leucine-rich re...    186   7e-51   Phoenix dactylifera
ref|XP_009406402.1|  PREDICTED: probable inactive receptor kinase...    186   8e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79229.1|  hypothetical protein OsI_19968                          188   9e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_009406423.1|  PREDICTED: probably inactive leucine-rich re...    186   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN63265.1|  hypothetical protein VITISV_037939                     186   1e-50   Vitis vinifera
ref|XP_003635622.1|  PREDICTED: probably inactive leucine-rich re...    186   1e-50   Vitis vinifera
emb|CBI23562.3|  unnamed protein product                                186   1e-50   Vitis vinifera
ref|XP_003577638.1|  PREDICTED: probably inactive leucine-rich re...    185   2e-50   Brachypodium distachyon [annual false brome]
gb|KHN22556.1|  Probably inactive leucine-rich repeat receptor-li...    179   2e-50   Glycine soja [wild soybean]
ref|XP_007134301.1|  hypothetical protein PHAVU_010G035800g             185   2e-50   Phaseolus vulgaris [French bean]
ref|XP_010908584.1|  PREDICTED: probably inactive leucine-rich re...    185   2e-50   Elaeis guineensis
ref|XP_003534491.1|  PREDICTED: probably inactive leucine-rich re...    185   2e-50   Glycine max [soybeans]
ref|XP_009406422.1|  PREDICTED: probably inactive leucine-rich re...    185   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22142.1|  Probably inactive leucine-rich repeat receptor-li...    185   2e-50   Glycine soja [wild soybean]
ref|XP_002450551.1|  hypothetical protein SORBIDRAFT_05g006860          184   3e-50   Sorghum bicolor [broomcorn]
ref|XP_006468634.1|  PREDICTED: probably inactive leucine-rich re...    184   3e-50   
gb|KDO43522.1|  hypothetical protein CISIN_1g006982mg                   184   3e-50   Citrus sinensis [apfelsine]
ref|XP_006447934.1|  hypothetical protein CICLE_v10014610mg             184   4e-50   Citrus clementina [clementine]
ref|XP_008801014.1|  PREDICTED: probably inactive leucine-rich re...    184   5e-50   Phoenix dactylifera
ref|XP_006654407.1|  PREDICTED: probably inactive leucine-rich re...    184   5e-50   Oryza brachyantha
ref|XP_004978965.1|  PREDICTED: probably inactive leucine-rich re...    184   5e-50   Setaria italica
ref|XP_008235868.1|  PREDICTED: probably inactive leucine-rich re...    184   6e-50   Prunus mume [ume]
ref|XP_009416988.1|  PREDICTED: probably inactive leucine-rich re...    184   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007201733.1|  hypothetical protein PRUPE_ppa002865mg             184   7e-50   Prunus persica
ref|XP_010547175.1|  PREDICTED: probably inactive leucine-rich re...    183   9e-50   Tarenaya hassleriana [spider flower]
ref|XP_004510191.1|  PREDICTED: probably inactive leucine-rich re...    183   1e-49   Cicer arietinum [garbanzo]
ref|XP_007049531.1|  Probably inactive leucine-rich repeat recept...    183   1e-49   
gb|EMT29216.1|  Putative inactive receptor kinase                       182   2e-49   
ref|XP_010037082.1|  PREDICTED: probably inactive leucine-rich re...    182   2e-49   Eucalyptus grandis [rose gum]
gb|ACN31332.1|  unknown                                                 182   2e-49   Zea mays [maize]
gb|ACN26668.1|  unknown                                                 182   2e-49   Zea mays [maize]
gb|EYU40677.1|  hypothetical protein MIMGU_mgv1a004274mg                181   2e-49   Erythranthe guttata [common monkey flower]
ref|NP_001151988.1|  brassinosteroid LRR receptor kinase precursor      182   2e-49   Zea mays [maize]
ref|NP_001147794.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    182   2e-49   Zea mays [maize]
tpg|DAA41892.1|  TPA: putative leucine-rich repeat transmembrane ...    182   3e-49   
ref|XP_008779573.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    182   3e-49   
gb|AFW78014.1|  putative leucine-rich repeat transmembrane protei...    182   3e-49   
ref|XP_006448523.1|  hypothetical protein CICLE_v10014622mg             182   3e-49   
ref|XP_002267164.2|  PREDICTED: probably inactive leucine-rich re...    181   6e-49   Vitis vinifera
emb|CBI23354.3|  unnamed protein product                                181   6e-49   Vitis vinifera
ref|XP_004242451.1|  PREDICTED: probably inactive leucine-rich re...    181   7e-49   Solanum lycopersicum
ref|XP_011010589.1|  PREDICTED: probably inactive leucine-rich re...    181   7e-49   Populus euphratica
ref|XP_007028124.1|  BAK1-interacting receptor-like kinase 1 isof...    181   8e-49   Theobroma cacao [chocolate]
ref|XP_008382538.1|  PREDICTED: probably inactive leucine-rich re...    181   8e-49   
ref|XP_008447262.1|  PREDICTED: probably inactive leucine-rich re...    181   8e-49   Cucumis melo [Oriental melon]
ref|XP_009342388.1|  PREDICTED: probably inactive leucine-rich re...    181   8e-49   Pyrus x bretschneideri [bai li]
ref|XP_011010442.1|  PREDICTED: probably inactive leucine-rich re...    180   1e-48   Populus euphratica
ref|NP_001238083.1|  protein kinase precursor                           179   1e-48   Glycine max [soybeans]
ref|XP_006598679.1|  PREDICTED: protein kinase isoform X1               180   1e-48   Glycine max [soybeans]
emb|CDP03993.1|  unnamed protein product                                180   1e-48   Coffea canephora [robusta coffee]
ref|XP_006366814.1|  PREDICTED: probably inactive leucine-rich re...    180   2e-48   Solanum tuberosum [potatoes]
ref|XP_006858332.1|  hypothetical protein AMTR_s00064p00147190          179   2e-48   Amborella trichopoda
dbj|BAI94492.1|  receptor-like kinase                                   179   2e-48   Dianthus caryophyllus [carnation]
ref|XP_006379647.1|  hypothetical protein POPTR_0008s07830g             178   4e-48   
ref|XP_010109952.1|  Probably inactive leucine-rich repeat recept...    173   4e-48   
gb|KDO72412.1|  hypothetical protein CISIN_1g040267mg                   177   4e-48   Citrus sinensis [apfelsine]
ref|XP_010673854.1|  PREDICTED: probably inactive leucine-rich re...    179   4e-48   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX85334.1|  BnaC07g26450D                                          178   6e-48   
ref|XP_006379646.1|  hypothetical protein POPTR_0008s07830g             178   7e-48   
ref|XP_004161543.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    177   1e-47   
ref|XP_004148962.1|  PREDICTED: probably inactive leucine-rich re...    177   1e-47   Cucumis sativus [cucumbers]
ref|XP_001774216.1|  predicted protein                                  177   1e-47   
ref|XP_002315108.2|  hypothetical protein POPTR_0010s18550g             177   1e-47   
ref|XP_011015926.1|  PREDICTED: probably inactive leucine-rich re...    177   3e-47   Populus euphratica
gb|AAL32637.1|  receptor-like protein kinase                            176   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568696.1|  BAK1-interacting receptor-like kinase BIR1            176   4e-47   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA96958.1|  receptor-like protein kinase                           176   4e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60365.1|  unknown                                                 176   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493657.1|  PREDICTED: probably inactive leucine-rich re...    175   9e-47   
ref|XP_010482086.1|  PREDICTED: probably inactive leucine-rich re...    175   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006280190.1|  hypothetical protein CARUB_v10026094mg             174   1e-46   Capsella rubella
emb|CDX86309.1|  BnaA06g30260D                                          172   1e-46   
ref|XP_010037095.1|  PREDICTED: probably inactive leucine-rich re...    174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_006395190.1|  hypothetical protein EUTSA_v10003825mg             173   6e-46   
dbj|BAJ33754.1|  unnamed protein product                                172   6e-46   Eutrema halophilum
ref|XP_009151638.1|  PREDICTED: probably inactive leucine-rich re...    172   8e-46   Brassica rapa
ref|XP_002865631.1|  hypothetical protein ARALYDRAFT_494891             172   9e-46   
emb|CDY05685.1|  BnaC02g38520D                                          171   2e-45   
ref|XP_001776665.1|  predicted protein                                  171   3e-45   
dbj|BAF79937.1|  receptor-like kinase                                   171   3e-45   Marchantia polymorpha
emb|CDY48749.1|  BnaA02g30100D                                          170   5e-45   Brassica napus [oilseed rape]
ref|XP_009102236.1|  PREDICTED: probably inactive leucine-rich re...    168   9e-45   Brassica rapa
ref|XP_006378629.1|  hypothetical protein POPTR_0010s18540g             169   1e-44   
ref|XP_009129721.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    168   2e-44   
ref|XP_001751680.1|  predicted protein                                  163   2e-42   
ref|XP_002967283.1|  hypothetical protein SELMODRAFT_87671              158   1e-40   Selaginella moellendorffii
ref|XP_002960437.1|  hypothetical protein SELMODRAFT_164132             156   4e-40   Selaginella moellendorffii
gb|ABR16056.1|  unknown                                                 150   3e-38   Picea sitchensis
gb|KHN12060.1|  Probably inactive leucine-rich repeat receptor-li...    140   1e-35   Glycine soja [wild soybean]
emb|CBI32063.3|  unnamed protein product                                138   2e-34   Vitis vinifera
ref|XP_010242453.1|  PREDICTED: probably inactive leucine-rich re...    139   2e-34   
ref|XP_006588050.1|  PREDICTED: probably inactive leucine-rich re...    134   4e-34   
gb|KHN19188.1|  Probably inactive leucine-rich repeat receptor-li...    135   6e-34   Glycine soja [wild soybean]
gb|KHN45273.1|  Probably inactive leucine-rich repeat receptor-li...    133   9e-34   Glycine soja [wild soybean]
ref|XP_010242454.1|  PREDICTED: probably inactive leucine-rich re...    135   2e-33   
emb|CDX86433.1|  BnaA06g31500D                                          134   1e-32   
ref|XP_004296525.1|  PREDICTED: phytosulfokine receptor 2               129   8e-30   Fragaria vesca subsp. vesca
ref|XP_008648923.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    129   9e-30   Zea mays [maize]
gb|EYU21252.1|  hypothetical protein MIMGU_mgv1a000586mg                126   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_002437497.1|  hypothetical protein SORBIDRAFT_10g028170          126   7e-29   Sorghum bicolor [broomcorn]
gb|EAZ02179.1|  hypothetical protein OsI_24271                          125   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_011082694.1|  PREDICTED: phytosulfokine receptor 2-like          125   1e-28   Sesamum indicum [beniseed]
ref|XP_010060600.1|  PREDICTED: phytosulfokine receptor 2               125   1e-28   Eucalyptus grandis [rose gum]
ref|NP_001058424.1|  Os06g0691800                                       125   1e-28   
ref|XP_004966176.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    125   2e-28   
ref|XP_007213710.1|  hypothetical protein PRUPE_ppa000652mg             125   2e-28   
ref|XP_006370236.1|  hypothetical protein POPTR_0001s40900g             125   2e-28   
ref|XP_006348262.1|  PREDICTED: phytosulfokine receptor 2-like          125   2e-28   
ref|XP_011043822.1|  PREDICTED: phytosulfokine receptor 2-like          124   3e-28   
ref|XP_004244239.1|  PREDICTED: phytosulfokine receptor 2               124   3e-28   
ref|XP_008679942.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    124   4e-28   
ref|XP_008644981.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    124   4e-28   
ref|XP_010537029.1|  PREDICTED: phytosulfokine receptor 2               124   4e-28   
gb|AAU12605.1|  putative leucine-rich repeat receptor-like kinase       124   5e-28   
ref|XP_010540114.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    124   5e-28   
ref|XP_008349995.1|  PREDICTED: phytosulfokine receptor 2-like          124   5e-28   
gb|EAY84518.1|  hypothetical protein OsI_05891                          124   5e-28   
ref|XP_002317487.1|  hypothetical protein POPTR_0011s11780g             123   7e-28   
ref|XP_008226481.1|  PREDICTED: phytosulfokine receptor 2               123   7e-28   
ref|XP_009589875.1|  PREDICTED: phytosulfokine receptor 2               123   7e-28   
gb|EMS55495.1|  Phytosulfokine receptor 2                               123   8e-28   
ref|XP_006847965.1|  hypothetical protein AMTR_s00029p00150520          123   9e-28   
gb|KJB61792.1|  hypothetical protein B456_009G381200                    123   1e-27   
ref|XP_004955312.1|  PREDICTED: phytosulfokine receptor 2-like          123   1e-27   
ref|XP_004496591.1|  PREDICTED: leucine-rich repeat receptor prot...    123   1e-27   
gb|EMT21082.1|  Phytosulfokine receptor 2                               123   1e-27   
gb|EMT20015.1|  Tyrosine-sulfated glycopeptide receptor 1               122   1e-27   
ref|XP_006594757.1|  PREDICTED: phytosulfokine receptor 2-like          122   1e-27   
ref|XP_007021540.1|  Phytosylfokine-alpha receptor 2                    122   2e-27   
ref|XP_010917324.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    122   2e-27   
ref|XP_009340769.1|  PREDICTED: phytosulfokine receptor 2               122   2e-27   
ref|XP_002459218.1|  hypothetical protein SORBIDRAFT_02g000750          122   2e-27   
ref|XP_009804571.1|  PREDICTED: phytosulfokine receptor 2               122   2e-27   
dbj|BAK02212.1|  predicted protein                                      122   2e-27   
dbj|BAD38602.1|  putative Phytosulfokine receptor precursor             122   3e-27   
gb|AAV33325.1|  putative leucine-rich repeat receptor-like kinase       122   3e-27   
gb|AAV33330.1|  putative leucine-rich repeat receptor-like kinase       122   3e-27   
ref|NP_001045924.2|  Os02g0153100                                       122   3e-27   
ref|NP_001045930.1|  Os02g0153900                                       122   3e-27   
gb|KHN28072.1|  Phytosulfokine receptor 2                               121   3e-27   
gb|EEE56322.1|  hypothetical protein OsJ_05418                          121   3e-27   
ref|XP_004305776.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    121   3e-27   
gb|EMT25583.1|  Tyrosine-sulfated glycopeptide receptor 1               121   3e-27   
gb|EMT02814.1|  Tyrosine-sulfated glycopeptide receptor 1               121   4e-27   
ref|XP_008804519.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    121   4e-27   
ref|XP_011031836.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    121   4e-27   
ref|XP_011072717.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    121   4e-27   
ref|XP_003540472.1|  PREDICTED: phytosulfokine receptor 2-like          121   4e-27   
ref|XP_006451809.1|  hypothetical protein CICLE_v10007314mg             121   4e-27   
gb|KDO62543.1|  hypothetical protein CISIN_1g001561mg                   121   5e-27   
ref|XP_007045577.1|  Phytosulfokin receptor 1                           121   5e-27   
gb|KDO62544.1|  hypothetical protein CISIN_1g001561mg                   121   5e-27   
emb|CBI20272.3|  unnamed protein product                                120   5e-27   
ref|XP_006464783.1|  PREDICTED: phytosulfokine receptor 2-like          121   5e-27   
ref|XP_004235515.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    121   5e-27   
gb|AFV66754.1|  putative leucine-rich repeat receptor-like kinase       121   5e-27   
ref|NP_001045933.1|  Os02g0154200                                       121   5e-27   
emb|CDP16836.1|  unnamed protein product                                120   5e-27   
gb|EEE56323.1|  hypothetical protein OsJ_05420                          120   5e-27   
ref|XP_003561510.1|  PREDICTED: phytosulfokine receptor 2               120   5e-27   
gb|AAU12601.1|  putative leucine-rich repeat receptor-like kinase       120   5e-27   
gb|KDO56320.1|  hypothetical protein CISIN_1g0026732mg                  119   6e-27   
ref|XP_007143380.1|  hypothetical protein PHAVU_007G067700g             121   6e-27   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg                119   6e-27   
emb|CAN68931.1|  hypothetical protein VITISV_006966                     120   6e-27   
ref|XP_002282588.1|  PREDICTED: phytosulfokine receptor 2               120   7e-27   
gb|EEC72514.1|  hypothetical protein OsI_05896                          120   7e-27   
emb|CDP07970.1|  unnamed protein product                                120   8e-27   
gb|EMT01347.1|  Tyrosine-sulfated glycopeptide receptor 1               120   8e-27   
ref|XP_010685182.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    120   9e-27   
gb|KCW56446.1|  hypothetical protein EUGRSUZ_I02173                     120   9e-27   
ref|XP_010030822.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    120   1e-26   
gb|EMS44961.1|  Tyrosine-sulfated glycopeptide receptor 1               120   1e-26   
emb|CDO97771.1|  unnamed protein product                                120   1e-26   
ref|XP_008340497.1|  PREDICTED: phytosulfokine receptor 1               119   1e-26   
ref|XP_002304261.2|  leucine-rich repeat family protein                 120   1e-26   
ref|XP_008651929.1|  PREDICTED: phytosulfokine receptor 2               119   1e-26   
ref|XP_009392844.1|  PREDICTED: phytosulfokine receptor 1-like          119   1e-26   
gb|KDP29473.1|  hypothetical protein JCGZ_19302                         119   1e-26   
dbj|BAJ93593.1|  predicted protein                                      118   1e-26   
ref|XP_002864288.1|  hypothetical protein ARALYDRAFT_495467             119   1e-26   
emb|CDY15822.1|  BnaC02g34410D                                          119   1e-26   
ref|XP_006656407.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    119   1e-26   
ref|XP_010527857.1|  PREDICTED: phytosulfokine receptor 1               119   2e-26   
ref|XP_011098286.1|  PREDICTED: phytosulfokine receptor 2-like          119   2e-26   
ref|XP_007227028.1|  hypothetical protein PRUPE_ppa000729mg             119   2e-26   
emb|CDX70023.1|  BnaA10g23720D                                          119   2e-26   
ref|XP_009129163.1|  PREDICTED: phytosulfokine receptor 1               119   2e-26   
emb|CDY09384.1|  BnaA02g26260D                                          119   2e-26   
ref|XP_007138215.1|  hypothetical protein PHAVU_009G190400g             117   2e-26   
ref|XP_007138216.1|  hypothetical protein PHAVU_009G190400g             117   2e-26   
ref|XP_006646900.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    119   2e-26   
ref|XP_007149480.1|  hypothetical protein PHAVU_005G073800g             119   2e-26   
ref|XP_010929346.1|  PREDICTED: phytosulfokine receptor 2               119   2e-26   
gb|AAU12600.1|  putative leucine-rich repeat receptor-like kinase       119   2e-26   
ref|XP_010227389.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    119   2e-26   
ref|XP_004135892.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    119   2e-26   
gb|KJB30601.1|  hypothetical protein B456_005G151100                    119   2e-26   
gb|EEE66438.1|  hypothetical protein OsJ_22811                          119   2e-26   
dbj|BAC20742.1|  putative phytosulfokine receptor                       119   2e-26   
gb|AAV33324.1|  putative leucine-rich repeat receptor-like kinase       119   2e-26   
ref|NP_001058711.1|  Os07g0107800                                       119   2e-26   
ref|XP_006369064.1|  hypothetical protein POPTR_0001s16110g             119   2e-26   
ref|NP_001045931.1|  Os02g0154000                                       119   2e-26   
ref|XP_006369063.1|  hypothetical protein POPTR_0001s16110g             119   2e-26   
ref|XP_008461215.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    119   2e-26   
gb|AAV33329.1|  putative leucine-rich repeat receptor-like kinase       119   3e-26   
gb|KJB13329.1|  hypothetical protein B456_002G068500                    119   3e-26   
ref|XP_010275524.1|  PREDICTED: receptor-like serine/threonine-pr...    115   3e-26   
ref|XP_004960118.1|  PREDICTED: phytosulfokine receptor 1-like          119   3e-26   
ref|XP_006657396.1|  PREDICTED: phytosulfokine receptor 2-like          118   3e-26   
ref|XP_010272395.1|  PREDICTED: phytosulfokine receptor 2-like          119   3e-26   
gb|AAV33323.1|  putative leucine-rich repeat receptor-like kinase       119   3e-26   
gb|AAU12610.1|  putative leucine-rich repeat receptor-like kinase       119   3e-26   
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g             117   3e-26   
gb|KJB08255.1|  hypothetical protein B456_001G074000                    117   3e-26   
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g             117   3e-26   
ref|XP_010241346.1|  PREDICTED: receptor-like serine/threonine-pr...    115   3e-26   
ref|XP_007139047.1|  hypothetical protein PHAVU_009G260500g             119   3e-26   
emb|CDY03063.1|  BnaC07g21640D                                          118   3e-26   
ref|XP_006660065.1|  PREDICTED: receptor-like protein kinase BRI1...    118   3e-26   
ref|XP_004172741.1|  PREDICTED: phytosulfokine receptor 2-like          118   3e-26   
ref|XP_010241344.1|  PREDICTED: receptor-like serine/threonine-pr...    115   4e-26   
ref|XP_008456020.1|  PREDICTED: phytosulfokine receptor 2               118   4e-26   
gb|AAV33327.1|  putative leucine-rich repeat receptor-like kinase       118   4e-26   
gb|EAY84521.1|  hypothetical protein OsI_05894                          118   4e-26   
ref|XP_010241342.1|  PREDICTED: receptor-like serine/threonine-pr...    115   4e-26   
ref|NP_001172807.1|  Os02g0153500                                       118   4e-26   
ref|XP_006433323.1|  hypothetical protein CICLE_v10003419mg             118   4e-26   
ref|NP_001045925.1|  Os02g0153200                                       118   4e-26   
dbj|BAD38603.1|  putative Phytosulfokine receptor precursor             118   4e-26   
ref|XP_004510600.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    118   4e-26   
ref|XP_011029579.1|  PREDICTED: LOW QUALITY PROTEIN: phytosulfoki...    118   4e-26   
ref|XP_006342878.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    118   4e-26   
ref|XP_002273186.2|  PREDICTED: phytosulfokine receptor 1               118   4e-26   
ref|XP_003535621.1|  PREDICTED: leucine-rich repeat receptor prot...    118   4e-26   
ref|XP_009351664.1|  PREDICTED: phytosulfokine receptor 1               118   4e-26   
gb|KHN21723.1|  Leucine-rich repeat receptor protein kinase EXS         118   4e-26   
ref|XP_003575411.2|  PREDICTED: phytosulfokine receptor 1-like          118   4e-26   
ref|XP_010555311.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    118   5e-26   
ref|XP_009122355.1|  PREDICTED: leucine-rich repeat receptor prot...    118   5e-26   
gb|KEH43739.1|  LRR receptor-like kinase family protein                 118   5e-26   
ref|XP_007137583.1|  hypothetical protein PHAVU_009G1385000g            114   5e-26   
ref|XP_010027753.1|  PREDICTED: systemin receptor SR160-like            118   5e-26   
ref|XP_002965106.1|  hypothetical protein SELMODRAFT_83773              117   6e-26   
ref|XP_004146245.1|  PREDICTED: phytosulfokine receptor 2-like          118   6e-26   
ref|XP_002528241.1|  Phytosulfokine receptor precursor, putative        118   6e-26   
ref|XP_008809466.1|  PREDICTED: phytosulfokine receptor 1-like          118   6e-26   
dbj|BAK00265.1|  predicted protein                                      117   6e-26   
ref|XP_002962193.1|  hypothetical protein SELMODRAFT_77054              117   6e-26   
ref|XP_009604086.1|  PREDICTED: phytosulfokine receptor 1               117   6e-26   
gb|EAZ02182.1|  hypothetical protein OsI_24273                          117   6e-26   
gb|KDP45882.1|  hypothetical protein JCGZ_15326                         117   7e-26   
dbj|BAD54522.1|  putative systemin receptor SR160                       117   7e-26   
gb|KHN42486.1|  Phytosulfokine receptor 2                               117   7e-26   
gb|EMT08540.1|  Tyrosine-sulfated glycopeptide receptor 1               118   7e-26   
ref|XP_009371306.1|  PREDICTED: leucine-rich repeat receptor prot...    117   7e-26   
ref|XP_006646899.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    117   7e-26   
ref|XP_003540126.1|  PREDICTED: phytosulfokine receptor 2-like is...    117   8e-26   
ref|XP_009401858.1|  PREDICTED: phytosulfokine receptor 1-like          117   8e-26   
ref|XP_004140449.1|  PREDICTED: phytosulfokine receptor 1-like          117   8e-26   
ref|NP_001045929.1|  Os02g0153700                                       117   8e-26   
ref|XP_010910213.1|  PREDICTED: phytosulfokine receptor 1-like          117   8e-26   
ref|XP_004309218.1|  PREDICTED: leucine-rich repeat receptor prot...    117   8e-26   
gb|KHN08861.1|  LRR receptor-like serine/threonine-protein kinase...    115   8e-26   
ref|XP_008789812.1|  PREDICTED: LOW QUALITY PROTEIN: phytosulfoki...    117   9e-26   
ref|XP_004170602.1|  PREDICTED: leucine-rich repeat receptor prot...    117   9e-26   
ref|XP_002518809.1|  Phytosulfokine receptor precursor, putative        117   9e-26   
ref|XP_008377011.1|  PREDICTED: leucine-rich repeat receptor prot...    117   9e-26   
ref|XP_010032878.1|  PREDICTED: phytosulfokine receptor 1               117   1e-25   
gb|EEC72508.1|  hypothetical protein OsI_05886                          117   1e-25   
ref|XP_004140850.1|  PREDICTED: leucine-rich repeat receptor prot...    117   1e-25   
ref|XP_008439189.1|  PREDICTED: leucine-rich repeat receptor prot...    117   1e-25   
emb|CDY66904.1|  BnaC01g40660D                                          114   1e-25   
ref|XP_002509763.1|  Leucine-rich repeat receptor protein kinase ...    117   1e-25   
gb|EMS56714.1|  Phytosulfokine receptor 1                               117   1e-25   
ref|XP_004955022.1|  PREDICTED: leucine-rich repeat receptor-like...    114   1e-25   
ref|XP_002278935.2|  PREDICTED: systemin receptor SR160                 117   1e-25   
ref|XP_010241481.1|  PREDICTED: leucine-rich repeat receptor prot...    117   1e-25   
ref|XP_010241490.1|  PREDICTED: leucine-rich repeat receptor prot...    117   1e-25   
gb|EYU45925.1|  hypothetical protein MIMGU_mgv1a000641mg                117   1e-25   
emb|CDY41977.1|  BnaA01g05490D                                          117   1e-25   
ref|XP_010241489.1|  PREDICTED: leucine-rich repeat receptor prot...    117   1e-25   
gb|EEC72513.1|  hypothetical protein OsI_05895                          117   1e-25   
ref|XP_008228087.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    117   1e-25   
gb|KCW52373.1|  hypothetical protein EUGRSUZ_J01778                     117   1e-25   
ref|XP_006581954.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-25   
ref|XP_006657277.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    117   1e-25   
ref|XP_010233827.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    117   1e-25   
ref|XP_004952165.1|  PREDICTED: phytosulfokine receptor 1-like          117   1e-25   
gb|AAU12602.1|  putative leucine-rich repeat receptor-like kinase       117   1e-25   
gb|EMT02813.1|  Tyrosine-sulfated glycopeptide receptor 1               116   1e-25   
gb|KGN50791.1|  hypothetical protein Csa_5G263270                       116   1e-25   
ref|XP_010537660.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    117   1e-25   
ref|XP_009614020.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    116   2e-25   
ref|XP_007216800.1|  hypothetical protein PRUPE_ppa023693mg             116   2e-25   
ref|XP_010233828.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    116   2e-25   
gb|EPS65760.1|  hypothetical protein M569_09017                         113   2e-25   
ref|XP_009120729.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    117   2e-25   
gb|KEH18526.1|  LRR receptor-like kinase                                116   2e-25   
dbj|BAC99050.1|  brassinosteroid receptor                               116   2e-25   
ref|XP_010675503.1|  PREDICTED: phytosulfokine receptor 2-like          116   2e-25   
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-25   
ref|XP_011098153.1|  PREDICTED: receptor-like serine/threonine-pr...    112   2e-25   
gb|KEH38701.1|  LRR receptor-like kinase                                116   2e-25   
gb|KEH38700.1|  LRR receptor-like kinase                                116   2e-25   
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-25   
ref|XP_008221004.1|  PREDICTED: phytosulfokine receptor 1               116   2e-25   
ref|XP_011100073.1|  PREDICTED: brassinosteroid LRR receptor kina...    116   2e-25   
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...    115   2e-25   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-25   
ref|XP_008377334.1|  PREDICTED: leucine-rich repeat receptor prot...    116   2e-25   
ref|XP_009780720.1|  PREDICTED: LRR receptor-like serine/threonin...    115   2e-25   
ref|XP_006353398.1|  PREDICTED: leucine-rich repeat receptor prot...    116   2e-25   
gb|KJB68971.1|  hypothetical protein B456_011G001200                    116   2e-25   
emb|CDP12482.1|  unnamed protein product                                112   2e-25   
ref|XP_010236270.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-sul...    116   2e-25   
gb|KDP22307.1|  hypothetical protein JCGZ_26138                         116   2e-25   
gb|EPS68609.1|  hypothetical protein M569_06156                         116   2e-25   
gb|KHN16391.1|  Tyrosine-sulfated glycopeptide receptor 1               115   2e-25   
ref|XP_011035509.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    116   3e-25   
ref|XP_006395801.1|  hypothetical protein EUTSA_v10003581mg             115   3e-25   
ref|XP_009759322.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    116   3e-25   
ref|XP_006648315.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    115   3e-25   
ref|XP_011035511.1|  PREDICTED: tyrosine-sulfated glycopeptide re...    116   3e-25   



>ref|XP_006357131.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=612

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I LDEDFD+RIMDFGLARL+ PPDA ETSFV G+LGEFGYVAPEYSSTM+ S
Sbjct  431  HQNICSNVIFLDEDFDSRIMDFGLARLVTPPDAKETSFVNGELGEFGYVAPEYSSTMVAS  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQ+PLE+T A+EGFKGNLVDWVNQ S SGRIKD IDK IC +G
Sbjct  491  LKGDAYSFGVVLLELATGQRPLEITAADEGFKGNLVDWVNQLSVSGRIKDAIDKHICRKG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+IV+FL+IACNC++SR KERWSMYQ YEAL  MA + G SE YDEFPL+F +Q+TSS
Sbjct  551  HDEEIVKFLKIACNCLISRPKERWSMYQVYEALKSMAEKHGFSEHYDEFPLLFNKQETSS  610

Query  218  PM  213
            P+
Sbjct  611  PI  612



>ref|XP_009617928.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=605

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I LDEDFDARIMDFGLARLM P DA ETSFV G+LGEFGYVAPEYSSTM+ S
Sbjct  424  HQNICSNVIFLDEDFDARIMDFGLARLMTPSDAKETSFVNGELGEFGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGV+LLELATGQ+PLE+TTA++GFKGNLVDWVNQ S SG IKD IDK ICG+G
Sbjct  484  LKGDVYSFGVMLLELATGQRPLEITTADKGFKGNLVDWVNQLSVSGWIKDAIDKHICGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE++VQFL+IA NCV+SR KERWSMYQ YE+L  MA ++G SE +DEFPL+F +QD SS
Sbjct  544  HDEEVVQFLKIASNCVISRPKERWSMYQVYESLKSMAEERGFSEQFDEFPLLFNKQDISS  603

Query  218  PM  213
            P+
Sbjct  604  PI  605



>ref|XP_009620632.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=602

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+   LDED DAR+MDFGLARLM P DA E+SFV G+LGEFGYVAPEYSSTM+PS
Sbjct  420  HQNICSNVFFLDEDLDARLMDFGLARLMTPSDAKESSFVNGELGEFGYVAPEYSSTMVPS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQKPLE+T  EEGFKGNLVDWVNQ S SGRIKD ID++ICG+G
Sbjct  480  LKGDAYSFGVVLLELATGQKPLEVTAGEEGFKGNLVDWVNQLSVSGRIKDAIDQNICGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF-TEQDTS  222
            HDE+IVQFLRIACN VV R K+RWSMYQ YEAL  MA +QG SE YDEFPL+F  E  TS
Sbjct  540  HDEEIVQFLRIACNSVVFRPKDRWSMYQVYEALKSMAERQGFSEQYDEFPLLFGKEATTS  599

Query  221  SPM  213
            SP+
Sbjct  600  SPI  602



>emb|CDP02178.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLDEDFDARIMDFGLARLM   D++E+SFV GDLGEFGYVAPEYSST++ S
Sbjct  424  HQNISSNVILLDEDFDARIMDFGLARLMTSSDSNESSFVNGDLGEFGYVAPEYSSTLVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVL+ELATGQKPLE+  AEEGFKGNLVDWVNQ S SGRIKD ID ++CG+G
Sbjct  484  LKGDAYSFGVVLMELATGQKPLEVGCAEEGFKGNLVDWVNQLSSSGRIKDAIDGALCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+IVQFLRIACNCVVSR K+R SMYQ YE+L  MA +QG SE YDEFPL+F + D
Sbjct  544  HDEEIVQFLRIACNCVVSRPKDRCSMYQVYESLKSMAEKQGFSEQYDEFPLLFGKND  600



>ref|XP_009759220.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=602

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+   LDED DAR+ DFGLARLM P DA E+SFV G+LGEFGYVAPEYSSTM+PS
Sbjct  420  HQNICSNVFFLDEDLDARLTDFGLARLMTPSDAKESSFVNGELGEFGYVAPEYSSTMVPS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQKPLE+T  EEGFKGNLVDWVNQ S SGRIKD ID++ICG+G
Sbjct  480  LKGDAYSFGVVLLELATGQKPLEVTAGEEGFKGNLVDWVNQLSASGRIKDAIDQNICGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF-TEQDTS  222
            HDE+IVQFLRIACN V  R K+RWSMYQ YEAL  M  ++G SE YDEFPL+F  E  TS
Sbjct  540  HDEEIVQFLRIACNSVAFRPKDRWSMYQVYEALKSMGERRGFSEQYDEFPLLFGKEGTTS  599

Query  221  SPM  213
            SP+
Sbjct  600  SPI  602



>ref|XP_004233342.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=603

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I LDEDFDARIMDFGLARL+ PPDA ETSFV G+LGEFGYVAPE    M+ S
Sbjct  426  HQNICSNVIFLDEDFDARIMDFGLARLVTPPDAKETSFVNGELGEFGYVAPE----MVAS  481

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQKPLE+T A+E FKGNLVDWVNQ S SG+IKD IDK IC +G
Sbjct  482  LKGDAYSFGVVLLELATGQKPLEITAADEVFKGNLVDWVNQLSVSGQIKDAIDKHICRKG  541

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+IV+FL+IACNC++SR KERWSMYQ YEAL  MA + G SE YDEFPL+F +Q+TSS
Sbjct  542  HDEEIVKFLKIACNCLISRPKERWSMYQVYEALKSMAEKHGFSEHYDEFPLLFNKQETSS  601

Query  218  PM  213
            P+
Sbjct  602  PI  603



>ref|XP_011098550.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=604

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ +LLDEDFDAR+MDFGLARL+   +++E+SFV GDLGE GYVAPEYSSTM+ S
Sbjct  423  HQNISSNVVLLDEDFDARVMDFGLARLLTSSESNESSFVYGDLGEIGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD+YSFGVVLLELATG KPL+++T +E FKGNLVDWV Q +GSGRIKD +DK +CG+G
Sbjct  483  VKGDSYSFGVVLLELATGLKPLDVSTVDEMFKGNLVDWVKQLAGSGRIKDALDKRLCGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE IV+FLRIACNCVVS+ K+RWSMYQ YE+L  MA + G+SE YDEFPL+F +Q+++S
Sbjct  543  HDEDIVRFLRIACNCVVSQPKDRWSMYQVYESLKSMAEEHGLSEHYDEFPLLFGKQESTS  602

Query  218  PM  213
            P+
Sbjct  603  PL  604



>ref|XP_004232252.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=601

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I LDEDFDAR+MDFGLARLM   DA E+S+V G+LGEFGYVAPEYSSTM+PS
Sbjct  420  HQNICSNVIFLDEDFDARVMDFGLARLMTS-DAKESSYVNGELGEFGYVAPEYSSTMVPS  478

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQKPLE+T  EEGFKGNLVDW+NQ S SGRIKD ID+++ G+G
Sbjct  479  LKGDAYSFGVVLLELATGQKPLEVTAGEEGFKGNLVDWMNQLSASGRIKDAIDQNMRGKG  538

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+IVQFL++ACN VVSR  +RWSMYQ YEAL  MA +QG SE YDEFPL+F ++ T
Sbjct  539  HDEEIVQFLKVACNSVVSRPNDRWSMYQVYEALKSMAEKQGFSEQYDEFPLLFGKEGT  596



>ref|XP_006338497.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=601

 Score =   279 bits (713),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I LDEDFDAR+MDFGLARLM   DA E+S+V G+LGEFGYVAPEYSSTM+PS
Sbjct  420  HQNICSNVIFLDEDFDARVMDFGLARLMTS-DAKESSYVNGELGEFGYVAPEYSSTMVPS  478

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAYSFGVVLLELATGQKPLE+T  EEGFKGNLVDWVNQ S SGRIKD ID+++ G+G
Sbjct  479  LKGDAYSFGVVLLELATGQKPLEVTAGEEGFKGNLVDWVNQLSASGRIKDAIDQNMRGKG  538

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF-TEQDTS  222
            +DE+IVQFL++ACN VVSR  +RWSMYQ YEAL  MA +QG SE YDEFPL+F  E  T 
Sbjct  539  NDEEIVQFLKVACNSVVSRPNDRWSMYQVYEALQSMAEKQGFSEQYDEFPLLFGKEGATR  598

Query  221  SPM  213
            SP+
Sbjct  599  SPV  601



>ref|XP_006431036.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
 gb|ESR44276.1| hypothetical protein CICLE_v10011313mg [Citrus clementina]
Length=612

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ IL+DEDFDARIMDFGLA+LM   D  E+SFV GDLGEFGY+APEYSSTM+ S
Sbjct  434  HQNICSNVILVDEDFDARIMDFGLAKLMTSSD--ESSFVNGDLGEFGYIAPEYSSTMVAS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLEL TG+KPLEL TAE GFKGNLVDWVNQ S SGR K+VIDK++CG+G
Sbjct  492  LKGDVYGIGVVLLELVTGRKPLELGTAEAGFKGNLVDWVNQLSSSGRSKEVIDKALCGKG  551

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+I+QFL++ACNCVVSR K+RWSMYQ Y++LN +AAQ G SE YDEFPLIF  QD  S
Sbjct  552  YDEEILQFLKVACNCVVSRPKDRWSMYQVYQSLNSIAAQHGFSERYDEFPLIFHRQDGGS  611



>ref|XP_011085787.1| PREDICTED: probable inactive receptor kinase At1g27190 [Sesamum 
indicum]
Length=607

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ +LLDEDFDARIMDFGLARLM   +++++SFV GDLGE GYVAPEYSST++ S
Sbjct  426  HQNISSNIVLLDEDFDARIMDFGLARLMTSSESNDSSFVNGDLGEIGYVAPEYSSTLVAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
            TKGDAYSFGVVLLELATG KPL++TTA+E  KGNLVDWVNQ S SGRIKD IDK + G+ 
Sbjct  486  TKGDAYSFGVVLLELATGLKPLDVTTADELCKGNLVDWVNQLSASGRIKDAIDKRLSGKD  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE IV+FLRIACNCVVSR K+RWSMYQ YE+L  MA + G SE YDEFPL+F + + +S
Sbjct  546  HDEDIVRFLRIACNCVVSRPKDRWSMYQVYESLKSMAEEHGFSEQYDEFPLLFGKPEPTS  605

Query  218  PM  213
            P+
Sbjct  606  PI  607



>gb|EYU34688.1| hypothetical protein MIMGU_mgv1a026965mg, partial [Erythranthe 
guttata]
Length=587

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS  ILLDEDFD+RIMDFGLARLM   +++E+SFV GDLGE GYVAPEYSSTM+ S
Sbjct  406  HQNISSGVILLDEDFDSRIMDFGLARLMTSSESNESSFVYGDLGEIGYVAPEYSSTMVAS  465

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
            TKGDAYSFGVVLLELATG KPL+++ A+E FKGNLVDWVNQ   SGRIKD IDK +CG+G
Sbjct  466  TKGDAYSFGVVLLELATGLKPLDVSAADELFKGNLVDWVNQLYISGRIKDAIDKKLCGKG  525

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+IV+FL+IA NCVVSR K+RWSMYQ YE+L  MA + G SE +DEFPL+F +++++S
Sbjct  526  NDEEIVRFLKIASNCVVSRPKDRWSMYQVYESLKSMAEEHGFSEQFDEFPLLFMKKESNS  585

Query  218  PM  213
            P+
Sbjct  586  PI  587



>ref|XP_006482508.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
Length=612

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ IL+DEDFDARIMDFGLA+LM   D  E+SFV GDLGEFGY+APEYSSTM+ S
Sbjct  434  HQNICSNVILVDEDFDARIMDFGLAKLMTSSD--ESSFVNGDLGEFGYIAPEYSSTMVAS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLEL TG+KPLEL TAE GFKGNLVDWVNQ S SGR K+ IDK++CG+G
Sbjct  492  LKGDVYGIGVVLLELVTGRKPLELGTAEAGFKGNLVDWVNQLSSSGRSKEAIDKALCGKG  551

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+I+QFL++ACNCVVSR K+RWSMYQ Y++LN +AAQ G SE YDEFPLIF  QD  S
Sbjct  552  YDEEILQFLKVACNCVVSRPKDRWSMYQVYQSLNSIAAQHGFSERYDEFPLIFHRQDGGS  611



>ref|XP_003633815.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=613

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS+ IL+D+DFDARI+DFGLARLMA  D++ +SFV G LGEFGYVAPEYSSTM+ S
Sbjct  432  HENISSNVILIDDDFDARIVDFGLARLMATSDSNGSSFVNGGLGEFGYVAPEYSSTMVAS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+T AEEGFKGNLV+WVNQ  GSGR KDVID+++CG+G
Sbjct  492  LKGDVYGFGVVLLELVTGQKPLEVTNAEEGFKGNLVEWVNQLCGSGRNKDVIDEALCGKG  551

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IACNC+  R K+R SMYQA+E+L  M    G SE YDEFPLIF +QD
Sbjct  552  HDEEILQFLKIACNCLGPRPKDRLSMYQAFESLKSMGDHHGFSEHYDEFPLIFGKQD  608



>ref|XP_011047296.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=593

 Score =   266 bits (680),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+AIL+DEDFDARIMDFGLA++M   D +E+S++ GDLGE GYVAPEYSSTM+ S
Sbjct  415  HQNICSNAILVDEDFDARIMDFGLAKMMTSSDCNESSYINGDLGEIGYVAPEYSSTMVAS  474

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             +GD Y FGVVLLEL TGQKPL+++TAEEGFKGNLVDWVN  S SGR KD +DK+ICG+G
Sbjct  475  LQGDVYGFGVVLLELVTGQKPLDISTAEEGFKGNLVDWVNHLSSSGRSKDAVDKAICGKG  534

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
            HDE+I QFL+IAC CV++R K+RWSMY+AY++L  +A + G+ E  DEFPLIF +Q
Sbjct  535  HDEEISQFLKIACKCVIARPKDRWSMYEAYQSLKIIAKEHGLPEQDDEFPLIFGKQ  590



>ref|XP_007032365.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY03291.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=606

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ I +DEDFDARIMDFGLA LM   D +ETSF  GDLGEFGY+APEYSSTM+ +
Sbjct  426  QQNICSNVIFVDEDFDARIMDFGLAGLMTSSDVNETSFENGDLGEFGYIAPEYSSTMVTT  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL T QKPLE+   EEG+KGNLVDWVN  S SGRIKD ID S+ G+G
Sbjct  486  LKGDVYGFGVVLLELVTRQKPLEINAGEEGYKGNLVDWVNHLSSSGRIKDAIDNSLRGKG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+I+QFL+IACNCVV+R K+RWSMYQ Y++L  MA + G SE +D+FPLIF++QD  S
Sbjct  546  HDEEILQFLKIACNCVVARPKDRWSMYQVYQSLKSMAEELGFSEQFDDFPLIFSKQDNES  605



>gb|KDP45434.1| hypothetical protein JCGZ_09683 [Jatropha curcas]
Length=598

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ+  S+ IL+DEDFDARIMDFGLARLM   D++E+S+V GDLGEFGYVAPEYSSTM+ S
Sbjct  420  HQSICSNVILVDEDFDARIMDFGLARLMTSSDSNESSYVNGDLGEFGYVAPEYSSTMVAS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPL+++TAEEGFKGNLVDWVN  S SGRIKD IDK++CG+G
Sbjct  480  LKGDVYGFGVVLLELVTGQKPLDISTAEEGFKGNLVDWVNYLSSSGRIKDAIDKTLCGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +DE+I+QFL+IA NCVV+R K+RWSMY+ Y++L       G  E  DEFPLIF +QD
Sbjct  540  NDEEILQFLKIALNCVVARPKDRWSMYRVYQSLKGTGNDLGFPEQDDEFPLIFGKQD  596



>ref|XP_002298520.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE83325.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=595

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+AIL+DEDFDARIMDFGLAR+M   D++E+S+V GDLGE GYVAPEYSSTM+ S
Sbjct  415  HQNICSNAILVDEDFDARIMDFGLARMMTSSDSNESSYVNGDLGEIGYVAPEYSSTMVAS  474

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPL+++TAEEGFKGNLVDWVN  S SGR KD ++K+ICG+G
Sbjct  475  LKGDVYGFGVVLLELVTGQKPLDISTAEEGFKGNLVDWVNNLSSSGRSKDAVEKAICGKG  534

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQ  231
            HDE+I QFL+IAC CV++R K+RWSMY+AY++L  +A + G  +SE  DEFPLIF +Q
Sbjct  535  HDEEISQFLKIACKCVIARPKDRWSMYEAYQSLKIIANEHGLTLSEQDDEFPLIFGKQ  592



>ref|XP_004302375.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=596

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA+LM   D+HE+SFV GDLGE GY+APEY STM+PS
Sbjct  419  HQNICSNVILLDEDFDARIMDFGLAKLMTS-DSHESSFVNGDLGELGYIAPEYPSTMVPS  477

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPLE+ TAEEGFKGN+VDWVN  S S R KD IDK ICG+G
Sbjct  478  LKGDVYGFGIVLLELVTGQKPLEVGTAEEGFKGNVVDWVNHLSSSDRNKDAIDKDICGKG  537

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFL+IAC CVVSR K+RWSMYQ Y AL  M      SE  DEFPLIF + D
Sbjct  538  HDDEILQFLKIACKCVVSRPKDRWSMYQVYHALKSMRRDHSFSEQDDEFPLIFRKPD  594



>ref|XP_010091928.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB47708.1| putative inactive receptor kinase [Morus notabilis]
Length=597

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARIMDFGLARLM   D+HE+SFV GDLGE GYVAPEY ST++ S
Sbjct  421  HQNICSSVILIDEDFDARIMDFGLARLMTS-DSHESSFVNGDLGELGYVAPEYPSTLVAS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGDAY  GVVLLEL TGQKPLE++T +EGFKG LVDWVN  S +GR+KDVIDKS+ G+G
Sbjct  480  LKGDAYGVGVVLLELVTGQKPLEVSTGDEGFKGKLVDWVNHLSNTGRMKDVIDKSLLGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            H+E+I+QFL++ACNCVVSR KERWSMYQ Y++L  M   +G SE  DEFPL+F +Q+ 
Sbjct  540  HEEEILQFLKVACNCVVSRPKERWSMYQVYQSLKGMNNDRGFSEQDDEFPLVFAKQEV  597



>ref|XP_007044441.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00273.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=612

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ FSS+ +LLD+D DARI DFGLARLM   D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  431  HQYFSSNVVLLDDDLDARITDFGLARLMGSRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TGQKP+ ++TAEEGFKGNLVDWVNQ   +GR KD IDK++CG+G
Sbjct  491  LKGDVYSFGVVLLELVTGQKPIGISTAEEGFKGNLVDWVNQLFSTGRSKDAIDKALCGKG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFLR+AC CVV R K+R SMYQ YE+L  MA + G  E YD+FPLIF  QD
Sbjct  551  HDDEIMQFLRVACTCVVPRPKDRPSMYQVYESLKSMAEKHGFFEHYDDFPLIFGRQD  607



>ref|XP_008458707.1| PREDICTED: probable inactive receptor kinase At1g27190 [Cucumis 
melo]
Length=604

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DED+DARIMDFGLARLMA  D+ ++SFV GDLGE GYVAPEY STM+ S
Sbjct  425  HQNICSSVILVDEDYDARIMDFGLARLMAS-DSQDSSFVNGDLGELGYVAPEYPSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+T AEEG+KGNLVDWVNQ S SGRIKDVIDK +CG+G
Sbjct  484  LKGDVYGFGVVLLELITGQKPLEVTKAEEGYKGNLVDWVNQQSTSGRIKDVIDKDLCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+I+QFL+I  NC+VSR K+RWSMYQ Y+++  MA      EP DEFPL+  + D + 
Sbjct  544  NDEEILQFLKITMNCIVSRPKDRWSMYQVYQSMRTMAKDYSFPEPDDEFPLLLGKGD-ND  602

Query  218  PM  213
            PM
Sbjct  603  PM  604



>ref|XP_002517430.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF44972.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=602

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ IL+DEDFDARIMDFGLARLM   D++E+S+V GDLGE GYVAPEYSSTM+ S
Sbjct  424  HQNICSNVILVDEDFDARIMDFGLARLMTSSDSNESSYVNGDLGELGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPL++ T EE FKGNLVDWVNQ S SGR+KD IDKS+CG+G
Sbjct  484  LKGDVYGFGVVLLELVTGQKPLDIATPEEEFKGNLVDWVNQLSSSGRLKDAIDKSLCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+I+QFL+I  NCV++R K+RWSM + Y++L    +  G SE  +EFPLIF +QD 
Sbjct  544  HDEEILQFLKIGLNCVIARPKDRWSMLRVYQSLKVTGSDLGFSEQDEEFPLIFGKQDN  601



>ref|XP_004148679.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 ref|XP_004168438.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cucumis 
sativus]
 gb|KGN52424.1| hypothetical protein Csa_5G633220 [Cucumis sativus]
Length=604

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DED+DARIMDFGLARLMA  D+ ++SFV GDLGE GYVAPEY STM+ S
Sbjct  425  HQNICSSVILVDEDYDARIMDFGLARLMAS-DSQDSSFVNGDLGELGYVAPEYPSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+T AEEG+KGNLVDWVNQ S SGRIKDVID+ +CG+G
Sbjct  484  LKGDVYGFGVVLLELITGQKPLEVTKAEEGYKGNLVDWVNQLSTSGRIKDVIDRDLCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+I+QFL+I  NC+VSR K+RWSMYQ Y+++  MA      EP DEFPL+  + D + 
Sbjct  544  NDEEILQFLKITMNCIVSRPKDRWSMYQVYQSMRTMAKDYSFPEPDDEFPLLLGKGD-ND  602

Query  218  PM  213
            PM
Sbjct  603  PM  604



>ref|XP_006438525.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
 ref|XP_006483300.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Citrus 
sinensis]
 gb|ESR51765.1| hypothetical protein CICLE_v10030999mg [Citrus clementina]
Length=604

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+DFDARI DFGLARL+   D +++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  423  HQYISSNVILIDDDFDARITDFGLARLVGSRDPNDSSFVHGDLGEFGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL++  AEEGFKGNLVDWVN    +GR +DV+DKS+ GRG
Sbjct  483  LKGDVYGFGIVLLELLTGQKPLDVAGAEEGFKGNLVDWVNHLVITGRSRDVVDKSLYGRG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +D++I+QFLR+AC+CVVSR K+R SMYQ YE+L  MA + G SEPYDEFP+IF +QD
Sbjct  543  NDDEIMQFLRVACSCVVSRPKDRPSMYQVYESLKSMAEKHGFSEPYDEFPMIFGKQD  599



>ref|XP_007216971.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
 gb|EMJ18170.1| hypothetical protein PRUPE_ppa003100mg [Prunus persica]
Length=604

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D++E+SFV GDLGE GYVAPEY STM+ S
Sbjct  425  HQNICSNVILLDEDFDARIMDFGLATLTAS-DSNESSFVNGDLGELGYVAPEYPSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLELATGQKPLE+TT EEGFKGN+VDWVN  + SGR KD IDK++CG+G
Sbjct  484  LKGDVYGLGIVLLELATGQKPLEVTTVEEGFKGNVVDWVNHLTNSGRTKDAIDKALCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+I+QFL++A NCVVSR K+RWSMYQ Y +L  M      +E  DEFPLIF + D  S
Sbjct  544  HDEEILQFLKVASNCVVSRPKDRWSMYQVYHSLKSMNKDNSFTEQDDEFPLIFRKPDKDS  603



>dbj|BAF00829.1| putative receptor kinase [Arabidopsis thaliana]
Length=307

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  130  HQFISSNVILLDDDFDARITDYGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  189

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SIC +G
Sbjct  190  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKG  249

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+ 
Sbjct  250  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKHGVSEHYDEFPLVFNKQEA  307



>ref|XP_008230695.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=604

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D++E+SFV GDLGE GYVAPEY STM+ S
Sbjct  425  HQNICSNVILLDEDFDARIMDFGLATLTAS-DSNESSFVTGDLGELGYVAPEYPSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KG+ Y  G+VLLELATGQKPLE+TT EEGFKGN+VDWVN  + SGR KD IDK++CG+G
Sbjct  484  LKGNVYGLGIVLLELATGQKPLEVTTVEEGFKGNVVDWVNHLTSSGRTKDAIDKALCGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+I+QFL++A NCVVSR K+RWSMYQ Y +L  M+     +E  DEFPLIF + D  S
Sbjct  544  HDEEILQFLKVASNCVVSRPKDRWSMYQVYHSLKSMSKDNSFTEQDDEFPLIFRKPDKDS  603



>gb|KDO82668.1| hypothetical protein CISIN_1g007423mg [Citrus sinensis]
Length=604

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+DFDARI DFGLARL+   D +++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  423  HQYISSNVILIDDDFDARITDFGLARLVGSRDPNDSSFVHGDLGEFGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL +GQKPL++  AEEGFKGNLVDWVN    +GR +DV+DKS+ GRG
Sbjct  483  LKGDVYGFGIVLLELLSGQKPLDVAGAEEGFKGNLVDWVNHLVIAGRSRDVVDKSLYGRG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +D++I+QFLR+AC+CVVSR K+R SMYQ YE+L  MA + G SEPYDEFP+IF +QD
Sbjct  543  NDDEIMQFLRVACSCVVSRPKDRPSMYQVYESLKSMAEKHGFSEPYDEFPMIFGKQD  599



>ref|XP_010272145.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nelumbo 
nucifera]
Length=610

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLDEDFDARI DFGLARLM+  D++++SFV GD GEFGYVAPEYSSTM+ S
Sbjct  429  HQNISSNVILLDEDFDARITDFGLARLMSSADSNDSSFVHGDFGEFGYVAPEYSSTMVAS  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLEL TGQKPLE++ AEEGFKGNLVDWVN   GSGRIKD ID+S+ GRG
Sbjct  489  LKGDVYGLGIVLLELVTGQKPLEVSKAEEGFKGNLVDWVNLLIGSGRIKDAIDRSLFGRG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +D++I+QFLR+AC CVVSR K+R SMYQ Y++L  +      SE +DEFPLI+ +QD
Sbjct  549  YDDEILQFLRVACGCVVSRPKDRSSMYQVYQSLKNIGEGPDSSEQFDEFPLIYGKQD  605



>ref|XP_011009041.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=602

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            +QN  S  IL+DEDFDARIMDFGLA+ M   D++E+S+V GDLGEFGYVAPEYSSTM+ S
Sbjct  424  YQNLCSDVILVDEDFDARIMDFGLAK-MTCSDSNESSYVNGDLGEFGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPL+++ AEEGFKG+LVDWVN  S SGR KD +DK+ICG+G
Sbjct  483  LKGDVYGFGVVLLELVTGQKPLDISNAEEGFKGSLVDWVNHLSSSGRSKDAVDKAICGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA-QQGISEPYDEFPLIFTEQD  228
            HDE+I QFL+IACNCVV+R K+RWSMY+ Y++L  +A+    +SE  DEFPLIF +QD
Sbjct  543  HDEEIYQFLKIACNCVVARPKDRWSMYKTYQSLKTIASDHHALSELDDEFPLIFGKQD  600



>ref|XP_011038318.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=607

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI DFGLARL++ PD++++SFV GDLGEFGY+APEYSSTMI S
Sbjct  426  HQYISSNVILLDDDFDARITDFGLARLISSPDSNDSSFVNGDLGEFGYIAPEYSSTMIAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQK L++   EEGFKGNLVDWVNQ   +GR KD +DK++ G+G
Sbjct  486  LKGDVYGFGVVLLELVTGQKALDVNNEEEGFKGNLVDWVNQLVSTGRSKDAVDKALTGKG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFLRIA +CVVSR K+R SMYQ YE+L  MA + G S+ YDEFPLIF +QD
Sbjct  546  HDDEIMQFLRIAGSCVVSRPKDRPSMYQVYESLKGMAEKHGFSDQYDEFPLIFGKQD  602



>ref|XP_002323813.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03946.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=602

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            +QN  S+ IL+DEDFDARIMDFGLA+ M   D++E+S+V GDLGEFGYVAPEYSSTM+ S
Sbjct  424  YQNMCSNVILVDEDFDARIMDFGLAK-MTCSDSNESSYVNGDLGEFGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPL+++ AEEGFKG+LVDWVN  S SGR KD +DK+ICG+G
Sbjct  483  LKGDVYGFGVVLLELVTGQKPLDISNAEEGFKGSLVDWVNHLSSSGRSKDAVDKAICGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI-SEPYDEFPLIFTEQD  228
            HDE I QFL+IACNCV++R K+RWSMY+ Y++L  +A++  + SE  DEFPLIF +QD
Sbjct  543  HDEGIYQFLKIACNCVIARPKDRWSMYKTYQSLKTIASEHHVLSELDDEFPLIFGKQD  600



>ref|XP_010498954.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  421  HQFISSNVILLDDDFDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  480

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SICG+G
Sbjct  481  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  541  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKSMADKHGVSEHYDEFPLVFNKQE  597



>ref|XP_010477749.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=600

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  423  HQFISSNVILLDDDFDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SICG+G
Sbjct  483  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  543  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKSMADKHGVSEHYDEFPLVFNKQE  599



>ref|XP_002305238.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE85749.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=609

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI DFGLARL++ PD++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  428  HQYISSNVILLDDDFDARITDFGLARLISSPDSNDSSFVHGDLGEFGYVAPEYSSTMVAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL +GQKPL+++ AEEGFKGNLVDWVNQ +  GR  D IDK++ G+G
Sbjct  488  LKGDVYGFGVVLLELVSGQKPLDVSNAEEGFKGNLVDWVNQLASIGRSTDAIDKALVGKG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFL++A +CVVSR K+R +MYQ YE+L  MA + G S+ YDEFPLIF +QD
Sbjct  548  HDDEIMQFLKVAWSCVVSRPKDRPTMYQIYESLKGMAEKHGFSDKYDEFPLIFGKQD  604



>gb|KJB11418.1| hypothetical protein B456_001G257700 [Gossypium raimondii]
Length=588

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 142/181 (78%), Gaps = 1/181 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DED DAR+MDFGLA LM   D +ETSF+K DLGEFGY+APEYSSTM+ S
Sbjct  407  QQNICSNVILVDEDLDARLMDFGLAGLMTSSDVNETSFMKSDLGEFGYIAPEYSSTMVAS  466

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL T QKPL++ T EEGFKG+LVDW+N  S SGRI+D IDK + G+G
Sbjct  467  LKGDVYGFGVVLLELVTRQKPLQVNTGEEGFKGHLVDWINHLSNSGRIEDAIDKDVIGKG  526

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE-PYDEFPLIFTEQDTS  222
            HDEQI + L+IACNCVV+R K+RWSM+Q Y++L  M  + G SE   D+FPLIFT+QDT 
Sbjct  527  HDEQISELLKIACNCVVARPKDRWSMFQVYQSLKTMGEENGFSEMDDDDFPLIFTKQDTE  586

Query  221  S  219
            S
Sbjct  587  S  587



>ref|XP_002268171.1| PREDICTED: probable inactive receptor kinase At1g27190 [Vitis 
vinifera]
Length=611

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS  ILLD+D+DARI DFGLARL+A  D++++SFV GDLGEFGYVAPEYSSTM+PS
Sbjct  432  HQNISSSVILLDDDYDARITDFGLARLVASADSNDSSFVNGDLGEFGYVAPEYSSTMVPS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+   +EGFKGNLVDWV Q   SGR KD IDK + G+G
Sbjct  492  LKGDVYGFGVVLLELVTGQKPLEVNNGDEGFKGNLVDWVIQLLISGRSKDAIDKDLWGKG  551

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +D++IVQ +R+AC+CV SR KER SMY  Y++L  MA + G SE YDEFPL+F++QD
Sbjct  552  YDDEIVQLMRVACSCVGSRPKERPSMYNVYQSLKSMAEKHGFSEQYDEFPLMFSKQD  608



>ref|XP_006303937.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
 gb|EOA36835.1| hypothetical protein CARUB_v10008631mg [Capsella rubella]
Length=601

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  424  HQFISSNVILLDDDFDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SICG+G
Sbjct  484  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+ 
Sbjct  544  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKSMADKHGVSEHYDEFPLVFNKQEA  601



>ref|XP_010043841.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW85840.1| hypothetical protein EUGRSUZ_B02576 [Eucalyptus grandis]
Length=616

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  755  QNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPST  576
            Q+ SSHAILLD+D DARI DFGLARL+ P D++++S+  GDLGEFGYVAPEYSSTM+ S 
Sbjct  437  QSISSHAILLDDDLDARITDFGLARLVNPRDSNDSSYRNGDLGEFGYVAPEYSSTMVASL  496

Query  575  KGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRGH  396
            KGD Y FGVVLLELATGQKPLE+   E+ FKGNLVDWVN  + SGR KD ID+SICGRGH
Sbjct  497  KGDVYGFGVVLLELATGQKPLEICNVEQVFKGNLVDWVNNLTSSGRSKDAIDRSICGRGH  556

Query  395  DEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            D++IVQFL++AC+CVVSR K+R SMY  YE+L  +  + G SE  DEFPLIF +QD+
Sbjct  557  DDEIVQFLKVACSCVVSRPKDRPSMYNVYESLRTIGERHGFSEADDEFPLIF-KQDS  612



>ref|XP_010460207.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=598

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+D+DARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  421  HQFISSNVILLDDDYDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  480

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SICG+G
Sbjct  481  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  541  HDEEILQFLKIACGCVVSRPKERPTMIQVYESLKSMADKHGVSEHYDEFPLVFNKQE  597



>ref|XP_011043889.1| PREDICTED: probable inactive receptor kinase At1g27190 [Populus 
euphratica]
Length=609

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI DFGLARL++ PD++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  428  HQYISSNVILLDDDFDARITDFGLARLISSPDSNDSSFVHGDLGEFGYVAPEYSSTMVAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL +GQKPL+++ AEEGFKGNLVDWVNQ +  GR  D IDK++ G+G
Sbjct  488  LKGDVYGFGVVLLELVSGQKPLDVSNAEEGFKGNLVDWVNQLASIGRSTDAIDKALVGKG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFL++A +CVVSR K+R +MYQ +E+L  MA + G S+ YDEFPLIF +QD
Sbjct  548  HDDEIMQFLKVAWSCVVSRPKDRPTMYQIFESLKGMAEKHGFSDKYDEFPLIFGKQD  604



>ref|XP_002890616.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66875.1| hypothetical protein ARALYDRAFT_889992 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  424  HQFISSNVILLDDDFDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SIC +G
Sbjct  484  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  544  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKSMADKHGVSEHYDEFPLVFNKQE  600



>gb|KDP21268.1| hypothetical protein JCGZ_21739 [Jatropha curcas]
Length=601

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+DFDAR  DFGLARL+   D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  420  HQYISSNVILIDDDFDARFTDFGLARLVGSRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG+VLLEL TGQKPLE++ AEEGFKGNLVDWVN    +GR KD IDK++ G+G
Sbjct  480  LKGDIYSFGIVLLELVTGQKPLEVSNAEEGFKGNLVDWVNHLVSAGRSKDAIDKALIGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HD++I+QFL+I  +CVVSR K+R SM+Q YE+L  MA + G S+ Y+EFPLIF +QD+
Sbjct  540  HDDEIMQFLKIGWSCVVSRPKDRPSMFQVYESLKVMAEKHGFSDQYEEFPLIFDKQDS  597



>gb|KJB40809.1| hypothetical protein B456_007G077900 [Gossypium raimondii]
Length=556

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DEDFDARIMDFGLA LM   D +ETSF K D+GEFGY+APE SST + S
Sbjct  376  QQNICSNVILMDEDFDARIMDFGLASLMTSSDVYETSFAKRDIGEFGYIAPESSSTTVAS  435

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             K D Y FGVVLLEL T QKPLE+   EEGFKG LVDWVN  S +GRIKD IDK + G+G
Sbjct  436  MKSDVYGFGVVLLELVTRQKPLEVNAGEEGFKGGLVDWVNHLSNTGRIKDAIDKDLYGKG  495

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDEQIVQ L+I CNCVV+  K+RWSM++  ++L  MA + G+SE +D+FPLIFT+QD  S
Sbjct  496  HDEQIVQVLKIGCNCVVAHPKKRWSMFKVSQSLRTMAEENGLSEEFDDFPLIFTDQDDES  555



>ref|XP_006372487.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP50284.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=606

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI DFGLARL++ PD++++S+V GDLGEFGY+APEYSSTM+ S
Sbjct  425  HQYISSNVILLDDDFDARITDFGLARLISSPDSNDSSYVNGDLGEFGYIAPEYSSTMVAS  484

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQK L++   EEGFKGNLVDWVNQ   +GR KD IDK++ G+G
Sbjct  485  LKGDVYGFGVVLLELVTGQKALDVNNEEEGFKGNLVDWVNQLVSTGRSKDAIDKALTGKG  544

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+QFLR+A +CVVSR K+R SMYQ YE+L  +A + G S+ YDEFPLIF + D
Sbjct  545  HDDEIMQFLRVAWSCVVSRPKDRPSMYQVYESLKGLAEKHGFSDQYDEFPLIFGKPD  601



>ref|XP_010098246.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74731.1| putative inactive receptor kinase [Morus notabilis]
Length=586

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+   D++++SFV G+LGEFGYVAPEYSSTM+ S
Sbjct  408  HQNISSNVILLDYDFEARITDFGLARLVGSRDSNDSSFVNGNLGEFGYVAPEYSSTMVAS  467

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+    EGFKGNLVDWVNQ S +GR  D ID ++ G+G
Sbjct  468  LKGDVYGFGVVLLELVTGQKPLEVNNPGEGFKGNLVDWVNQLSSAGRSVDAIDNALSGKG  527

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HD++I+ F+++AC+CVVSR K+R SMYQ YE+L  +A + G SE YDEFPLIF +QD
Sbjct  528  HDDEILHFMKVACSCVVSRPKDRPSMYQVYESLKTVAEKHGFSEHYDEFPLIFGKQD  584



>ref|XP_006416011.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
 gb|ESQ34364.1| hypothetical protein EUTSA_v10009684mg [Eutrema salsugineum]
Length=601

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  424  HQFISSNVILLDDDFDARITDYGLARLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD + FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+ R KD ID+SICG+G
Sbjct  484  LKGDVFGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTSRSKDAIDRSICGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  544  HDEEILQFLKIACSCVVSRPKERPTMVQVYESLKNMADKHGVSEHYDEFPLVFNKQE  600



>gb|KDO72413.1| hypothetical protein CISIN_1g035917mg [Citrus sinensis]
Length=611

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 139/180 (77%), Gaps = 15/180 (8%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ IL+DEDFDARIMDFGLA+LM   D  E+SFV GDLGEFGY+APEYSSTM+ S
Sbjct  446  HQNICSNVILVDEDFDARIMDFGLAKLMTSSD--ESSFVNGDLGEFGYIAPEYSSTMVAS  503

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELA             GFKGNLVDWVNQ S SGR K+ IDK++CG+G
Sbjct  504  LKGDVYGIGVVLLELA-------------GFKGNLVDWVNQLSSSGRSKEAIDKALCGKG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            +DE+I+QFL++ACNCVVSR K+RWSMYQ Y++LN +AAQ G SE YDEFPLIF  QD  S
Sbjct  551  YDEEILQFLKVACNCVVSRPKDRWSMYQVYQSLNSIAAQHGFSERYDEFPLIFHRQDGGS  610



>ref|NP_174039.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|O04567.1|Y1719_ARATH RecName: Full=Probable inactive receptor kinase At1g27190; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF79872.1|AC000348_25 T7N9.25 [Arabidopsis thaliana]
 gb|AAU94364.1| At1g27190 [Arabidopsis thaliana]
 gb|ACN59234.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30792.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=601

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  424  HQFISSNVILLDDDFDARITDYGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SIC +G
Sbjct  484  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+ 
Sbjct  544  HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKHGVSEHYDEFPLVFNKQEA  601



>gb|KJB31374.1| hypothetical protein B456_005G188100 [Gossypium raimondii]
Length=611

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ FSS+ +LLD+DFDARI DFGLARLM   D++++SF+ GDLGEFGYVAPEYSSTM+ S
Sbjct  431  HQYFSSNVVLLDDDFDARIADFGLARLMGSRDSNDSSFMNGDLGEFGYVAPEYSSTMVAS  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD +SFGVVLLEL TGQKP+ ++ AEEGFKGNLVDWVNQ   +GR KD +DK++ G+G
Sbjct  491  LKGDVFSFGVVLLELVTGQKPIGVSNAEEGFKGNLVDWVNQLFSTGRSKDAVDKALLGKG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
             D++I+QFLR+AC CVV R K+R SMYQ YE+L  M  + G  E YDEFPLIF +Q
Sbjct  551  CDDEIMQFLRVACTCVVPRPKDRPSMYQVYESLKIMGEKHGALEQYDEFPLIFGKQ  606



>ref|XP_007222048.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
 gb|EMJ23247.1| hypothetical protein PRUPE_ppa003089mg [Prunus persica]
Length=605

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+A  D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  426  HQNISSNVILLDYDFEARITDFGLARLVASRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+  A EGFKGNLVDWVN  S +GR  D ID  + G+G
Sbjct  486  LKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
            HD++I+QF+R+AC CVV+R K+R SMYQ YE+L  +A + G  E YDEFPL+F +Q
Sbjct  546  HDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVLAEKHGFFEQYDEFPLVFGKQ  601



>emb|CDY14686.1| BnaC05g19430D [Brassica napus]
Length=597

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  420  HQFISSNVILLDDDFDARITDYGLAKLVGTRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  479

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SI G+G
Sbjct  480  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSISGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  540  HDEEILQFLKIACSCVVSRPKERPTMVQVYESLKNMADKHGVSEHYDEFPLVFNKQE  596



>emb|CDY16228.1| BnaA09g29620D [Brassica napus]
Length=599

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  422  HQFISSNVILLDDDFDARITDYGLAKLVGTRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  481

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SI G+G
Sbjct  482  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSISGKG  541

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  542  HDEEILQFLKIACSCVVSRPKERPTMVQVYESLKSMADKHGVSEHYDEFPLVFNKQE  598



>gb|KJB40808.1| hypothetical protein B456_007G077900 [Gossypium raimondii]
Length=605

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DEDFDARIMDFGLA LM   D +ETSF K D+GEFGY+APE SST + S
Sbjct  425  QQNICSNVILMDEDFDARIMDFGLASLMTSSDVYETSFAKRDIGEFGYIAPESSSTTVAS  484

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             K D Y FGVVLLEL T QKPLE+   EEGFKG LVDWVN  S +GRIKD IDK + G+G
Sbjct  485  MKSDVYGFGVVLLELVTRQKPLEVNAGEEGFKGGLVDWVNHLSNTGRIKDAIDKDLYGKG  544

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDEQIVQ L+I CNCVV+  K+RWSM++  ++L  MA + G+SE +D+FPLIFT+QD  S
Sbjct  545  HDEQIVQVLKIGCNCVVAHPKKRWSMFKVSQSLRTMAEENGLSEEFDDFPLIFTDQDDES  604



>ref|XP_008221489.1| PREDICTED: probable inactive receptor kinase At1g27190 [Prunus 
mume]
Length=605

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+A  D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  426  HQNISSNVILLDYDFEARITDFGLARLVASRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE+  A EGFKGNLVDWVN  S +GR  D ID  + G+G
Sbjct  486  LKGDVYGFGVVLLELVTGQKPLEIVNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
            HD++I+QF+R+AC CVV+R K+R SMYQ YE+L   A + G  E YDEFPL+F +Q
Sbjct  546  HDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVFAEKHGFFEQYDEFPLVFGKQ  601



>ref|XP_009115452.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=598

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  421  HQFISSNVILLDDDFDARITDYGLAKLVGTRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  480

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SI G+G
Sbjct  481  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSISGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct  541  HDEEILQFLKIACSCVVSRPKERPTMVQVYESLKSMADKHGVSEHYDEFPLVFNKQE  597



>gb|KFK44612.1| hypothetical protein AALP_AA1G281300 [Arabis alpina]
Length=598

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GLARL+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  421  HQFISSNVILLDDDFDARITDYGLARLVGTRDSNDSSFNNGDLGELGYVAPEYSSTMVAS  480

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G GR KD ID SICG+G
Sbjct  481  LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGGGRSKDAIDGSICGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+Q L+IAC+CVVSR KER +M Q YE+L  M  + G+SE YDEFPL+F +Q+
Sbjct  541  HDEEILQVLKIACSCVVSRPKERPTMIQVYESLKNMVDKHGVSEHYDEFPLVFNKQE  597



>ref|XP_008353487.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Malus domestica]
Length=601

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D+ E+SFV GDLGE GYVAPEY ST++ S
Sbjct  424  HQNICSNVILLDEDFDARIMDFGLATLTAS-DSKESSFVNGDLGELGYVAPEYPSTLVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLELATGQKPLE++TA+EGFKGN+VDWVN+ S SGR KD IDK++ G+G
Sbjct  483  LKGDVYGLGIVLLELATGQKPLEVSTADEGFKGNVVDWVNRLSSSGRTKDAIDKALIGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IA +CV+SR K+RWSMYQ Y AL  M+ +       DEFPL+F   D
Sbjct  543  HDEEILQFLKIASSCVISRPKDRWSMYQVYHALKSMSKEHSFRGQDDEFPLLFRRPD  599



>ref|XP_008341508.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=601

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D+ E+SFV GDLGE GYVAPEY ST++ S
Sbjct  424  HQNICSNVILLDEDFDARIMDFGLATLTAS-DSKESSFVNGDLGELGYVAPEYPSTLVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLELATGQKPLE++TA+EGFKGN+VDWVN+ S SGR KD IDK++ G+G
Sbjct  483  LKGDVYGLGIVLLELATGQKPLEVSTADEGFKGNVVDWVNRLSSSGRTKDAIDKALIGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IA +CV+SR K+RWSMYQ Y AL  M+ +       DEFPL+F   D
Sbjct  543  HDEEILQFLKIASSCVISRPKDRWSMYQVYHALKSMSKEHSFRGQDDEFPLLFRRPD  599



>ref|XP_008361793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+A  D++++SFV GDLGEFGYVAPEY+STM+ S
Sbjct  428  HQNISSNVILLDYDFEARITDFGLARLVASRDSNDSSFVNGDLGEFGYVAPEYASTMVAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE++   EGFKGNLVDWVN  S +G   D ID  + G+G
Sbjct  488  LKGDVYGFGVVLLELVTGQKPLEISNVLEGFKGNLVDWVNHLSNTGXSMDAIDNXLSGKG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            HD++I+QF+R+AC CVVSR K+R SMYQ YE+L   A + G SE YDEFPL++
Sbjct  548  HDDEILQFMRVACTCVVSRPKDRPSMYQVYESLKSFAEKHGFSEQYDEFPLVY  600



>ref|XP_009335793.1| PREDICTED: probable inactive receptor kinase At1g27190 [Pyrus 
x bretschneideri]
Length=601

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D+ E+SFV GDLGE GYVAPEY S+++ S
Sbjct  424  HQNICSNVILLDEDFDARIMDFGLATLTAS-DSKESSFVNGDLGELGYVAPEYPSSLVAS  482

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLELATGQKPLE++TA+EGFKG++VDWVN+ S SGR KD IDK++ G+G
Sbjct  483  LKGDVYGLGIVLLELATGQKPLEVSTADEGFKGSVVDWVNRLSSSGRTKDAIDKALIGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IA +CV+SR K+RWSMYQ Y AL  M+ +    E  DEFPL+F   D
Sbjct  543  HDEEILQFLKIASSCVISRPKDRWSMYQVYHALKSMSKEHSFREQDDEFPLLFRNPD  599



>ref|XP_002883614.1| hypothetical protein ARALYDRAFT_480045 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59873.1| hypothetical protein ARALYDRAFT_480045 [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDARI D+GL RL+   D+ ++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  439  HQFISSNVILLDDDFDARITDYGLTRLVGSRDSSDSSFNNGDLGELGYVAPEYSSTMVAS  498

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG+VLLE  TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SIC +G
Sbjct  499  LKGDVYGFGIVLLEFVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICVKG  558

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IAC+CVVSR KER +M Q YE L  MA + G+SE YDEFPL+F +Q+
Sbjct  559  HDEEILQFLKIACSCVVSRPKERPTMIQVYEYLKNMADKHGVSEHYDEFPLVFNKQE  615



>ref|XP_004489358.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Cicer 
arietinum]
Length=601

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DE+FDARIMDFGLARLM   DA+  SFV GDLGE GY+APEYSSTM+ S
Sbjct  423  QQNICSNVILVDEEFDARIMDFGLARLMTS-DAN-GSFVNGDLGELGYIAPEYSSTMVAS  480

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGV+LLEL TG KPLE+ T +E FKGNLVDWVN HS SGR+KD IDKSICG+G
Sbjct  481  LKGDVYGFGVLLLELVTGCKPLEVNTGDEEFKGNLVDWVNMHSNSGRLKDCIDKSICGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
             DE+I+QFL+IA NCV+SR K+RWSMYQ Y +L  ++     SE  DEFPLIF
Sbjct  541  QDEEILQFLKIASNCVISRPKDRWSMYQVYNSLKGISKDHSFSEHDDEFPLIF  593



>ref|XP_008379313.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=600

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLDEDFDARIMDFGLA L A  D  E+SFV GDLGE GYVAPEY ST++ S
Sbjct  423  HQNXCSNVILLDEDFDARIMDFGLATLTAS-DPKESSFVNGDLGELGYVAPEYPSTLVAS  481

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  G+VLLELATGQ PLE++TA+EG+KGN+VDWVN    SGR KD IDK++ G+G
Sbjct  482  LKGDVYGLGIVLLELATGQMPLEVSTADEGYKGNVVDWVNHLYNSGRTKDAIDKALIGKG  541

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
            HDE+I+QFL+IA +CV+SR K+RWSMYQ Y AL  M+ +    E  DEFPL+F + DT
Sbjct  542  HDEEILQFLKIASSCVISRPKDRWSMYQVYHALKSMSKEHSFREQDDEFPLLFRKPDT  599



>ref|XP_008389562.1| PREDICTED: probable inactive receptor kinase At1g27190 [Malus 
domestica]
Length=607

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLA+L+A  D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  428  HQNISSNVILLDYDFEARITDFGLAKLVASRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE++   EGFKGNLVDWVN  S +GR  D ID  + G+G
Sbjct  488  LKGDVYGFGVVLLELVTGQKPLEISNVVEGFKGNLVDWVNHLSNTGRSMDAIDNVLTGKG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            HD++I+QF+RIAC C+VSR K+R SMYQ  E+L   A + G S+ YDEFPL++
Sbjct  548  HDDEILQFMRIACTCIVSRPKDRPSMYQVCESLKSFAEKHGFSKQYDEFPLVY  600



>ref|XP_010033235.1| PREDICTED: probable inactive receptor kinase At1g27190 [Eucalyptus 
grandis]
 gb|KCW52822.1| hypothetical protein EUGRSUZ_J02155 [Eucalyptus grandis]
Length=599

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ I +DEDF+ARI+DFGLARLM   ++  +SFV GDLGEFGY+APEY STM+ S
Sbjct  419  HQNLCSNTIFIDEDFEARIVDFGLARLMTTSESSGSSFVNGDLGEFGYIAPEYPSTMVAS  478

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y+FGV+LLEL TGQKPL +    E FKGNLVDWVN  S + RIKD +D+++   G
Sbjct  479  MKGDVYAFGVLLLELVTGQKPLLVNNPNEEFKGNLVDWVNVLSSTDRIKDAVDQTLWEHG  538

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            +D +I+QFL+IAC+C+ SR K+RWS+YQAY++L  MA +QG++E YDEFPLIF +QD
Sbjct  539  YDGEILQFLKIACSCINSRPKDRWSIYQAYQSLKSMAEEQGMTEQYDEFPLIFLKQD  595



>ref|XP_010528295.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=611

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DED+DAR +D GLARLMAP D +E+SF+ GDLGEFGYVAPEYSSTM+ S
Sbjct  429  HQNICSSVILIDEDYDARFIDSGLARLMAPTDTNESSFMTGDLGEFGYVAPEYSSTMLAS  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLEL TGQK L   + +EGFKGNLVDWVNQ   SG+I D IDK+I G G
Sbjct  489  LKGDVYGLGVVLLELVTGQKALGAGSLDEGFKGNLVDWVNQLDSSGKISDAIDKNISGTG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIF  240
            HDE+I++F+RIACNCV +R KERWSM QAY++L  +A + G   SE  D+FPLIF
Sbjct  549  HDEEILKFVRIACNCVAARPKERWSMVQAYQSLKAIAEKIGFSFSEQDDDFPLIF  603



>ref|XP_009360430.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Pyrus x bretschneideri]
Length=607

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+A  D++++SFV GDLGEFGYVAPEYSSTM+ S
Sbjct  428  HQNISSNVILLDYDFEARITDFGLARLVASRDSNDSSFVNGDLGEFGYVAPEYSSTMVAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKP E++   EGFKGNLVDWVN  S +G+  D ID  + G+G
Sbjct  488  LKGDVYGFGVVLLELVTGQKPREISNVVEGFKGNLVDWVNHLSNTGQSMDAIDNVLSGKG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            HD++I+Q +RIAC CVVSR K+R SMYQ  E+L   A + G SE YDEFPL++
Sbjct  548  HDDEILQLMRIACTCVVSRPKDRPSMYQVCESLKSFAEKHGFSEQYDEFPLVY  600



>ref|XP_010532925.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=612

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDARI D+GLARL+A  +++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct  432  HQYISSNVILLDEDFDARITDYGLARLVASRNSNDSSFNNGDLGELGYVAPEYSSTMVAS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEE--GFKGNLVDWVNQHSGSGRIKDVIDKSICG  405
             KGD Y FG+VLLEL TGQKPL +   EE  GFKG+LVDWV+Q+  +GR K+ IDKSI G
Sbjct  492  FKGDVYGFGIVLLELVTGQKPLSINNGEEGLGFKGSLVDWVSQYLSTGRSKEAIDKSIYG  551

Query  404  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             G+D++I+QFLR+AC+CV SR KER SM Q YE+L  MA + G+SE Y+EFPLIF +QD
Sbjct  552  IGYDDEIMQFLRVACSCVASRPKERPSMCQVYESLKNMADKHGLSEHYNEFPLIFNKQD  610



>ref|XP_006849112.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
 gb|ERN10693.1| hypothetical protein AMTR_s00028p00246730 [Amborella trichopoda]
Length=620

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = -2

Query  770  ANPS---HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
             NP+   H+N SS+ +LLDED++ARI DFGLAR+M+P + H ++F+ GD G+FGYVAPEY
Sbjct  432  GNPTSFIHRNISSNTVLLDEDYEARITDFGLARIMSPVETHLSTFINGDFGDFGYVAPEY  491

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            SST++ S KGD Y FGVVLLELATGQKPL +  AEEGFKGNLV+WVN+ S SGRI D +D
Sbjct  492  SSTLVASLKGDVYGFGVVLLELATGQKPLVVENAEEGFKGNLVEWVNRLSSSGRIIDAVD  551

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
             S+ G+G+DE+I+QF+R+AC CV+SR K+R SM+Q Y+ L  + +    SE YDEFPL++
Sbjct  552  ASLRGKGNDEEILQFMRVACACVLSRPKDRSSMHQVYQLLKGIGSTHDFSEQYDEFPLLY  611

Query  239  TEQD  228
               D
Sbjct  612  GRDD  615



>ref|XP_010684872.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=604

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAH-ETSFVKGDLGEFGYVAPEYSSTMIP  582
            HQN SS+ ILLDED DARI+DFGLARL++  + H E+SFV GDLGEFGY+APEYSSTM+ 
Sbjct  426  HQNISSNVILLDEDLDARIIDFGLARLLSASETHHESSFVNGDLGEFGYIAPEYSSTMVA  485

Query  581  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR  402
            S KGD Y+FGVVLLEL TGQKPLE+   EE FKGNLVDWVNQ S SGR  + IDK I G+
Sbjct  486  SLKGDVYAFGVVLLELVTGQKPLEVIAVEEVFKGNLVDWVNQLSSSGRTIEAIDKDIRGK  545

Query  401  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            GHD+ I+Q   IA NC+VSR K+R SM Q YE+LN M      SE +D+FPLIF  QD
Sbjct  546  GHDKDILQVFTIASNCIVSRPKDRCSMLQVYESLNSMIDDHP-SEQFDDFPLIFGRQD  602



>ref|XP_004298597.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=605

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS+ ILLD DF+ARI DFGLARL+   D++++SFV G+LGE GYVAPEYSSTM+ S
Sbjct  426  HQNISSNVILLDYDFEARITDFGLARLVGSRDSNDSSFVNGELGEIGYVAPEYSSTMVAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGVVLLEL TGQKPLE++   EGFKGNLVDWV+  S +GR  D ID  + G+G
Sbjct  486  LKGDVYGFGVVLLELITGQKPLEISNVVEGFKGNLVDWVSHLSNTGRSVDAIDNVLAGKG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
            HD++I+QF+++AC+CVV+R K+R SM+Q YE L  +A + G SE YDEFPL+  +Q
Sbjct  546  HDDEILQFMKVACSCVVARPKDRPSMHQVYELLKSLADKHGFSEQYDEFPLMLGKQ  601



>ref|XP_003618423.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago 
truncatula]
 gb|AES74641.1| LRR receptor-like kinase [Medicago truncatula]
Length=602

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DE+FDARIMDFGLARLM   DA+  SFV GDLGE GY+APEYSSTM+ S
Sbjct  424  QQNICSNVILVDEEFDARIMDFGLARLMTS-DAN-GSFVNGDLGELGYIAPEYSSTMVAS  481

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGV+LLEL TG KPLE+   +E FKGNLVDWVN HS SGR+KD ID+SI G+G
Sbjct  482  LKGDVYGFGVLLLELVTGCKPLEVNNIDEEFKGNLVDWVNMHSSSGRLKDCIDRSISGKG  541

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            +DE+I+QFL+IA NCV++R+K+RWSMYQ Y +L  ++     SE  DEFPLIF
Sbjct  542  NDEEILQFLKIASNCVIARAKDRWSMYQVYNSLKGISKDHSFSEHDDEFPLIF  594



>ref|XP_009602624.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
tomentosiformis]
Length=617

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+D DARI DFGLA L+   D++++SFV GDLGEFGYVAPEYSST++ S
Sbjct  436  HQYLSSNVILVDDDLDARITDFGLASLVGSSDSNDSSFVNGDLGEFGYVAPEYSSTLVAS  495

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVV+LEL TG+KPL    A+EGFKG+LVDWVNQ S SGR +DVIDKS  GRG
Sbjct  496  MKGDVYSFGVVMLELVTGRKPLGAGNADEGFKGSLVDWVNQLSSSGRSRDVIDKSFVGRG  555

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D++I++ L+IAC+CVVSR K+R SMY  Y++L  M  +   SE +DEFP+  T+Q+
Sbjct  556  QDDEILRILQIACSCVVSRPKDRPSMYTVYQSLKSMVKEHCFSEHFDEFPINLTKQN  612



>gb|EYU34129.1| hypothetical protein MIMGU_mgv1a027001mg, partial [Erythranthe 
guttata]
Length=603

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHET-SFVKGDLGEFGYVAPEYSSTMI-  585
            H+N SS+ +LLDEDFDARIMDFGLARL+          FV GDLGE GY+APE +STM+ 
Sbjct  418  HRNISSNVVLLDEDFDARIMDFGLARLLNSSSESNESGFVDGDLGEIGYIAPECTSTMMS  477

Query  584  PSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICG  405
             S KGD YSFGVVLLEL TG KP+     EEG+KGNLVDWVN+  G GRI+D +DK +CG
Sbjct  478  ASLKGDCYSFGVVLLELGTGLKPVNPDIEEEGYKGNLVDWVNRLVGGGRIEDAVDKRLCG  537

Query  404  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ-GISEPYDEFPLIFTEQD  228
             G++E+IV+FLRIACNCVVS+ KERWSMY+ YE+L  MA +Q G SE YDEFP +F +QD
Sbjct  538  SGYEEEIVRFLRIACNCVVSQPKERWSMYRVYESLKSMAEEQYGFSERYDEFPFLFGKQD  597



>ref|XP_010683354.1| PREDICTED: probable inactive receptor kinase At1g27190 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S+ ILLD+DFD RI D GL RLM   +++ +S   GD GEFGYV PEY+ST++ S
Sbjct  419  HQNICSNVILLDDDFDVRITDVGLVRLMGMGNSNGSSVANGDFGEFGYVPPEYASTLVAS  478

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGV+LLEL TGQKPLE+T A+EGFKG+LV WV   S SGRIKD IDK +CG+G
Sbjct  479  LKGDVYGFGVILLELITGQKPLEVTKAQEGFKGSLVHWVTYLSSSGRIKDAIDKFLCGKG  538

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT  225
             +++++Q LR+AC+CV SR K+R SM++ YE+L  MA   G  E YDEFPLI TEQD 
Sbjct  539  DEDEVMQLLRVACSCVASRPKDRPSMFRVYESLKNMAENHGFLEHYDEFPLILTEQDV  596



>gb|KJB75784.1| hypothetical protein B456_012G058000 [Gossypium raimondii]
Length=564

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN SS  ILLDED DARIMDFGLA  M   D +ETSF++G LGE GY+APEYS+T + S
Sbjct  387  QQNISSIVILLDEDLDARIMDFGLAGFMNNSDVNETSFMEGALGELGYIAPEYSTTTVAS  446

Query  578  TKGDAYSFGVVLLELATGQKPLELTTA-EEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR  402
             KGD +  GVVLLEL T QKPLE+    EEGFKGNLVDW+N  S SGRIKD  D ++ G+
Sbjct  447  LKGDVFGLGVVLLELVTRQKPLEVNAGGEEGFKGNLVDWINHLSDSGRIKDATDSNLRGK  506

Query  401  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            GHDE+++QFL IA NCV  RSK+RWSMYQ YE+L  M  + G SE +D+FPLIF E
Sbjct  507  GHDEEMLQFLTIALNCVNPRSKDRWSMYQVYESLKNMGEENGSSEEFDDFPLIFIE  562



>gb|KHN34180.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S  IL+DE+FDAR+MDFGLARLMA       SFV GDLGE GY+APEY ST++ S
Sbjct  431  QQNICSSVILVDEEFDARLMDFGLARLMASDS--NGSFVNGDLGELGYIAPEYPSTLVAS  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG++LLEL TG+KPL+++  E  FKG+LVDWVN HS SGRIKD IDK+I GRG
Sbjct  489  LKGDVYGFGILLLELVTGRKPLDVSNGEAEFKGSLVDWVNMHSSSGRIKDCIDKAISGRG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            HDE+I+QFL+ A NCVVSR K+RWSMYQ Y ++  ++ +Q   E  DEFPLIF
Sbjct  549  HDEEILQFLKTAMNCVVSRPKDRWSMYQVYHSIKSISKEQSFFEHDDEFPLIF  601



>ref|XP_007151169.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
 gb|ESW23163.1| hypothetical protein PHAVU_004G023700g [Phaseolus vulgaris]
Length=606

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 135/180 (75%), Gaps = 2/180 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S+ IL+DE+FDAR+MDFGLARLMA       SFV GDLGE GY+APEY ST++ S
Sbjct  428  QQNICSNVILVDEEFDARLMDFGLARLMASDS--NGSFVNGDLGEIGYIAPEYPSTLVAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FGV+LLEL TGQKPL ++  EE FKG+LVDWVN HS  GR+KD IDK++ GRG
Sbjct  486  LKGDVYGFGVLLLELVTGQKPLYVSNGEEDFKGSLVDWVNMHSSLGRMKDCIDKAMSGRG  545

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
            HDE+I+QFL+IA NCVVSR K+RWSMYQ Y +L  ++  Q   E  D+FPLIF + +  +
Sbjct  546  HDEEILQFLKIALNCVVSRPKDRWSMYQVYHSLKGLSKDQSFFEHDDDFPLIFGKPENEA  605



>pdb|4L68|A Chain A, Structure Of The Psedudokinase Domain Of Bir2, An Immune 
Regulator Of The Rlk/pelle Family
 pdb|4L68|B Chain B, Structure Of The Psedudokinase Domain Of Bir2, An Immune 
Regulator Of The Rlk/pelle Family
Length=340

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 134/180 (74%), Gaps = 6/180 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  162  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  221

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K +      EGFKG+LVDWV Q   SGRI +  D++I G+G
Sbjct  222  LKGDVYGLGVVLLELATGLKAV----GGEGFKGSLVDWVKQLESSGRIAETFDENIRGKG  277

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQDT  225
            HDE+I +F+ IA NCV SR KERWSM+QAY++L  +A +QG   SE  D+FPLIF  Q+ 
Sbjct  278  HDEEISKFVEIALNCVSSRPKERWSMFQAYQSLKAIAEKQGYSFSEQDDDFPLIFDTQEN  337



>ref|XP_006357223.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Solanum 
tuberosum]
Length=615

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+DFDARI DFGLARL+   D++++SFV GDLGEFGYVAPEYSST++ S
Sbjct  434  HQYLSSNVILVDDDFDARITDFGLARLIGSADSNDSSFVNGDLGEFGYVAPEYSSTLVAS  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KPL    AEEGFKG+LVDWVNQ S SG  KD IDK+  G G
Sbjct  494  MKGDVYSFGVVLLELVTGRKPLGAGNAEEGFKGSLVDWVNQLSSSGHSKDAIDKAFAGSG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D++I++ L+IAC+CVVSR K+R SMY  Y++L  M  +   SE +DEFP+  T+++
Sbjct  554  QDDEILRVLQIACSCVVSRPKDRPSMYTVYQSLKSMVKEHCFSEHFDEFPINLTKEN  610



>gb|KHN13260.1| Putative inactive receptor kinase [Glycine soja]
Length=608

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
             QN  S  IL+DE+FDAR+MDFGLARLMA       SFV GDLGE GY+APEY ST++ S
Sbjct  429  QQNICSSVILVDEEFDARLMDFGLARLMASDS--NGSFVNGDLGELGYIAPEYPSTLVAS  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y FG++LLEL TG+KPL+++  EE FKG+LVDWVN HS SG IKD IDK+I GRG
Sbjct  487  LKGDVYGFGILLLELVTGRKPLDVSNGEEEFKGSLVDWVNMHSSSGGIKDCIDKAISGRG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            HDE+I+QFL+ A NCVVSR K+RWSMYQ Y +L  ++  Q   E  DEFPLIF
Sbjct  547  HDEEILQFLKTAMNCVVSRPKDRWSMYQVYNSLKSISKDQSFFEHDDEFPLIF  599



>ref|XP_002875454.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51713.1| hypothetical protein ARALYDRAFT_484619 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  401  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  460

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGRI +  D++I G+G
Sbjct  461  LKGDVYGLGVVLLELATGLKAL----GREGFKGSLVDWVKQLESSGRIAETFDENIRGKG  516

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQDT  225
            H+E+I++F+ IACNCV SR KERWSM+QAY++L  +A +QG   SE  D+FPLIF  Q+ 
Sbjct  517  HEEEILKFVEIACNCVSSRPKERWSMFQAYQSLKAIAEKQGYSFSEQDDDFPLIFDTQEN  576

Query  224  SS  219
             +
Sbjct  577  EA  578



>ref|XP_010502845.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  428  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGRI D  D++I G+G
Sbjct  488  LKGDVYGLGVVLLELATGVKAL----GGEGFKGSLVDWVKQLESSGRITDAFDENIRGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ--GISEPYDEFPLIFTEQDT  225
            HDE+I++F+ IACNCV SR KERWSM+QAY++L  +A +Q    SE  D+FPLIF  Q+ 
Sbjct  544  HDEEILKFVEIACNCVSSRPKERWSMFQAYQSLKAIAEKQDYSFSEQDDDFPLIFDTQEN  603

Query  224  SS  219
             +
Sbjct  604  ET  605



>ref|XP_010425626.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=606

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  428  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGRI D  D++I G+G
Sbjct  488  LKGDVYGLGVVLLELATGVKAL----GGEGFKGSLVDWVKQLESSGRITDAFDENIRGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ--GISEPYDEFPLIFTEQDT  225
            HDE+I++FL IACNC  SR KERWSM+QAY++L  +A +Q    SE  D+FPLIF  Q+ 
Sbjct  544  HDEEILKFLEIACNCASSRPKERWSMFQAYQSLKAIAEKQDYSFSEQDDDFPLIFDTQEN  603

Query  224  SS  219
             +
Sbjct  604  ET  605



>ref|XP_010514548.1| PREDICTED: probable inactive receptor kinase At1g27190 [Camelina 
sativa]
Length=607

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  428  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGRI D  D++I G+G
Sbjct  488  LKGDVYGLGVVLLELATGVKAL----GGEGFKGSLVDWVKQLESSGRITDAFDENIRGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ--GISEPYDEFPLIFTEQDT  225
            HDE+I++F+ IACNCV SR KERWSM+QAY++L  +A +Q    SE  D+FPLIF  Q+ 
Sbjct  544  HDEEILKFVEIACNCVSSRPKERWSMFQAYQSLKAIAEKQDYSFSERDDDFPLIFDTQEN  603



>gb|KFK33740.1| hypothetical protein AALP_AA5G053600 [Arabis alpina]
Length=604

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DED+DARI+D GLARLM   D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  425  HQNICSSVILIDEDYDARIIDSGLARLMVSSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  484

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EG KGNLVDWV Q   SGRI D  D++I G+G
Sbjct  485  VKGDVYGLGVVLLELATGLKAL----GGEGIKGNLVDWVKQFESSGRIADAFDENIRGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQDT  225
            HDE+I++F+  ACNCV SR KERWSM+QAY++L  +A +QG S  E  D+FPLIF  Q+T
Sbjct  541  HDEEILKFVETACNCVTSRPKERWSMFQAYQSLKAIAEKQGYSFTEQDDDFPLIFDTQET  600

Query  224  SS  219
             +
Sbjct  601  GT  602



>ref|XP_009129373.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=600

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 136/179 (76%), Gaps = 6/179 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  424  HQNICSSVILVDEDFDARIVDSGLARLMVPLDNNESSFMTGDLGEFGYVAPEYSTTMLAS  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L     +EGFKG+LVDWV     SGR+ DVID+ I G+G
Sbjct  484  LKGDVYGLGVVLLELATGVKAL----GKEGFKGSLVDWVKHLESSGRLVDVIDEEIKGKG  539

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQD  228
             DE+I++F+ +ACNCV SR KERWSM++AY++L  MA +QG S  E  ++FPLIF  Q+
Sbjct  540  CDEEIIKFVEVACNCVASRPKERWSMFKAYQSLRAMAEKQGYSFTEQDEDFPLIFNTQE  598



>ref|XP_006395364.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
 gb|ESQ32650.1| hypothetical protein EUTSA_v10003844mg [Eutrema salsugineum]
Length=609

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLAR+M P + +E+SF+ GDLGEFGYVAPEYS+TMI S
Sbjct  431  HQNICSSVILVDEDFDARIIDSGLARIMVPSENNESSFMTGDLGEFGYVAPEYSTTMIAS  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGRI D +D  I G+G
Sbjct  491  LKGDVYGLGVVLLELATGLKAL----GGEGFKGSLVDWVKQLESSGRIADALDGDIRGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQDT  225
            HDE+I++F+ I CNCV SR KERWSM+Q Y++L  +A +QG S  E  D+FPLIF  Q+ 
Sbjct  547  HDEEILKFVEIGCNCVASRPKERWSMFQVYQSLKAIAGKQGYSFTEQDDDFPLIFDTQEN  606

Query  224  SS  219
             +
Sbjct  607  EA  608



>ref|XP_009799074.1| PREDICTED: probable inactive receptor kinase At1g27190 [Nicotiana 
sylvestris]
Length=617

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+D DARI DFGLARL+   D++++SFV GDLGEFGYVAPEYSST++ S
Sbjct  436  HQYLSSNVILVDDDLDARITDFGLARLVGSSDSNDSSFVNGDLGEFGYVAPEYSSTLVAS  495

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVV+LEL T +KPL    AEEGFKG+LVDWVNQ S SGR +D IDKS  GRG
Sbjct  496  MKGDVYSFGVVMLELVTRRKPLGAGNAEEGFKGSLVDWVNQLSSSGRSRDAIDKSFVGRG  555

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D++I++ L+IA +CVVSR K+R SMY  Y++L  M  +   SE +DEFP+  T+Q+
Sbjct  556  QDDEILRVLQIASSCVVSRPKDRPSMYTVYQSLKGMVKEHCFSEHFDEFPINLTKQN  612



>emb|CDY04020.1| BnaC02g37350D [Brassica napus]
Length=602

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  426  HQNICSSVILVDEDFDARIVDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  485

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L     +EGFKG+LVDWV     SGR+ D ID+ I G+G
Sbjct  486  LKGDVYGLGVVLLELATGVKAL----GKEGFKGSLVDWVKHLESSGRLADAIDEEIRGKG  541

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQD  228
             DE+I++F+ +ACNCV SR KERWSM++AY++L  MA +QG S  E  ++FPLIF  Q+
Sbjct  542  CDEEIIKFVEVACNCVASRPKERWSMFKAYQSLRAMAEKQGYSFTEQDEDFPLIFNTQE  600



>gb|KFK41423.1| hypothetical protein AALP_AA2G128900 [Arabis alpina]
Length=595

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR++D+GL +L++  D++ +SF  G LGE GY+APEYSSTM+ S
Sbjct  417  HQYISSNVILLDEDFDARVIDYGLGKLVSSRDSNNSSFSNGGLGEMGYIAPEYSSTMVAS  476

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y+FG+VLLE+ TGQKPL +   E+GFKG+LVDWV++H  +G+ KDV D++I G+G
Sbjct  477  LSGDVYAFGIVLLEIVTGQKPLSINNGEDGFKGSLVDWVSKHLSTGKSKDVFDRNIIGKG  536

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI-SEPYDEFPLIFTEQD  228
            +D++I+QFLRIAC+CVVSR KER SM + YE+L  +  Q G+ SE  DEFPLI  +Q+
Sbjct  537  YDDEILQFLRIACSCVVSRPKERPSMIEVYESLKNLGDQHGLFSEYSDEFPLISNKQE  594



>ref|XP_002888749.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65008.1| hypothetical protein ARALYDRAFT_894788 [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR++D+GL +L++  D+ ++SF  G+LGE GYVAPEYSSTM+ S
Sbjct  418  HQYISSNVILLDEDFDARVIDYGLGKLVSSRDSKDSSFSNGELGELGYVAPEYSSTMVAS  477

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP+ +   EEGFK +LV+WV++H  +GR KD ID+ ICG+G
Sbjct  478  LSGDMYGFGIVLLEIVTGQKPVSINIGEEGFKESLVEWVSKHLSNGRSKDAIDRRICGKG  537

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            +D++IVQ LRIAC+CVVSR KER  M Q YE+L  +  Q G  SE  DEFPLIF +Q+
Sbjct  538  YDDEIVQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFNKQE  595



>ref|XP_006301045.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
 gb|EOA33943.1| hypothetical protein CARUB_v10021437mg [Capsella rubella]
Length=596

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR+MD+GL +L++  D++++SF  G+LGEFGYVAPEYSSTM+ S
Sbjct  418  HQYISSNVILLDEDFDARVMDYGLGKLVSSRDSNDSSFSNGELGEFGYVAPEYSSTMVVS  477

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FGVVLLE+ TGQKP+ +   +EGFK +LVDWV +H  +GR KD ID+SI G+G
Sbjct  478  LNGDVYGFGVVLLEIVTGQKPVLVNNGQEGFKESLVDWVGKHLSNGRSKDAIDRSIYGKG  537

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            +D++I+Q LRIAC+CVVSR KER  M Q YE+L  +  Q G  SE  DEFPLIF +Q+
Sbjct  538  YDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQYGFFSEYSDEFPLIFNKQE  595



>ref|XP_006290709.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
 gb|EOA23607.1| hypothetical protein CARUB_v10016807mg, partial [Capsella rubella]
Length=654

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM   + +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  476  HQNICSSVILIDEDFDARIIDSGLARLMVHSENNESSFMTGDLGEFGYVAPEYSTTMLAS  535

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATGQK L      EGFKG LVDWV Q   SGR+ D  D++I G+G
Sbjct  536  LKGDVYGLGVVLLELATGQKAL----GGEGFKGTLVDWVRQLESSGRLTDAFDENIRGKG  591

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQDT  225
            HDE+I++F+ IACNCV S  KERWSM+QAY++L  +A +QG   SE  D+FPLIF  Q+ 
Sbjct  592  HDEEILKFVEIACNCVSSSPKERWSMFQAYQSLKGIADKQGYSFSEQDDDFPLIFDTQEN  651

Query  224  SS  219
             +
Sbjct  652  ET  653



>emb|CDY47244.1| BnaA02g29300D [Brassica napus]
Length=601

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  425  HQNICSSVILVDEDFDARIVDSGLARLMVPLDNNESSFMTGDLGEFGYVAPEYSTTMLAS  484

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L     +EGFKG+LVDWV     SGR+ D ID+ I G+G
Sbjct  485  LKGDVYGLGVVLLELATGVKAL----GKEGFKGSLVDWVKHLESSGRLVDAIDEEIRGKG  540

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQD  228
             D++I++F+ +ACNCV SR KERWSM++AY++L  MA +QG S  E  ++FPLIF  Q+
Sbjct  541  CDDEIIKFVEVACNCVASRPKERWSMFKAYQSLRAMAEKQGYSFTEQDEDFPLIFNTQE  599



>ref|NP_189486.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAB02861.1| receptor-like protein kinase-like protein [Arabidopsis thaliana]
 dbj|BAC42027.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59325.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77446.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=605

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 6/180 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct  427  HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K        EGFKG+LVDWV Q   SGRI +  D++I G+G
Sbjct  487  LKGDVYGLGVVLLELATGLK----AVGGEGFKGSLVDWVKQLESSGRIAETFDENIRGKG  542

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQDT  225
            HDE+I +F+ IA NCV SR KERWSM+QAY++L  +A +QG   SE  D+FPLIF  Q+ 
Sbjct  543  HDEEISKFVEIALNCVSSRPKERWSMFQAYQSLKAIAEKQGYSFSEQDDDFPLIFDTQEN  602



>ref|XP_008800372.1| PREDICTED: probable inactive receptor kinase At1g27190 [Phoenix 
dactylifera]
Length=618

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 137/182 (75%), Gaps = 5/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPP--DAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQ+ SS A+LLDED++ARI DFGL RL+ P   D H TS F+ GD GEFGY APEYS+  
Sbjct  433  HQSMSSSAVLLDEDYEARITDFGLTRLVRPSSGDGHNTSPFMNGDFGEFGYAAPEYSTNP  492

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + +TKGD Y FG+VLLELATGQ+P E+T+  A EGFKG+LVDWVNQ + +GRI D IDKS
Sbjct  493  LATTKGDVYGFGLVLLELATGQRPTEITSNAAGEGFKGSLVDWVNQLAAAGRIADAIDKS  552

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            I GRGHD +IVQFL++A  CVV++  ER SMYQ Y++L  +     +SE +DEFPL++ +
Sbjct  553  IRGRGHDGEIVQFLKVALGCVVAQPNERSSMYQVYQSLKAIGEDHDLSEQFDEFPLVYGK  612

Query  233  QD  228
             D
Sbjct  613  DD  614



>emb|CDY11627.1| BnaC06g31120D [Brassica napus]
Length=595

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPP-DAHETSFVKGDLGEFGYVAPEYSSTMIP  582
            HQ  SS+ ILLDED+DAR++D+GL +L++   D++++SF  GD GE GYVAPEY+STM+ 
Sbjct  416  HQYISSNVILLDEDYDARVIDYGLGKLVSSTRDSNDSSFSNGDFGEVGYVAPEYASTMVA  475

Query  581  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR  402
            S  GD Y+FGVVLLE+ TGQKPL +   E+GF G+LVDWVN+H   GR KDV+D+ + G+
Sbjct  476  SLSGDVYAFGVVLLEIVTGQKPLSINNGEDGFNGSLVDWVNRHLSDGRGKDVVDRCVIGK  535

Query  401  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            G+D++++QFLRIAC+CVV R KER  M Q YE+L K+  Q G  SE  DEFPLIF +Q+
Sbjct  536  GYDDEMMQFLRIACSCVVMRPKERPLMVQVYESLKKLGDQYGFFSEHSDEFPLIFNKQE  594



>ref|XP_010415671.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR+MD+GL +L++  D+ ++S   G+LGEFGYV PEYSSTM+ S
Sbjct  416  HQYISSNVILLDEDFDARVMDYGLGKLVSSRDSKDSSLSDGELGEFGYVPPEYSSTMVAS  475

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP+ +   +EGFK +LVDWV +H  +GR KD ID+SI G+G
Sbjct  476  LSGDVYGFGIVLLEIVTGQKPVSINNGQEGFKESLVDWVGKHLSNGRSKDAIDRSIYGKG  535

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPY-DEFPLIFTEQD  228
            +D++I+Q LRIAC+CVVSR KER  M Q YE+L  +  Q G    Y DEFPLIF +Q+
Sbjct  536  YDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQYGFFPEYSDEFPLIFNKQE  593



>ref|XP_004238738.1| PREDICTED: probable inactive receptor kinase At1g27190 [Solanum 
lycopersicum]
Length=610

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ IL+D+D+DARI DFGLARL+   D++++ FV GDLGEFGYV PEYSST++ S
Sbjct  432  HQYLSSNVILVDDDYDARITDFGLARLIGSTDSNDSLFVNGDLGEFGYVPPEYSSTLVAS  491

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP+    AEEGFKG+LVDWVNQ S SG  KD IDKS  G G
Sbjct  492  MKGDVYSFGVVLLELVTGRKPV---GAEEGFKGSLVDWVNQLSSSGHSKDAIDKSFAGSG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D++I++ L+IAC CVVSR K+R SMY  Y++L  M      SE +DEFP+  T+++
Sbjct  549  RDDEILRVLQIACLCVVSRPKDRPSMYTVYQSLKSMVKDHCFSEHFDEFPINLTKEN  605



>ref|XP_010551471.1| PREDICTED: probable inactive receptor kinase At1g27190 [Tarenaya 
hassleriana]
Length=604

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 135/181 (75%), Gaps = 3/181 (2%)
 Frame = -2

Query  761  SHQNFSSHAILLDEDFDARIMDFGLARLMAPP--DAHETSFVKGDLGEFGYVAPEYSSTM  588
            +HQ  SS+ ILLDED DAR+ D+GLARL+A       ++SF  GDLGE GY+APEYSST 
Sbjct  422  THQYISSNVILLDEDLDARVTDYGLARLVAASRDSKDDSSFNNGDLGELGYMAPEYSSTK  481

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC  408
            + S KGD Y FG+VLLEL TGQKPL     EEGFKG+LVDWV+Q   +GR K+ ID++I 
Sbjct  482  VTSLKGDVYGFGIVLLELVTGQKPLSAINGEEGFKGSLVDWVSQFLSTGRSKEAIDRNIF  541

Query  407  GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI-SEPYDEFPLIFTEQ  231
            GRG+D++I+QFL+ AC+CVVSR KER SM   YE L  MA + G+ ++ +DEFPLIF +Q
Sbjct  542  GRGYDDEIMQFLKTACSCVVSRPKERPSMCHVYECLKNMADKHGLTTDHFDEFPLIFNKQ  601

Query  230  D  228
            D
Sbjct  602  D  602



>emb|CDX85198.1| BnaC07g25090D [Brassica napus]
Length=380

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 128/179 (72%), Gaps = 6/179 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDARI+D GLARLM   D ++  F+ GDLGEFGYVA EY +TM+ S
Sbjct  205  HQNICSSVILVDEDFDARIVDSGLARLMVRSDNNDGCFMTGDLGEFGYVASEYFTTMVAS  264

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y  GVVLLELATG K L      EGFKG+LVDWV Q   SGR+ D  D+ I G+G
Sbjct  265  LKGDVYGLGVVLLELATGVKAL----GGEGFKGSLVDWVKQLESSGRMADAFDEGIRGKG  320

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQD  228
            HDE+I++F+ +AC+CV  R KERW+M+QAY +L  MA +QG S  E  D+FPLIF  Q+
Sbjct  321  HDEEILKFVEVACHCVAPRPKERWTMFQAYRSLKAMAEKQGYSFTEQDDDFPLIFDTQE  379



>ref|XP_009151873.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brassica 
rapa]
Length=594

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN  S  IL+DEDFDAR++D GLARLM   D +E SF+ G LGEFGYVAPEYS+TM+ S
Sbjct  418  HQNVCSSVILIDEDFDARLVDSGLARLMVRSDNNEGSFMTGGLGEFGYVAPEYSTTMVAS  477

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD Y+ GVVL+ELATG K L      EGFKG+LVDWV Q   SGR+ D +D+ I G+G
Sbjct  478  LKGDVYALGVVLIELATGLKAL---GGGEGFKGSLVDWVKQLESSGRMADALDEGIRGKG  534

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS--EPYDEFPLIFTEQD  228
            HDE+I++F+ +AC+CV +  KERW+M+QAY +L  MA +QG S  E  D+FPLIF  Q+
Sbjct  535  HDEEILKFVEVACHCVATNPKERWTMFQAYRSLKAMAEKQGYSFTEQDDDFPLIFDTQE  593



>ref|XP_010912844.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g27190 [Elaeis guineensis]
Length=614

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 133/181 (73%), Gaps = 4/181 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPP--DAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQ+ SS A+LLDED++ARI DFGL RL+ P   D H TS F+ GD  EFGYVAPEY++  
Sbjct  430  HQSMSSSAVLLDEDYEARITDFGLTRLVRPSAGDGHSTSPFMSGDFAEFGYVAPEYATNP  489

Query  587  IPSTKGDAYSFGVVLLELATGQKP-LELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSI  411
            + +TKGD Y FGVVLLELATGQ+  +    A EGFKGNLVDWVNQ + +GR+ D IDKSI
Sbjct  490  LATTKGDVYGFGVVLLELATGQRTEISSNAAGEGFKGNLVDWVNQLAAAGRVADAIDKSI  549

Query  410  CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
              RGHD +IV+FL++A  CVV+  KER SMYQ YE+L  +   + +SE +DEFPL++ + 
Sbjct  550  RERGHDGEIVEFLKVALGCVVADPKERSSMYQVYESLKTIGEARDVSEQFDEFPLVYGKD  609

Query  230  D  228
            D
Sbjct  610  D  610



>gb|ABR16721.1| unknown [Picea sitchensis]
Length=613

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 130/178 (73%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS++ILLD++++ RI DFGLARLM P D H ++F+ GD G+ GYVAPEY
Sbjct  418  SCNPRVIHRNISSNSILLDDEYEPRITDFGLARLMNPVDTHLSTFINGDFGDLGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFGVVLLEL TGQKP+ +   E+GFKGNLVDW+ + S  GRI + ID
Sbjct  478  MRTLVATLKGDVYSFGVVLLELVTGQKPINVENGEDGFKGNLVDWITKLSNDGRISEAID  537

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ GRG +++++QF+R+AC CV+S +KER SMY+ Y  L  +  +   S+  DE PL
Sbjct  538  KSLIGRGQEDELLQFMRVACACVLSGAKERPSMYEVYHLLRAIGEKYNFSDGNDEIPL  595



>ref|XP_010512071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=594

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 130/178 (73%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR+MD+GL +L++  D+ ++SF   +LGEFGYV PEY STM+ S
Sbjct  416  HQYISSNVILLDEDFDARVMDYGLGKLVSSRDSKDSSFSNDELGEFGYVPPEYLSTMVVS  475

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP  +   +EGFK +LVDWV +H  +GR KD ID+SI G+G
Sbjct  476  LSGDVYGFGIVLLEIVTGQKPFLINNGQEGFKESLVDWVGKHLSNGRSKDAIDRSIYGKG  535

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPY-DEFPLIFTEQD  228
            +D++I+Q L IAC+CVVSR KER  M Q YE+L  +  Q G    Y DEFPLIF +Q+
Sbjct  536  YDDEIMQVLLIACSCVVSRPKERPLMIQVYESLKNLGDQYGFFPEYSDEFPLIFNKQE  593



>gb|AAB61113.1| Similar to Arabidopsis receptor-like protein kinase precursor 
(gb|M84659) [Arabidopsis thaliana]
Length=574

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR++D+GL +L++  D+ ++SF  G   +FGYVAPEYSSTM+ S
Sbjct  397  HQYISSNVILLDEDFDARVIDYGLGKLVSSQDSKDSSFSNG---KFGYVAPEYSSTMVAS  453

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP+ +   EEGFK +LV+WV++H  +GR KD ID+ I G+G
Sbjct  454  LSGDVYGFGIVLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGKG  513

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            +D++I+Q LRIAC+CVVSR KER  M Q YE+L  +  Q G  SE  DEFPLIF +Q+
Sbjct  514  YDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFNKQE  571



>ref|NP_177157.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGI5.1|Y1699_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g69990; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59270.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE35006.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=591

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 133/178 (75%), Gaps = 4/178 (2%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR++D+GL +L++  D+ ++SF  G   +FGYVAPEYSSTM+ S
Sbjct  414  HQYISSNVILLDEDFDARVIDYGLGKLVSSQDSKDSSFSNG---KFGYVAPEYSSTMVAS  470

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP+ +   EEGFK +LV+WV++H  +GR KD ID+ I G+G
Sbjct  471  LSGDVYGFGIVLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGKG  530

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            +D++I+Q LRIAC+CVVSR KER  M Q YE+L  +  Q G  SE  DEFPLIF +Q+
Sbjct  531  YDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFNKQE  588



>emb|CDY38780.1| BnaA07g28520D [Brassica napus]
Length=600

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 132/179 (74%), Gaps = 2/179 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFV-KGDLGEFGYVAPEYSSTMIP  582
            HQ  SS+ ILLDEDFD R++D+GL +L++       S    GD GE GYVAPEY+STM+ 
Sbjct  421  HQYISSNVILLDEDFDPRVIDYGLGKLVSSSRDSNDSSFSNGDFGEVGYVAPEYASTMVA  480

Query  581  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR  402
            S  GD Y+FGVVLLE+ TGQKPL +   E+GF G LVDWV++H  +GR KDV+D+++ G+
Sbjct  481  SLSGDVYAFGVVLLEIVTGQKPLSINNGEDGFNGCLVDWVSKHLSNGRSKDVVDRNVIGK  540

Query  401  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            G+D++I+QFLRIAC+CVVSR KER  M Q YE+L K+  + G  SE  DEFPLIF +Q+
Sbjct  541  GYDDEIMQFLRIACSCVVSRPKERPLMIQVYESLKKLGDRYGFFSEHSDEFPLIFNKQE  599



>ref|XP_009105677.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Brassica rapa]
Length=596

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFV-KGDLGEFGYVAPEYSSTMIP  582
            HQ  SS+ ILLDEDFD R++D+GL +L++       S    GD GE GYVAPEY+STM+ 
Sbjct  417  HQYISSNVILLDEDFDPRVIDYGLGKLVSSSRDSNDSSFSNGDFGEVGYVAPEYASTMVA  476

Query  581  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR  402
            S  GD Y+FGVVLLE+ TGQKPL +   E+GF G+LVDWV++H  +GR K+V+D+S+ G+
Sbjct  477  SLSGDVYAFGVVLLEIVTGQKPLSINNGEDGFNGSLVDWVSKHLSNGRGKNVVDRSVIGK  536

Query  401  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD  228
            G+D++++QFLRIAC+CVVSR KER  M Q YE+L K+  + G  SE  DEFPLIF +Q+
Sbjct  537  GYDDEMMQFLRIACSCVVSRPKERPLMIQVYESLKKLGDRYGFFSEHSDEFPLIFNKQE  595



>ref|XP_010471000.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g69990 [Camelina sativa]
Length=616

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLDEDFDAR+MD+GL +L++  D+ + SF   +LGEF YV PEY+STM+ S
Sbjct  438  HQYISSNVILLDEDFDARVMDYGLGKLVSSRDSKDNSFSNDELGEFSYVPPEYASTMVVS  497

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP  +   +EGFK +LVDWV +H  +GR KD ID+SI G+G
Sbjct  498  LNGDVYGFGIVLLEIVTGQKPFSINNGQEGFKESLVDWVGKHLSNGRSKDAIDRSIYGKG  557

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPY-DEFPLIFTEQD  228
            +D +I+Q L IAC+CVVSR KER  M Q YE+L  +  Q      Y DEFPLIF +Q+
Sbjct  558  YDNEIMQVLLIACSCVVSRPKERPLMIQVYESLKNLGDQYVFFLEYSDEFPLIFNKQE  615



>ref|XP_004978090.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Setaria 
italica]
Length=650

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN S+ A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  465  HQNLSASAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  524

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGDAY+FGV+L EL +GQ+   + T    EGFKG LVDWVNQ   SGRI DV+DK 
Sbjct  525  VGTMKGDAYAFGVILFELVSGQEAAAVVTDVTGEGFKGTLVDWVNQLKASGRISDVVDKQ  584

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GHD++I +FL++A  C   R KER+SMY+AY +L  +   + +SE +DEFPL + +
Sbjct  585  LRGKGHDKEIDEFLKVAFACTQPRPKERYSMYRAYHSLKSIGQGRDVSEQFDEFPLAYNK  644

Query  233  QDTSS  219
            +D+ +
Sbjct  645  EDSDT  649



>ref|XP_008670287.1| PREDICTED: probable inactive receptor kinase At1g27190 [Zea mays]
Length=315

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 126/185 (68%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED+DARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  130  HQNLSSSAVLLDEDYDARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  189

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGDAY+FGV+L EL +GQ+   + T    EGFKG LVDWVNQ   SGRI D IDK 
Sbjct  190  VGTMKGDAYAFGVILFELVSGQESAAVVTDVTGEGFKGTLVDWVNQLKASGRISDAIDKP  249

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GH+ +I +FL+IA  C   R  ER SMY+ + AL  +     ++E +DEFPL + +
Sbjct  250  LRGKGHEAEIQEFLKIAFACTQPRVTERHSMYRVFHALKSIGEGCDVTEQFDEFPLAYNK  309

Query  233  QDTSS  219
             D+ +
Sbjct  310  DDSDA  314



>gb|AEW22944.1| leucine-rich repeat receptor-like protein kinase, partial [Cenchrus 
ciliaris]
Length=597

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  412  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  471

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGDAY+FGV+L EL +GQ+   + T    +GFKG LVDWVNQ   SGRI DV+DK 
Sbjct  472  VGTMKGDAYAFGVILFELVSGQEAAAVVTDVTGDGFKGTLVDWVNQLKASGRISDVVDKP  531

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GHD++I + L++A  C+  R KER+SMY+AY +L  +   + +SE +DEFPL + +
Sbjct  532  LRGKGHDKEIDELLKVAFACIQPRLKERYSMYRAYHSLKDIEQGRDVSEQFDEFPLSYNK  591

Query  233  QDTSS  219
            +D+ +
Sbjct  592  EDSDT  596



>ref|XP_003580015.1| PREDICTED: probable inactive receptor kinase At1g27190 [Brachypodium 
distachyon]
Length=630

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  445  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  504

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGD Y+FGV+LLEL +GQ+   + +  A EGFKG LVDWV Q   SGRI D +DKS
Sbjct  505  VGTMKGDTYAFGVILLELVSGQEAATVASDVAGEGFKGTLVDWVYQLKSSGRITDAVDKS  564

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GHD +I +FL++A  C+ +R KER SMY+ Y AL  +   + +SE +DEFPL + +
Sbjct  565  LNGKGHDTEIGEFLKVAFQCISARPKERVSMYRVYHALKSIGTGRDVSEQFDEFPLSYNK  624

Query  233  QDTSS  219
             D+ +
Sbjct  625  DDSDT  629



>ref|XP_006653547.1| PREDICTED: probable inactive receptor kinase At1g27190-like [Oryza 
brachyantha]
Length=602

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GE+GYVAPE +S  
Sbjct  417  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEYGYVAPECASNP  476

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGD Y+FGV+L EL +GQ+   +T+  A EGFKG LVDW+NQ   SGRI DV+ KS
Sbjct  477  VATMKGDVYAFGVILFELVSGQEAATVTSDAAGEGFKGTLVDWINQLKASGRIGDVVHKS  536

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            +CG GHD +I +F++IA  C++ R +ER SMY+ Y +L  +   + +SE +DEFPL + +
Sbjct  537  LCGNGHDSEIDEFVKIAFACIMVRPRERLSMYKVYHSLKSIGQGRDVSEQFDEFPLAYNK  596

Query  233  QDTSS  219
             ++ +
Sbjct  597  DESDT  601



>ref|XP_006390935.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
 gb|ESQ28221.1| hypothetical protein EUTSA_v10018330mg [Eutrema salsugineum]
Length=582

 Score =   196 bits (499),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 11/179 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQ  SS+ ILLD+DFDAR++D+GL +L++   ++E+SF  G   E GYVAPE SSTM+ S
Sbjct  412  HQYISSNVILLDDDFDARVVDYGLEKLVS---SNESSFSNG---ELGYVAPECSSTMVAS  465

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD Y FG+VLLE+ TGQKP+ +   E+G   +LVDWV++H  +GR KD ID+SI G+G
Sbjct  466  LSGDVYGFGIVLLEIVTGQKPILINNGEDG---SLVDWVSKHLSNGRSKDAIDRSIIGKG  522

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPY--DEFPLIFTEQD  228
            +DE+I+QFLRIAC+CVVSR KER  M Q YE+L  +  Q G+   +  DEFPLIF +Q+
Sbjct  523  YDEEIMQFLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGLFSEHISDEFPLIFNKQE  581



>ref|XP_009385796.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=611

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLM--APPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN  S AILLDED +ARI +FGL RL+  A  D   +S F+ GD GEFGY APEY +  
Sbjct  426  HQNLCSKAILLDEDNEARITEFGLTRLVRTAAGDGDNSSPFLNGDFGEFGYTAPEYDTNS  485

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
             P+TKGD Y+FG+VLLEL TGQK  E+TT  A E FKG+LVDWVNQ S +G+  + ID+S
Sbjct  486  DPTTKGDVYAFGIVLLELVTGQKATEITTDVAGEVFKGSLVDWVNQLSAAGKTHEAIDRS  545

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+G+D++I+Q L+IA  CVV++ KER SMY+ ++AL  +  +  ISE +DEFPL++ +
Sbjct  546  LRGKGNDDEIIQVLKIASGCVVAQLKERPSMYKVFQALKIIGERYNISEQFDEFPLVYGK  605

Query  233  QDTSS  219
             +  S
Sbjct  606  DELDS  610



>dbj|BAK03355.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 131/184 (71%), Gaps = 6/184 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  442  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  501

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT-AEEGFKGNLVDWVNQHSGSGRIKDVIDKSI  411
            + + KGD Y+FGV+LLEL +GQ+   +++   EGFKG LVDWV Q   +GRI D +DKS+
Sbjct  502  VGTMKGDTYAFGVILLELVSGQEAASVSSDVGEGFKGTLVDWVFQLKSTGRIADAVDKSL  561

Query  410  CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ  231
              +GHD +I +FL++A  C+V+R KER SMY+ Y +L  +   + +SE +DEFPL + + 
Sbjct  562  --KGHDAEISEFLKVAFQCIVARPKERISMYRVYHSLKSIGTGRDVSEQFDEFPLAYNKD  619

Query  230  DTSS  219
            D+ +
Sbjct  620  DSDT  623



>ref|NP_001143239.1| uncharacterized protein LOC100275764 precursor [Zea mays]
 gb|ACG30073.1| hypothetical protein [Zea mays]
Length=467

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 128/187 (68%), Gaps = 7/187 (4%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+KGDLGEFGYVAPE +S  
Sbjct  280  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLKGDLGEFGYVAPECASNP  339

Query  587  IPSTKGDAYSFGVVLLELATGQKPLE----LTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + +TKGDAY+FGVVL EL +GQ+       +    EGFKG LVDWV Q   SGRI D +D
Sbjct  340  VGTTKGDAYAFGVVLFELVSGQEAAAAVGTVDVTGEGFKGTLVDWVYQLKASGRIGDAVD  399

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            KS+ G+GH+ +I +FL++A  C   R +ER SMY+ Y AL  +   +  +E +DEFPL +
Sbjct  400  KSLRGKGHEAEIEEFLKVAFACTQPRVRERHSMYRVYHALKSIGEGRDATEQFDEFPLAY  459

Query  239  TEQDTSS  219
             + D+ +
Sbjct  460  NKDDSDT  466



>ref|XP_008669246.1| PREDICTED: probable inactive receptor kinase At1g27190 [Zea mays]
 tpg|DAA37241.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=626

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 126/185 (68%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED+DARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  441  HQNLSSSAVLLDEDYDARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  500

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGDAY+FGV+L EL +GQ+   + T    EGFKG LVDWVNQ   SGRI D IDK 
Sbjct  501  VGTMKGDAYAFGVILFELVSGQEAAAVVTDVTGEGFKGTLVDWVNQLKASGRISDAIDKP  560

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GH+ +I +FL+IA  C   R  ER SMY+ + AL  +     ++E +DEFPL + +
Sbjct  561  LRGKGHEAEIQEFLKIAFACTQPRVTERHSMYRVFHALKSIGEGCDVTEQFDEFPLAYNK  620

Query  233  QDTSS  219
             D+ +
Sbjct  621  DDSDA  625



>ref|XP_010251401.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251402.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
 ref|XP_010251403.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=617

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLDEDF+ +I +FGLARLM P D H ++FV GD G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCILLDEDFEPKISNFGLARLMNPVDTHLSTFVNGDFGDLGYVAPEYARTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG+VLLEL TG++P  +  A EGFKGNL +WV + S   R++D IDKS+ G+ 
Sbjct  487  PKGDVYSFGIVLLELVTGERPTHVANAPEGFKGNLAEWVTKLSSDSRLQDAIDKSLVGKD  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D +++QFLR+ACNCV+   KER +M++ Y+ L  +  +
Sbjct  547  IDGELLQFLRVACNCVLPTPKERPTMFEVYQLLRAIGER  585



>dbj|BAJ90680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  160  TCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPLDTHLSTFVNGEFGDIGYVAPEY  219

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
             ST++ + KGD YSFGVVLLEL TG++P +++TA + F+GNLV+W+   S +  ++D ID
Sbjct  220  GSTLVATPKGDVYSFGVVLLELITGERPTQVSTAPDNFRGNLVEWITYLSNNAILQDSID  279

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++QFL++AC+C V+ +KER +M++ Y+ L  +  +
Sbjct  280  KSLIGKDNDSELMQFLKVACSCTVTTAKERPTMFEVYQLLRAIGEK  325



>ref|NP_001067622.1| Os11g0249900 [Oryza sativa Japonica Group]
 dbj|BAF27985.1| Os11g0249900, partial [Oryza sativa Japonica Group]
Length=501

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D+D +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  307  SCNPRILHRNISSKCILLDDDYDPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  366

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P ++  A E FKG+LVDW+   S +  ++D +D
Sbjct  367  ARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNNAILQDAVD  426

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ HD +++QF+++AC+CV+S  KER +M++ Y+ +  +  +   S   DE  +
Sbjct  427  KSLIGKDHDAELLQFMKVACSCVLSAPKERPTMFEVYQLMRAIGEKYHFSAADDELTM  484



>ref|XP_010242455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nelumbo nucifera]
Length=630

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDEDF+ +I +FGLARLM P D H ++FV GD G+ GYVAPEY
Sbjct  428  SCNPRIIHRNISSKCILLDEDFEPKISNFGLARLMNPVDTHLSTFVNGDFGDLGYVAPEY  487

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG+VLLEL TG++P  ++ A EGFKGNL +WV   S +  + D ID
Sbjct  488  TRTLMATPKGDVYSFGIVLLELVTGERPTHVSNAPEGFKGNLAEWVTHLSSNSNLHDAID  547

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS  270
            KS+ G G D +++QFL++ACNC+V  +KER +M++ Y+ L  +  +   +
Sbjct  548  KSLVGNGFDGELLQFLKVACNCIVPTAKERPTMFEVYQLLRAIGERYNFT  597



>ref|XP_009799665.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009799666.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=625

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 124/184 (67%), Gaps = 4/184 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
              NP   H+N SS  ILLD +F+ RI DFGLARLM P D H ++FV G+ G  GYVAPEY
Sbjct  426  NCNPRIIHRNISSKCILLDVEFEPRISDFGLARLMNPIDTHLSTFVNGEFGVMGYVAPEY  485

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFGVVLLEL TG++P  +T A E FKGNLV+W+   SG   ++D ID
Sbjct  486  LRTLVATPKGDVYSFGVVLLELVTGERPTYVTKAPESFKGNLVEWITHLSGESMLQDAID  545

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            +S+CG+G+D+++ Q L++AC CV+S  KER SM++ Y+ L  +  +   +   D   L+ 
Sbjct  546  RSLCGKGYDDEVFQVLKVACRCVLSEHKERPSMFEVYQLLRAIGERYNFTTEND--ILML  603

Query  239  TEQD  228
            +E D
Sbjct  604  SETD  607



>ref|XP_002446698.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
 gb|EES11026.1| hypothetical protein SORBIDRAFT_06g020750 [Sorghum bicolor]
Length=627

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+ GD GEFGYVAPEY+S  
Sbjct  442  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLNGDFGEFGYVAPEYASNP  501

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGDAY+FGV+L EL +GQ+   + T    EGFKG LVDWVNQ   SGRI DV+DK 
Sbjct  502  VGTMKGDAYAFGVILFELVSGQEAAAVVTDVTGEGFKGTLVDWVNQLKASGRISDVVDKP  561

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+GH+ +I +FL+IA  C     +ER SMY+ + AL  +   + ++E +DEFPL + +
Sbjct  562  LRGKGHEAEIEEFLKIAFACTQPCVRERHSMYRVFHALKSIGEGRDVTEQFDEFPLAYNK  621

Query  233  QDTSS  219
             D+ +
Sbjct  622  DDSDT  626



>gb|EAY80522.1| hypothetical protein OsI_35701 [Oryza sativa Indica Group]
Length=525

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D+D +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  331  SCNPRILHRNISSKCILLDDDYDPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  390

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P ++  A E FKG+LVDW+   S +  ++D +D
Sbjct  391  ARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNNSILQDAVD  450

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ HD +++QF+++AC+CV+S  KER +M++ Y+ +  +  +   S   DE  +
Sbjct  451  KSLIGKDHDAELLQFMKVACSCVLSAPKERPTMFEVYQLMRAIGEKYHFSAADDELTM  508



>gb|KJB10817.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
Length=526

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 123/181 (68%), Gaps = 10/181 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  340  HRNISSKCILLDADFEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEYARTLVAT  399

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG++P  +T A E FKG+LV+W++Q S  G++ D ID S+ G G
Sbjct  400  PKGDVYSFGVVLLELVTGERPTHITKAPETFKGSLVEWISQLSDDGKLHDAIDASLVGNG  459

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
             D ++ QFL++ACNCV+   KER +M++ Y+ L      + I E Y+      TE + S 
Sbjct  460  VDNELFQFLKVACNCVLPTPKERPAMFEVYQLL------RAIGERYN----FTTEDEISM  509

Query  218  P  216
            P
Sbjct  510  P  510



>ref|XP_003624238.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|ABN08998.1| Protein kinase [Medicago truncatula]
 gb|AES80456.1| LRR receptor-like kinase [Medicago truncatula]
Length=615

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+
Sbjct  419  CNPRIIHRNISSKCILLDVDFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYT  478

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
            +T++ + KGD YSFG VLLEL TG++P  +  A E FKGNLV+W+ Q S + ++KD ID+
Sbjct  479  TTLVATPKGDVYSFGTVLLELVTGERPTHIAKAPETFKGNLVEWIMQLSVNSKLKDAIDE  538

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            S+ G+G D ++ QFL++ACNCV S  KER +M++ Y+ L  + ++
Sbjct  539  SLVGKGVDHELFQFLKVACNCVSSTPKERPTMFEVYQFLRDIGSR  583



>gb|AFW58657.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=632

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 8/188 (4%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++ARI D GL RL  MAP +  +TS F+KGDLGEFGYVAPE +S  
Sbjct  444  HQNLSSSAVLLDEDYEARITDVGLTRLVRMAPGEGGDTSPFLKGDLGEFGYVAPECASNP  503

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTTAE-----EGFKGNLVDWVNQHSGSGRIKDVI  423
            + +TKGDAY+FGVVL EL +GQ+             EGFKG LVDWV Q   SGRI D +
Sbjct  504  VGTTKGDAYAFGVVLFELVSGQEAAAAAVGTVDVMGEGFKGTLVDWVYQLKASGRIGDAV  563

Query  422  DKSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI  243
            DKS+ G+GH+ +I +FL++A  C   R +ER SMY+ Y AL  +   +  +E +DEFPL 
Sbjct  564  DKSLRGKGHEAEIEEFLKVAFACTQPRVRERHSMYRVYHALKSIGEGRDATEQFDEFPLA  623

Query  242  FTEQDTSS  219
            + + D+ +
Sbjct  624  YNKDDSDT  631



>gb|AAT94042.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV32131.1| putative systemin receptor SR160 [Oryza sativa Japonica Group]
 gb|EEE63733.1| hypothetical protein OsJ_18551 [Oryza sativa Japonica Group]
Length=607

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  413  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  472

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++TA E F+G+LV+W+N  S +  ++D +D
Sbjct  473  ARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWINYLSNNALLQDAVD  532

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFL++AC+C +S  KER +M++ Y+ L  +  +
Sbjct  533  KSLIGKGSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAIGEK  578



>ref|XP_006386865.1| hypothetical protein POPTR_0002s24100g [Populus trichocarpa]
 gb|ERP64662.1| hypothetical protein POPTR_0002s24100g [Populus trichocarpa]
Length=621

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  429  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHMSTFVNGEFGDLGYVAPEYARTLVAT  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG+ P  +  A E FKG+LV+W+ Q S + ++KD +DKS+ G+G
Sbjct  489  PKGDVYSFGTVLLELVTGETPTHVAKAPESFKGSLVEWITQLSSNSQLKDAVDKSLAGKG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D +I QFL++ACNCV+   KER +M++ Y+ L  +  Q
Sbjct  549  VDNEIFQFLKVACNCVLPTPKERPTMFEVYQLLRAIGEQ  587



>gb|AAX95167.1| receptor-like protein kinase [Oryza sativa Japonica Group]
 gb|ABA92374.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=606

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D+D +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYDPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P ++  A E FKG+LVDW+   S +  ++D +D
Sbjct  472  ARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNNAILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ HD +++QF+++AC+CV+S  KER +M++ Y+ +  +  +   S   DE  +
Sbjct  532  KSLIGKDHDAELLQFMKVACSCVLSAPKERPTMFEVYQLMRAIGEKYHFSAADDELTM  589



>ref|NP_001055553.2| Os05g0414700 [Oryza sativa Japonica Group]
 dbj|BAF17467.2| Os05g0414700, partial [Oryza sativa Japonica Group]
Length=625

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  431  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  490

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++TA E F+G+LV+W+N  S +  ++D +D
Sbjct  491  ARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWINYLSNNALLQDAVD  550

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFL++AC+C +S  KER +M++ Y+ L  +  +
Sbjct  551  KSLIGKGSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAIGEK  596



>gb|EAZ17993.1| hypothetical protein OsJ_33541 [Oryza sativa Japonica Group]
Length=634

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D+D +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  440  SCNPRILHRNISSKCILLDDDYDPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  499

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P ++  A E FKG+LVDW+   S +  ++D +D
Sbjct  500  ARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNNAILQDAVD  559

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ HD +++QF+++AC+CV+S  KER +M++ Y+ +  +  +   S   DE  +
Sbjct  560  KSLIGKDHDAELLQFMKVACSCVLSAPKERPTMFEVYQLMRAIGEKYHFSAADDELTM  617



>ref|XP_011015307.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
 ref|XP_011015308.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
 ref|XP_011015309.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
Length=621

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  429  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG+KP  +  A E FKG+LV+W+ Q S + ++KD +DKS+ G+G
Sbjct  489  PKGDVYSFGTVLLELVTGEKPTHVAKAPESFKGSLVEWITQLSSNSQLKDAVDKSLGGKG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D +I QFL++ACNCV+   K+R +M++ Y+ L  +  Q
Sbjct  549  VDNEIFQFLKVACNCVLPTPKDRPTMFEVYQLLRAIGEQ  587



>ref|XP_004290111.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Fragaria vesca subsp. vesca]
 ref|XP_011458125.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Fragaria vesca subsp. vesca]
Length=619

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 134/205 (65%), Gaps = 14/205 (7%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
              NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  422  NCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q S   ++ D ID
Sbjct  482  TRTLVATPKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWILQLSSKSQLTDAID  541

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            KS+ G+G DE++ QFL++ACNCVV  SKER +M++ ++ L      + I + Y+     F
Sbjct  542  KSLIGKGVDEEVFQFLKVACNCVVPTSKERPTMFEVFQLL------RAIGQKYN-----F  590

Query  239  T-EQDTSSPM*YMQKA*KTIVPRQM  168
            T E++ S+P        + IV R+M
Sbjct  591  TIEEEMSTPSNNDDCVGELIVAREM  615



>ref|XP_011024726.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
Length=621

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  429  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG+KP  +  A E FKG+LV+W+ Q S + ++KD +DKS+ G+G
Sbjct  489  PKGDVYSFGTVLLELVTGEKPTHVAKAPESFKGSLVEWITQLSSNSQLKDAVDKSLGGKG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D +I QFL++ACNCV+   K+R +M++ Y+ L  +  Q
Sbjct  549  VDNEIFQFLKVACNCVLPTPKDRPTMFEVYQLLRAIGEQ  587



>ref|NP_001239701.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At5g48380-like [Glycine max]
 gb|ACM89483.1| leucine-rich repeat family protein [Glycine max]
Length=592

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  395  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  454

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  ++ A E FKGNLV+W+ Q S + ++ + ID
Sbjct  455  TKTLVATPKGDIYSFGTVLLELVTGERPTHVSKAPETFKGNLVEWIQQQSSNAKLHEAID  514

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G+G D+++ QFL++ACNCV +  KER +M++ Y+ L
Sbjct  515  ESLVGKGVDQELFQFLKVACNCVTAMPKERPTMFEVYQLL  554



>gb|KJB10818.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
 gb|KJB10819.1| hypothetical protein B456_001G226700 [Gossypium raimondii]
Length=614

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 123/181 (68%), Gaps = 10/181 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  428  HRNISSKCILLDADFEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEYARTLVAT  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG++P  +T A E FKG+LV+W++Q S  G++ D ID S+ G G
Sbjct  488  PKGDVYSFGVVLLELVTGERPTHITKAPETFKGSLVEWISQLSDDGKLHDAIDASLVGNG  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
             D ++ QFL++ACNCV+   KER +M++ Y+ L      + I E Y+      TE + S 
Sbjct  548  VDNELFQFLKVACNCVLPTPKERPAMFEVYQLL------RAIGERYN----FTTEDEISM  597

Query  218  P  216
            P
Sbjct  598  P  598



>gb|KJB42638.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42639.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42640.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
 gb|KJB42641.1| hypothetical protein B456_007G161400 [Gossypium raimondii]
Length=621

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  429  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  ++ A E FKG+LV+W+ Q S  G++ D ID S+ G+G
Sbjct  489  PKGDVYSFGVVLLELVTGEKPTHVSKAPESFKGSLVEWITQLSNDGKLHDAIDTSLLGKG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALN------KMAAQQGISEPYD  258
             D ++ QFL++ACNCV+   KER +M++ Y+ L       K   ++ I  P D
Sbjct  549  VDNELFQFLKVACNCVLPPPKERPTMFEVYQLLRAIGERYKFTTEEEILMPSD  601



>ref|XP_006601824.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
Length=618

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  421  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  480

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  ++ A E FKGNLV+W+ Q S + ++ + ID
Sbjct  481  TKTLVATPKGDIYSFGTVLLELVTGERPTHVSKAPETFKGNLVEWIQQQSSNAKLHEAID  540

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G+G D+++ QFL++ACNCV +  KER +M++ Y+ L
Sbjct  541  ESLVGKGVDQELFQFLKVACNCVTAMPKERPTMFEVYQLL  580



>ref|XP_004492888.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004492889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
Length=614

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  424  HRNISSKCILLDVDFEPKISDFGLARLMNPLDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  483

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG+KP  +T A E FKGNL +W+ Q S    +KD ID+S+ G+G
Sbjct  484  PKGDVYSFGTVLLELVTGEKPTHVTKAPETFKGNLAEWIIQLSMKSSLKDAIDESLVGKG  543

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++ACNCV S  KER +M++ Y+ L  + ++
Sbjct  544  VDHELFQFLKVACNCVTSIPKERPTMFEVYQFLRDIGSR  582



>ref|XP_010911215.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=611

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 118/160 (74%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED + +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  418  SCNPRILHRNISSKCILLDEDDEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  L+ A E FKG+LV+W+   S +  ++D ID
Sbjct  478  ARTLVATPKGDVYSFGVVLLELVTGERPTHLSNAPESFKGSLVEWITYLSNNSLLQDAID  537

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            KS+ G+ HD +++QF+++AC CV+S  KER +M++ Y+ L
Sbjct  538  KSLIGKDHDSELLQFMKVACACVLSAPKERPTMFEVYQIL  577



>gb|EAZ31160.1| hypothetical protein OsJ_15259 [Oryza sativa Japonica Group]
Length=585

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++AR  D GL RL  MAP +  +TS F+ GD GE+GYVAPE +S  
Sbjct  400  HQNLSSSAVLLDEDYEARFTDVGLTRLVRMAPGEGGDTSPFLNGDFGEYGYVAPECASNP  459

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELT--TAEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGD Y+FGV+LLEL +GQ+   +T   A EGFKG LVDWVNQ   SGRI D + KS
Sbjct  460  VATMKGDVYAFGVILLELVSGQEAATVTGDAAGEGFKGTLVDWVNQLKASGRIGDAVHKS  519

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G GHD +I +F++IA  C++   +ER+SMY+ Y +L  +   + +SE +DEFPL + +
Sbjct  520  LRGNGHDSEIDEFVKIAFACIMVHPRERFSMYRVYHSLKSIGQGRDVSEQFDEFPLAYNK  579

Query  233  QDTSS  219
             ++ +
Sbjct  580  DESDT  584



>gb|KHN40510.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=616

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  419  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  478

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  ++ A E FKGNLV+W+ Q S + ++ + ID
Sbjct  479  TKTLVATPKGDIYSFGTVLLELVTGERPTHVSKAPETFKGNLVEWIQQQSSNAKLHEAID  538

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G+G D+++ QFL++ACNCV +  KER +M++ Y+ L
Sbjct  539  ESLVGKGVDQELFQFLKVACNCVTAMPKERPTMFEVYQFL  578



>ref|XP_010095584.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB61157.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=602

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILL+ DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  402  TCNPRIIHRNISSKCILLNADFEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  461

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG+VLLEL TG+KP  ++ A E FKGNL +W++Q SG+  + + ID
Sbjct  462  ARTLVATPKGDIYSFGIVLLELVTGEKPTHVSKAPEIFKGNLAEWISQLSGNSELHEAID  521

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D ++ QFL++AC+CVV+  KER +M++ Y+ L  +  +
Sbjct  522  KSLVGKGVDGELFQFLKVACSCVVATPKERPTMFEVYQLLRAIGEK  567



>gb|KDP45203.1| hypothetical protein JCGZ_15068 [Jatropha curcas]
Length=621

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  429  HRNISSKCILLDADFEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEYTRTLMAT  488

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
            TKGD YSFG VLLEL TG+KP  +  A E FKG+LV+W+ Q S + +++D ID+S+ G+G
Sbjct  489  TKGDVYSFGTVLLELVTGEKPTHVAKAPESFKGSLVEWITQLSSNSQLQDAIDQSLVGKG  548

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D +I QFL++AC CVV   KER +M++ Y+ L  +  +
Sbjct  549  VDNEIFQFLKVACTCVVPNHKERPTMFEVYQLLGAIGEK  587



>ref|XP_009595674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009595675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=626

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 124/184 (67%), Gaps = 4/184 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
              NP   H+N SS  ILLD +F+ RI DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  427  NCNPRIIHRNISSKCILLDVEFEPRISDFGLARLMNPIDTHLSTFVNGEFGDMGYVAPEY  486

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFGVVLLEL TG++P  +T A E FKGNLV+W+   SG   ++D ID
Sbjct  487  LRTLVATPKGDVYSFGVVLLELVTGERPTYVTKAPESFKGNLVEWITHLSGESMLQDAID  546

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            +S+ G+G+D+++ Q L++AC CV+S  KER SM++ Y+ L  +  +   +   D   L+ 
Sbjct  547  RSLPGKGYDDEVFQVLKVACRCVLSAHKERPSMFEVYQLLRAIGERYNFTTEND--ILML  604

Query  239  TEQD  228
            +E D
Sbjct  605  SETD  608



>ref|XP_002962989.1| hypothetical protein SELMODRAFT_165616 [Selaginella moellendorffii]
 gb|EFJ36452.1| hypothetical protein SELMODRAFT_165616 [Selaginella moellendorffii]
Length=604

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 125/179 (70%), Gaps = 3/179 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N S+ +ILLDEDF+ARI DFGLARLM P D H ++FV GD G+ G+VAPEY
Sbjct  410  SCNPRIIHRNISASSILLDEDFEARITDFGLARLMNPVDTHISTFVNGDFGDVGHVAPEY  469

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ +T+GD YSFGVVLL+L TGQKP+E+ + E+GF+GNLVDWV   S +G +  VI 
Sbjct  470  LRTLVATTRGDVYSFGVVLLQLTTGQKPVEVVS-EDGFRGNLVDWVGMQSQNGTLGSVIQ  528

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI  243
             S+ G   D + +QFL+IA +CV +  KER S Y+ Y+ L  +  +   S+  DE PL+
Sbjct  529  SSLKGAEVDAEQMQFLKIAISCVAANPKERPSSYEVYQLLRAVGQKYHFSDQNDEIPLV  587



>ref|NP_001053144.1| Os04g0487200 [Oryza sativa Japonica Group]
 emb|CAD41324.2| OJ991113_30.7 [Oryza sativa Japonica Group]
 dbj|BAF15058.1| Os04g0487200 [Oryza sativa Japonica Group]
 gb|EAY94615.1| hypothetical protein OsI_16392 [Oryza sativa Indica Group]
Length=622

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN SS A+LLDED++AR  D GL RL  MAP +  +TS F+ GD GE+GYVAPE +S  
Sbjct  437  HQNLSSSAVLLDEDYEARFTDVGLTRLVRMAPGEGGDTSPFLNGDFGEYGYVAPECASNP  496

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELT--TAEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
            + + KGD Y+FGV+LLEL +GQ+   +T   A EGFKG LVDWVNQ   SGRI D + KS
Sbjct  497  VATMKGDVYAFGVILLELVSGQEAATVTGDAAGEGFKGTLVDWVNQLKASGRIGDAVHKS  556

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G GHD +I +F++IA  C++   +ER+SMY+ Y +L  +   + +SE +DEFPL + +
Sbjct  557  LRGNGHDSEIDEFVKIAFACIMVHPRERFSMYRVYHSLKSIGQGRDVSEQFDEFPLAYNK  616

Query  233  QDTSS  219
             ++ +
Sbjct  617  DESDT  621



>ref|XP_004962081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Setaria italica]
Length=602

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 120/160 (75%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  409  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  468

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG+KP +++TA E F+G+LV+W+N  S +  ++D ID
Sbjct  469  ARTLMATPKGDVYSFGVVLLELITGEKPTQVSTAPENFRGSLVEWINYLSNNALLQDAID  528

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            KS+ G+  D +++QFL++AC+C ++  KER +M++ Y+ L
Sbjct  529  KSLIGKDADGELMQFLKVACSCTLATPKERPTMFEVYQLL  568



>dbj|BAJ86446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPLDTHLSTFVNGEFGDIGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
             ST++ + KGD YSFGVVLLEL TG++P +++TA + F+GNLV+W+   S +  ++D ID
Sbjct  471  GSTLVATPKGDVYSFGVVLLELITGERPTQVSTAPDNFRGNLVEWITYLSNNAILQDSID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++QFL++AC+C V+ +KER +M++ Y+ L  +  +
Sbjct  531  KSLIGKDNDSELMQFLKVACSCTVTTAKERPTMFEVYQLLRAIGEK  576



>gb|EMT26982.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=604

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPLDTHLSTFVNGEFGDIGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
             ST++ + KGD YSFGVVLLEL TG++P +++TA + F+GNLV+W+   S +  ++D ID
Sbjct  471  GSTLVATPKGDVYSFGVVLLELITGERPTQVSTAPDNFRGNLVEWITYLSNNSILQDSID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++QFL++AC+C V+ +KER +M++ Y+ L  +  +
Sbjct  531  KSLIGKDNDSELMQFLKVACSCTVTTAKERPTMFEVYQLLRAIGEK  576



>emb|CBI35007.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 116/177 (66%), Gaps = 37/177 (21%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS+ IL+D+DFDARI+DFGLARLMA  D++ +SFV G LGEF              
Sbjct  368  HENISSNVILIDDDFDARIVDFGLARLMATSDSNGSSFVNGGLGEF--------------  413

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
                                   +T AEEGFKGNLV+WVNQ  GSGR KDVID+++CG+G
Sbjct  414  -----------------------VTNAEEGFKGNLVEWVNQLCGSGRNKDVIDEALCGKG  450

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
            HDE+I+QFL+IACNC+  R K+R SMYQA+E+L  M    G SE YDEFPLIF +QD
Sbjct  451  HDEEILQFLKIACNCLGPRPKDRLSMYQAFESLKSMGDHHGFSEHYDEFPLIFGKQD  507



>ref|XP_009619663.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
 ref|XP_009619664.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana tomentosiformis]
Length=622

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY+
Sbjct  428  CNPRIIHRNISSKCILLDVEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYA  487

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG++P  +  A E FKGNLV+W++  SG  +++D ID 
Sbjct  488  RTLMATPKGDVYSFGVVLLELVTGERPTSVIKAPETFKGNLVEWISNLSGESKLQDAIDH  547

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            S+ G+G+D +I Q L++AC CV+S  KER +M++ Y+ L  +  +
Sbjct  548  SLSGKGYDTEIFQVLKVACRCVLSAPKERPTMFEVYQFLRAIGER  592



>ref|XP_007139688.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
 gb|ESW11682.1| hypothetical protein PHAVU_008G050700g [Phaseolus vulgaris]
Length=614

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ RI DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  417  SCNPRIIHRNISSKCILLDTDFEPRISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  476

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG+VLLEL TG++   +  A E FKGNLV+W++Q S + ++ DVI+
Sbjct  477  AKTLVATPKGDIYSFGIVLLELVTGERATHVAKAPETFKGNLVEWISQQSSNAKLHDVIE  536

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G G D+++ QFL++ACNCV    KER +M++ Y+ L
Sbjct  537  ESLVGNGVDQELFQFLKVACNCVSEMPKERPTMFEVYQLL  576



>ref|XP_006662858.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Oryza brachyantha]
Length=606

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D+D  I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYDPNISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P ++  A E FKG+LVDW+   S +  ++D +D
Sbjct  472  ARTLVATPKGDVYSFGVVLLELVTGEEPTQVKNAPENFKGSLVDWITYLSNNSILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ +D +++QF+++AC+CV+S  KER +M++ Y+ +  +  +   S   DE  +
Sbjct  532  KSLIGKDYDAELLQFMKVACSCVLSAHKERPTMFEVYQLMRAIGEKYHFSAADDELTM  589



>ref|XP_003568447.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brachypodium distachyon]
Length=604

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 121/166 (73%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ++LDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRILHRNISSKCVILDEDYEPKISDFGLARLMNPLDTHLSTFVNGEFGDIGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
             ST++ + KGD YSFGVVLLEL T ++P ++++A + FKGNLV+W+   S    ++D ID
Sbjct  471  GSTLVATPKGDVYSFGVVLLELITSERPTQVSSAPDNFKGNLVEWIAYLSNKAILQDAID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ HD +++QF+++AC+C VS +KER +M++ Y+ L  +  +
Sbjct  531  KSLIGKDHDSELMQFMKVACSCTVSTAKERPTMFEVYQLLRAIGEK  576



>dbj|BAJ94386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 123/178 (69%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  331  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  390

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++ A E FKG+LVDW+   S +  ++D +D
Sbjct  391  THTLVATPKGDVYSFGVVLLELVTGEEPTRVSKAPENFKGSLVDWITYLSNNSILQDAVD  450

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+  D +++Q L++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  L
Sbjct  451  KSLIGKNSDAELLQVLKVACSCVLSAPKERPTMFEVYQLLRAVGEKYHFSAADDELAL  508



>ref|XP_009358936.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
Length=626

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ RI +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPRISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q SG  +++D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWITQLSGKAQLQDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             +E++ QFL++ACNCV   +KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  554  VNEELFQFLKVACNCVGPIAKERPTMFEVYQLL------RAIGEKYN-----FTIED  599



>ref|XP_008356275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=626

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ RI +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPRISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q SG  +++D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWITQLSGKSQLQDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             +E++ QFL++ACNCV   +KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  554  VNEELFQFLKVACNCVGPIAKERPTMFEVYQLL------RAIGEKYN-----FTIED  599



>ref|XP_008372669.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=626

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ RI +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPRISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q SG  +++D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWITQLSGKSQLQDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             +E++ QFL++ACNCV   +KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  554  VNEELFQFLKVACNCVGPIAKERPTMFEVYQLL------RAIGEKYN-----FTIED  599



>ref|XP_002441100.1| hypothetical protein SORBIDRAFT_09g020410 [Sorghum bicolor]
 gb|EES19530.1| hypothetical protein SORBIDRAFT_09g020410 [Sorghum bicolor]
Length=606

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDEDF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRVLHRNISSKCILLDEDFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG+KP  +++A E F+G+LV+W+N  S +  ++D ID
Sbjct  471  ARTLMATPKGDVYSFGVVLLELVTGEKPTHVSSAPENFRGSLVEWINYMSNNALLQDAID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYE  306
            KS+ G+  D +++QFL++AC+C ++  KER +M++ Y+
Sbjct  531  KSLVGKDADGELMQFLKVACSCTLATPKERPTMFEVYQ  568



>ref|XP_008788253.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Phoenix dactylifera]
Length=562

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  369  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  428

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P +++ A E FKG+L +W+   S S  ++D ID
Sbjct  429  ARTLVATPKGDVYSFGTVLLELVTGERPTQVSKAPESFKGSLAEWITYLSNSSLLQDAID  488

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++QFL++AC+CV+S  KER +M++ Y+ L  +  +
Sbjct  489  KSLIGKDYDRELLQFLKVACSCVLSDPKERPTMFEVYQLLRAIGER  534



>gb|EYU46077.1| hypothetical protein MIMGU_mgv1a002955mg [Erythranthe guttata]
Length=622

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 123/184 (67%), Gaps = 13/184 (7%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G++GYVAPEY
Sbjct  425  SCNPRIIHRNVSSKCILLDSDFEPKISDFGLARLMNPVDTHLSTFVNGEFGDYGYVAPEY  484

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG KP  +  A E FKGNLV+WV Q +   ++ D ID
Sbjct  485  ARTLVATPKGDVYSFGVVLLELVTGAKPTFVKKAPESFKGNLVEWVTQLTAESKLHDAID  544

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIF  240
            + + G+G+D ++ QFL++ACNCV    KER +M++ Y+ L      + I + YD     F
Sbjct  545  EFLVGKGYDGEVFQFLKVACNCVGPAHKERPTMFEVYQLL------RAIGQRYD-----F  593

Query  239  TEQD  228
            T +D
Sbjct  594  TTED  597



>ref|XP_002527291.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF35135.1| ATP binding protein, putative [Ricinus communis]
Length=328

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+
Sbjct  130  CNPRILHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYT  189

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFG VLLEL T +KP  +  A E FKGNLV+W+ Q S +  + + +D 
Sbjct  190  RTLVATPKGDVYSFGTVLLELVTDEKPTHVAKAPESFKGNLVEWITQLSSNTELHEALDV  249

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            ++ G+G D +I QFL+IAC CVV   KER +M++ Y+ L  +  +
Sbjct  250  NLVGKGVDNEIFQFLKIACTCVVPNPKERPTMFEVYQLLRAIGER  294



>ref|XP_009767841.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767850.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
 ref|XP_009767856.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Nicotiana sylvestris]
Length=622

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY+
Sbjct  428  CNPRIIHRNISSKCILLDMEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYA  487

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG++P  +T A E FKGNLV+W++  SG  ++ D ID 
Sbjct  488  RTLMATPKGDVYSFGVVLLELVTGERPTFVTKAPETFKGNLVEWISNLSGESKLHDAIDH  547

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            S+ G+G+D ++ Q L++AC CV+S  KER +M++ Y+ L  +  +
Sbjct  548  SLSGKGYDSEVFQVLKVACLCVLSAPKERPTMFEVYQFLRAIGER  592



>ref|XP_002980343.1| hypothetical protein SELMODRAFT_112289 [Selaginella moellendorffii]
 gb|EFJ18603.1| hypothetical protein SELMODRAFT_112289 [Selaginella moellendorffii]
Length=604

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N S+ +ILLDEDF+ARI DFGLARLM P D H ++FV GD G+ G+VAPEY
Sbjct  410  SCNPRIIHRNISASSILLDEDFEARITDFGLARLMNPVDTHISTFVNGDFGDVGHVAPEY  469

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + +GD YSFGVVLL+L TGQKP+E+ + E+GF+GNLVDWV   S +G +  VI 
Sbjct  470  LRTLVATARGDVYSFGVVLLQLTTGQKPVEVVS-EDGFRGNLVDWVGMQSQNGTLGSVIQ  528

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI  243
             S+ G   D + +QFL+IA +CV +  KER S Y+ Y+ L  +  +   S+  DE PL+
Sbjct  529  SSLKGAEVDAEQMQFLKIAISCVAANPKERPSSYEVYQLLRAVGQKYHFSDQNDEIPLV  587



>ref|XP_010679004.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679005.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++ V G+ G+ GYVAPEYS
Sbjct  424  CNPRILHRNISSKCILLDIDFEPKISDFGLARLMNPIDTHLSTVVIGEFGDLGYVAPEYS  483

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG++P ++T A E FKGNLV+WV + S S ++K  IDK
Sbjct  484  RTLVATPKGDVYSFGVVLLELVTGERPTQVTKAPENFKGNLVEWVTELSQSSKLKHAIDK  543

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            S+ G+G D ++ QFL++A NC+ S  KER SM++ Y+ L  +  +
Sbjct  544  SLLGKGVDNEVFQFLKVAHNCLSSNPKERPSMFEVYQLLRAIGER  588



>ref|XP_011089586.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
 ref|XP_011089587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Sesamum indicum]
Length=620

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS+ ILLD D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  425  SCNPRIIHRNISSNCILLDGDYEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  484

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFGVVLLEL TG+KP  +  A E FKGNLV+WV+Q S +  ++D ID
Sbjct  485  MRTLVATPKGDVYSFGVVLLELVTGEKPTYVAKAPESFKGNLVEWVSQLSSTSTLQDAID  544

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             S+ G+G D ++ QFL+IAC CV+   KER SM++ Y+ L  +  +
Sbjct  545  ASLVGKGFDSELFQFLKIACRCVLPGPKERPSMFELYQLLRAIGQR  590



>gb|KEH18041.1| LRR receptor-like kinase [Medicago truncatula]
Length=618

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  422  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPLDTHLSTFVNGEFGDFGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD +SFG VLLEL TG++P  +  A E FKGNLV+W+ + S + ++ D ID
Sbjct  482  TKTLVATPKGDVFSFGTVLLELVTGERPANVAKAPETFKGNLVEWITELSSNSKLHDAID  541

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +S+  +G D ++ QFL++ACNCV    KER +M++ Y+ L  +  +
Sbjct  542  ESLLNKGDDNELFQFLKVACNCVTEVPKERPTMFEVYQFLRAIGGK  587



>ref|XP_008788252.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Phoenix dactylifera]
Length=610

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  417  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  476

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P +++ A E FKG+L +W+   S S  ++D ID
Sbjct  477  ARTLVATPKGDVYSFGTVLLELVTGERPTQVSKAPESFKGSLAEWITYLSNSSLLQDAID  536

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++QFL++AC+CV+S  KER +M++ Y+ L  +  +
Sbjct  537  KSLIGKDYDRELLQFLKVACSCVLSDPKERPTMFEVYQLLRAIGER  582



>ref|XP_009406402.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=599

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 129/182 (71%), Gaps = 5/182 (3%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLM--APPDAHETS-FVKGDLGEFGYVAPEYSSTM  588
            HQN S  AILLDED++ARI DFGL  LM  +  D  +TS F+ GD GEFGY APE +S  
Sbjct  418  HQNLSLKAILLDEDYEARITDFGLTGLMRTSTGDGADTSPFLNGDFGEFGYTAPESASNA  477

Query  587  IPSTKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKS  414
             P+TK D Y+FG++LLEL TGQK  E+T+    EGFKG+LVDWVN+ S +GRI +  D S
Sbjct  478  DPTTKEDVYAFGIILLELVTGQKATEITSDAGGEGFKGSLVDWVNRLSITGRIHEAFDLS  537

Query  413  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE  234
            + G+G+D++I+Q L+IA  CVV+  KER SMY+ ++ L K+     +SE  DEFPL++ +
Sbjct  538  LQGKGNDDEIMQVLKIASGCVVASPKERPSMYKVFQTLKKIGDGYDLSEHLDEFPLVYGK  597

Query  233  QD  228
            ++
Sbjct  598  EE  599



>gb|EEC79229.1| hypothetical protein OsI_19968 [Oryza sativa Indica Group]
Length=930

 Score =   188 bits (478),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 121/166 (73%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  413  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  472

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++TA E F+G+LV+W+   S +  ++D +D
Sbjct  473  ARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWITYLSNNALLQDAVD  532

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFL++AC+C +S  KER +M++ Y+ L  +  +
Sbjct  533  KSLIGKGSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAIGEK  578



>ref|XP_009406423.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406424.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  420  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG+KP +++ A E F+G+LVDW+   S +  ++D ID
Sbjct  480  ARTLVATPKGDVYSFGVVLLELVTGEKPTQVSKASENFRGSLVDWITFLSNNSLLQDAID  539

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF  252
            KS+ G+ +D +++QF+++AC C +S  KER +M++ Y+ L  +  +   +   D F
Sbjct  540  KSVIGKDYDSELLQFMKVACACALSGPKERPTMFEVYQLLRAIGEKYHFTADDDIF  595



>emb|CAN63265.1| hypothetical protein VITISV_037939 [Vitis vinifera]
Length=619

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P+ +  A E FKGNLV+W+ Q S + ++ D ID+S+ G+G
Sbjct  487  PKGDVYSFGTVLLELVTGERPIHVAKAPEDFKGNLVEWITQLSSNNKLHDAIDESLVGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++AC CV+   KER +M++ ++ L  +  +
Sbjct  547  FDSELFQFLKVACTCVLPEPKERPTMFELFQFLRAIGER  585



>ref|XP_003635622.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=625

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  433  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  492

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P+ +  A E FKGNLV+W+ Q S + ++ D ID+S+ G+G
Sbjct  493  PKGDVYSFGTVLLELVTGERPIHVAKAPEDFKGNLVEWITQLSSNNKLHDAIDESLVGKG  552

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++AC CV+   KER +M++ ++ L  +  +
Sbjct  553  FDSELFQFLKVACTCVLPEPKERPTMFELFQFLRAIGER  591



>emb|CBI23562.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P+ +  A E FKGNLV+W+ Q S + ++ D ID+S+ G+G
Sbjct  487  PKGDVYSFGTVLLELVTGERPIHVAKAPEDFKGNLVEWITQLSSNNKLHDAIDESLVGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++AC CV+   KER +M++ ++ L  +  +
Sbjct  547  FDSELFQFLKVACTCVLPEPKERPTMFELFQFLRAIGER  585



>ref|XP_003577638.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Brachypodium distachyon]
Length=606

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++ A E FKG+LVDW+   S +  ++D ID
Sbjct  472  TRTLVATPKGDVYSFGVVLLELVTGEEPTHVSNAPENFKGSLVDWITYLSNNSILQDAID  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ +D +++Q +++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  +
Sbjct  532  KSLIGKDYDAELLQVMKVACSCVLSAPKERPTMFEVYQLLRAVGEKYHFSAADDELTM  589



>gb|KHN22556.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=325

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 117/179 (65%), Gaps = 1/179 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DF LARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  135  HRNISSKCILLDADFEPKISDFCLARLMNPIDTHLSTFVNGEFGDLGYVAPEYIKTLVAT  194

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL  G++P  ++ A E FKGNLV+W+ Q S + ++ + ID+S+ G+G
Sbjct  195  PKGDIYSFGTVLLELVIGERPTHVSIAPETFKGNLVEWIQQKSSNAKLHEAIDESLVGKG  254

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI-SEPYDEFPLIFTEQDT  225
             D  + QFL++ACNCV S  K+R +M++ Y+ L  +       +E    FP+   + D 
Sbjct  255  VDRDLFQFLKVACNCVTSMPKKRPAMFEVYQLLRAIGINYNFTTEDEIMFPMDIGDADN  313



>ref|XP_007134301.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 ref|XP_007134302.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06295.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
 gb|ESW06296.1| hypothetical protein PHAVU_010G035800g [Phaseolus vulgaris]
Length=609

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  415  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  474

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T+I + KGD YSFG VLLEL TG++P  +  A+E FKGNLV+W+ + + + ++ D ID
Sbjct  475  ARTLIATPKGDVYSFGTVLLELVTGERPTNVAKAQETFKGNLVEWITELTNNAKLHDAID  534

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +S+  +  D ++ QFL++ACNCV+   KER +M++ Y+ L  + A+
Sbjct  535  ESLVNKDVDSELFQFLKVACNCVLPTPKERPTMFEVYQFLRAIGAR  580



>ref|XP_010908584.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908592.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
 ref|XP_010908599.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Elaeis guineensis]
Length=610

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++F+ G+ G+ GYVAPEY
Sbjct  417  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFINGEFGDLGYVAPEY  476

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P +++ A E FKGNLV+W+   S    ++D ID
Sbjct  477  TRTLVATPKGDVYSFGTVLLELVTGERPTQVSKAPESFKGNLVEWITYLSNGSLLQDAID  536

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+ +D +++Q L++AC+CV+S  KER +M++ Y+ L  +  +
Sbjct  537  KSLIGKDNDRELLQVLKVACSCVLSAPKERPTMFEVYQLLRAIGER  582



>ref|XP_003534491.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Glycine max]
 ref|XP_006587796.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Glycine max]
Length=617

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+  I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  420  SCNPRIIHRNISSKCILLDADFEPTISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  +  A E FKGNLV+W+ Q S + ++ +VID
Sbjct  480  TKTLVATPKGDIYSFGTVLLELVTGERPTHVAKAPETFKGNLVEWIQQQSSNAKLHEVID  539

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G+G D+++ QFL++A NCV +  KER +M++ Y+ L
Sbjct  540  ESLVGKGVDQELFQFLKVASNCVTAMPKERPTMFEVYQFL  579



>ref|XP_009406422.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=672

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  479  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  538

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG+KP +++ A E F+G+LVDW+   S +  ++D ID
Sbjct  539  ARTLVATPKGDVYSFGVVLLELVTGEKPTQVSKASENFRGSLVDWITFLSNNSLLQDAID  598

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF  252
            KS+ G+ +D +++QF+++AC C +S  KER +M++ Y+ L  +  +   +   D F
Sbjct  599  KSVIGKDYDSELLQFMKVACACALSGPKERPTMFEVYQLLRAIGEKYHFTADDDIF  654



>gb|KHN22142.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=617

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+  I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  420  SCNPRIIHRNISSKCILLDADFEPTISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  +  A E FKGNLV+W+ Q S + ++ +VID
Sbjct  480  AKTLVATPKGDIYSFGTVLLELVTGERPTHVAKAPETFKGNLVEWIQQQSSNAKLHEVID  539

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            +S+ G+G D+++ QFL++A NCV +  KER +M++ Y+ L
Sbjct  540  ESLVGKGVDQELFQFLKVASNCVTAMPKERPTMFEVYQFL  579



>ref|XP_002450551.1| hypothetical protein SORBIDRAFT_05g006860 [Sorghum bicolor]
 gb|EES09539.1| hypothetical protein SORBIDRAFT_05g006860 [Sorghum bicolor]
Length=604

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL T ++P  ++ A E FKG+LVDW+   S +  ++D ID
Sbjct  472  TRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAID  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+G+D +++Q +++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  +
Sbjct  532  KSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTM  589



>ref|XP_006468634.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Citrus sinensis]
 ref|XP_006468635.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Citrus sinensis]
 gb|KDO77099.1| hypothetical protein CISIN_1g007088mg [Citrus sinensis]
Length=618

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  431  HRNISSKCILLDGDFEPKLSDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEYPRTLVAT  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG++P  LT A E FKG+LV+W+   + +  ++  IDKS+ G G
Sbjct  491  PKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFLR+ACNCV+   KER +M++ Y+ L  +A +
Sbjct  551  FDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAIAER  589



>gb|KDO43522.1| hypothetical protein CISIN_1g006982mg [Citrus sinensis]
Length=623

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD+DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  430  HRNISSKCILLDDDFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  489

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P  +  A E FKGNLV+W+ Q S +G+++D IDK +  +G
Sbjct  490  PKGDVYSFGTVLLELVTGERPTNVAKAPETFKGNLVEWIAQLSSTGQLQDAIDKCLVAKG  549

Query  398  HDEQIVQFLRIACNCVV-SRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++ACNCV+ +  KER +M++ Y+ L  +  +
Sbjct  550  VDNELFQFLKVACNCVLPTIPKERPTMFEVYQFLRAIGER  589



>ref|XP_006447934.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
 ref|XP_006469354.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Citrus sinensis]
 gb|ESR61174.1| hypothetical protein CICLE_v10014610mg [Citrus clementina]
Length=623

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD+DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  430  HRNISSKCILLDDDFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  489

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P  +  A E FKGNLV+W+ Q S +G+++D IDK +  +G
Sbjct  490  PKGDVYSFGTVLLELVTGERPTNVAKAPETFKGNLVEWIAQLSSTGQLQDAIDKCLVAKG  549

Query  398  HDEQIVQFLRIACNCVV-SRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++ACNCV+ +  KER +M++ Y+ L  +  +
Sbjct  550  VDNELFQFLKVACNCVLPTIPKERPTMFEVYQFLRAIGER  589



>ref|XP_008801014.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Phoenix dactylifera]
Length=611

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 118/160 (74%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED +A+I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  418  SCNPRILHRNISSKCILLDEDCEAKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            S T++ + KGD YSFGVVLLEL TG++P +++ A E FKG+LV+W+   S +  ++D ID
Sbjct  478  SRTLVATPKGDVYSFGVVLLELVTGERPTQVSNAPESFKGSLVEWITYLSNNFLLQDAID  537

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            KS+ G+  D +++QF+++AC CV+S  KER +M++  + L
Sbjct  538  KSLIGKDCDSELLQFMKVACACVLSAPKERPTMFEVCQLL  577



>ref|XP_006654407.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Oryza brachyantha]
Length=606

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDE+++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  414  TCNPRVLHRNISSKCILLDENYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  473

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++TA E F+G+LV+W++  S +  ++D +D
Sbjct  474  ARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWISYLSNNA-LQDAVD  532

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFL++AC+C +S  KER +M++ Y+ L  +  +
Sbjct  533  KSLVGKGSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAIGEK  578



>ref|XP_004978965.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Setaria italica]
Length=604

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 124/178 (70%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGV+LLEL TG++P  ++ A E FKG+LVDW+   S +  ++D +D
Sbjct  472  TRTLVATPKGDVYSFGVILLELVTGEEPTHVSNAPENFKGSLVDWITYLSNNSILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+ +D +++Q +++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  +
Sbjct  532  KSLIGKDNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTM  589



>ref|XP_008235868.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Prunus mume]
Length=626

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
              NP   H+N SS  ILLD DF+ +I +FGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  427  NCNPRIIHRNISSKCILLDADFEPKISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  486

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++   +  A E FKGNLV+W+ Q S   +++D +D
Sbjct  487  ARTLLATPKGDVYSFGTVLLELVTGERATHIAKAPEDFKGNLVEWIMQLSSQSQLQDALD  546

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD  258
            KS+ G+G +E++ QFL++ACNCVV   KER +M++ Y+ L      + I E Y+
Sbjct  547  KSLVGKGVNEELFQFLKVACNCVVLTPKERPTMFEVYQLL------RAIGEKYN  594



>ref|XP_009416988.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
 ref|XP_009416990.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Musa acuminata subsp. malaccensis]
Length=617

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 118/160 (74%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  423  SCNPRILHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  482

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG+KP +++ A E F+G+LV+W+   S +  ++D ID
Sbjct  483  ARTLVATPKGDVYSFGVVLLELVTGEKPTQVSNASESFRGSLVEWITFLSNNSLLQDAID  542

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            KS+ G+ +D +++QF+++AC C +S  KER +M++ Y+ L
Sbjct  543  KSLIGKDYDSELLQFMKVACVCALSGPKERPTMFEVYQFL  582



>ref|XP_007201733.1| hypothetical protein PRUPE_ppa002865mg [Prunus persica]
 gb|EMJ02932.1| hypothetical protein PRUPE_ppa002865mg [Prunus persica]
Length=626

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 6/167 (4%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPKISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLLAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   +  A E FKGNLV+W+ Q S   +++D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHIAKAPEDFKGNLVEWIMQLSSQSQLQDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD  258
             +E++ QFL++ACNCVV   KER +M++ Y+ L      + I E Y+
Sbjct  554  VNEELFQFLKVACNCVVLTPKERPTMFEVYQLL------RAIGEKYN  594



>ref|XP_010547175.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Tarenaya hassleriana]
Length=615

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 125/188 (66%), Gaps = 17/188 (9%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  DF+ +I DFGLARLM P D H ++FV G+ GEFGYVAPEY
Sbjct  418  SCNPRIIHRNISSKCILLSADFEPKISDFGLARLMNPVDTHLSTFVNGEFGEFGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELT----TAEEGFKGNLVDWVNQHSGSGRIK  432
            + T++ + KGD YSFGVVLLEL T + P  +T    + EE FKGNLV+W+ + SG  +++
Sbjct  478  TRTLVATPKGDVYSFGVVLLELVTSEIPTSITKVSESEEESFKGNLVEWITKLSGESKLR  537

Query  431  DVIDKSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF  252
            D +DKS+   G DE++ + L++ACNCV+S +KER +M++ Y+ L      + I E Y   
Sbjct  538  DAMDKSLLINGVDEEVFRVLKVACNCVLSAAKERPTMFEVYQFL------RAIGESYH--  589

Query  251  PLIFTEQD  228
               FT +D
Sbjct  590  ---FTTED  594



>ref|XP_004510191.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X1 [Cicer arietinum]
 ref|XP_004510192.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X2 [Cicer arietinum]
 ref|XP_004510193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X3 [Cicer arietinum]
 ref|XP_004510194.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like isoform X4 [Cicer arietinum]
Length=618

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  421  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPLDTHLSTFVNGEFGDFGYVAPEY  480

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD +SFG +LLEL TG++P  +  A E FKGNLV+W+ + S + ++ D ID
Sbjct  481  TKTLVATPKGDVFSFGTILLELVTGERPAHVAKAPETFKGNLVEWIAELSSNSQLHDAID  540

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +S+  +G D ++ QFL++ACNCV    KER +M++ Y+ L  +  +
Sbjct  541  ESLVDKGDDNELFQFLKVACNCVTLVPKERPTMFEVYQFLRAIGGK  586



>ref|XP_007049531.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
 gb|EOX93688.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Theobroma cacao]
Length=619

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  I+LD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCIVLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG+VLLEL TG++P  +  A + FKGNLV+W+ Q S  G+++D ID  + G+G
Sbjct  487  PKGDVYSFGIVLLELVTGERPTHVAKAPDSFKGNLVEWITQLSNDGKLQDAIDTFLVGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D +++QFL++A NCV+   KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  547  VDNELLQFLKVASNCVLPPPKERPTMFEVYQLL------RAIGERYN-----FTAED  592



>gb|EMT29216.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=606

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM   D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNAIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  ++ A E FKG+LVDW+   S +  ++D +D
Sbjct  472  THTLVATPKGDVYSFGVVLLELVTGEEPTRVSKAPENFKGSLVDWITYLSNNSILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL  246
            KS+ G+  D +++Q L++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  L
Sbjct  532  KSLIGKNSDAELLQVLKVACSCVLSAPKERPTMFEVYQLLRAVGEKYHFSAADDELAL  589



>ref|XP_010037082.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW48706.1| hypothetical protein EUGRSUZ_K02357 [Eucalyptus grandis]
Length=618

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCILLDADFEPQISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLMAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG++P +++ A E FKGNLV+W+++ S S ++ D ID+ + G+G
Sbjct  487  PKGDVYSFGVVLLELVTGERPTQVSKAPETFKGNLVEWISELSSSSKLHDAIDRHLVGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
             D+++ + L++AC+CV+   KER +M++ Y+ L
Sbjct  547  IDDEVFKVLKVACSCVLPAPKERPTMFEVYQFL  579



>gb|ACN31332.1| unknown [Zea mays]
Length=606

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  +++A E F+G+LV+W++  S +  ++D ID
Sbjct  471  ARTLVATPKGDVYSFGVVLLELVTGERPTHVSSAPENFRGSLVEWISHLSNNALLQDAID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA  288
            KS+  +  D +++QFL++AC+C ++  KER +M++ Y+ L  + 
Sbjct  531  KSLVAKDADGELMQFLKVACSCTLATPKERPTMFEVYQLLRAIG  574



>gb|ACN26668.1| unknown [Zea mays]
 gb|AFW78015.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=606

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  +++A E F+G+LV+W++  S +  ++D ID
Sbjct  471  ARTLVATPKGDVYSFGVVLLELVTGERPTHVSSAPENFRGSLVEWISHLSNNALLQDAID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA  288
            KS+  +  D +++QFL++AC+C ++  KER +M++ Y+ L  + 
Sbjct  531  KSLVAKDADGELMQFLKVACSCTLATPKERPTMFEVYQLLRAIG  574



>gb|EYU40677.1| hypothetical protein MIMGU_mgv1a004274mg [Erythranthe guttata]
Length=535

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS+ ILLD +++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  342  HRNISSNCILLDSNYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  401

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD +SFGVVLLEL TG+KP  ++ A EGFKGNLV+W++Q S   ++ + +D S+ G+G
Sbjct  402  PKGDVFSFGVVLLELVTGEKPTSVSRAHEGFKGNLVEWISQLSRESKLLEAVDVSLVGKG  461

Query  398  HDEQIVQFLRIACNCVV-SRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D +I QF+++AC+CV+ +  KER +M++ Y+ L      + I + YD     FT +D
Sbjct  462  FDSEIFQFIKVACSCVLPAGHKERPTMFEVYQLL------RAIGQRYD-----FTTED  508



>ref|NP_001151988.1| brassinosteroid LRR receptor kinase precursor [Zea mays]
 gb|ACG45260.1| brassinosteroid LRR receptor kinase precursor [Zea mays]
Length=604

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 124/179 (69%), Gaps = 2/179 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL T ++P  ++ A E FKG+LVDW+   S +  ++D +D
Sbjct  472  TRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI  243
            KS+ G+ +D +++Q +++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  ++
Sbjct  532  KSLIGKDNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTML  590



>ref|NP_001147794.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
 gb|ACG28721.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor 
[Zea mays]
Length=606

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  411  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  470

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  +++A E F+G+LV+W++  S +  ++D ID
Sbjct  471  ARTLVATPKGDVYSFGVVLLELVTGERPTHVSSAPENFRGSLVEWISHLSNNALLQDAID  530

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA  288
            KS+  +  D +++QFL++AC+C ++  KER +M++ Y+ L  + 
Sbjct  531  KSLVAKDADGELMQFLKVACSCTLATPKERPTMFEVYQLLRAIG  574



>tpg|DAA41892.1| TPA: putative leucine-rich repeat transmembrane protein kinase 
family protein [Zea mays]
Length=604

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 124/179 (69%), Gaps = 2/179 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD+D++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  412  SCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  471

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL T ++P  ++ A E FKG+LVDW+   S +  ++D +D
Sbjct  472  TRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAVD  531

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI  243
            KS+ G+ +D +++Q +++AC+CV+S  KER +M++ Y+ L  +  +   S   DE  ++
Sbjct  532  KSLIGKDNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTML  590



>ref|XP_008779573.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380 [Phoenix dactylifera]
Length=612

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDED++A+I DFGLARLM P D H ++ V G+ G+FGYVAPEY
Sbjct  419  SCNPRILHRNISSKCILLDEDYEAKISDFGLARLMNPIDTHLSTSVTGEFGDFGYVAPEY  478

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            S T++ + KGD YSFGVVLLEL TG++P +++ A E FKG LV+W+   S +  ++D ID
Sbjct  479  SRTLVATPKGDVYSFGVVLLELVTGERPTQVSNAPERFKGTLVEWIAYLSNNSLLQDAID  538

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
            KS+ G+  D +++QF+ +AC+CV+S  KER +M++  + L
Sbjct  539  KSLIGKDRDSELLQFMEVACSCVLSAPKERPTMFEVCQLL  578



>gb|AFW78014.1| putative leucine-rich repeat transmembrane protein kinase family 
protein [Zea mays]
Length=630

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  435  TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  494

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFGVVLLEL TG++P  +++A E F+G+LV+W++  S +  ++D ID
Sbjct  495  ARTLVATPKGDVYSFGVVLLELVTGERPTHVSSAPENFRGSLVEWISHLSNNALLQDAID  554

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA  288
            KS+  +  D +++QFL++AC+C ++  KER +M++ Y+ L  + 
Sbjct  555  KSLVAKDADGELMQFLKVACSCTLATPKERPTMFEVYQLLRAIG  598



>ref|XP_006448523.1| hypothetical protein CICLE_v10014622mg [Citrus clementina]
 gb|ESR61763.1| hypothetical protein CICLE_v10014622mg [Citrus clementina]
Length=618

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  431  HRNISSKCILLDGDFEPKLSDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEYPRTLVAT  490

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG++P  LT A E FKG+LV+W+   + +  ++  IDKS+ G G
Sbjct  491  PKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWIILLNTNSSLETAIDKSLLGNG  550

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFLR+ACNCV+   KER +M++ Y+ L  +  +
Sbjct  551  FDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAIGER  589



>ref|XP_002267164.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Vitis vinifera]
Length=621

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDE+F+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  422  SCNPRIIHRNISSKCILLDENFEPKLSDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFG VLLEL TG++P  ++ A +GFKG+LV+W+   S +  ++  ID
Sbjct  482  LRTLVATPKGDVYSFGTVLLELITGERPTHVSNAPDGFKGSLVEWITDLSSNSLLQTAID  541

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFLR+AC CV    KER +M++ Y+ L  +  +
Sbjct  542  KSLLGKGFDGELMQFLRVACKCVSETPKERPTMFEVYQLLRAIGER  587



>emb|CBI23354.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLDE+F+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  422  SCNPRIIHRNISSKCILLDENFEPKLSDFGLARLMNPVDTHLSTFVNGEFGDLGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + KGD YSFG VLLEL TG++P  ++ A +GFKG+LV+W+   S +  ++  ID
Sbjct  482  LRTLVATPKGDVYSFGTVLLELITGERPTHVSNAPDGFKGSLVEWITDLSSNSLLQTAID  541

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D +++QFLR+AC CV    KER +M++ Y+ L  +  +
Sbjct  542  KSLLGKGFDGELMQFLRVACKCVSETPKERPTMFEVYQLLRAIGER  587



>ref|XP_004242451.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_004242452.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
 ref|XP_010323106.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Solanum lycopersicum]
Length=620

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 117/166 (70%), Gaps = 3/166 (2%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD +++ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY+
Sbjct  428  CNPRIIHRNISSKCILLDVEYEPKISDFGLARLMNPVDTHLSTFVNGEFGDFGYVAPEYA  487

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG+ P  +  A E FKGNLV+W+ Q SG  +++D ID 
Sbjct  488  RTLMATPKGDVYSFGVVLLELVTGETPTSVAKAPETFKGNLVEWITQLSGESKLQDAIDH  547

Query  416  SICGRGHDEQIVQFLRIACNCVVSRS-KERWSMYQAYEALNKMAAQ  282
            S+  +G+D +I Q L++AC CV+S + KER +M++ Y+ L  +  +
Sbjct  548  SLSSKGYDSEIFQVLKVACRCVLSAAPKERPTMFELYQLLRAIGER  593



>ref|XP_011010589.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X2 [Populus euphratica]
Length=597

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY 
Sbjct  398  CNPRIIHRNISSKCILLDGDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYL  457

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG+KP  + TA E FKG+LV+W+ Q S    +   +DK
Sbjct  458  RTLVATPKGDVYSFGVVLLELITGEKPTHVATAPESFKGSLVEWIRQLSDGPLLHTAVDK  517

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             + G G+D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  518  PLPGNGYDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  562



>ref|XP_007028124.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007028125.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08626.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY08627.1| BAK1-interacting receptor-like kinase 1 isoform 1 [Theobroma 
cacao]
Length=623

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD D + ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  435  HRNISSKCILLDGDCEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYPRTLVAT  494

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  +  A E F+G+L +W+ Q S S  ++  IDKS+ G G
Sbjct  495  PKGDIYSFGVVLLELITGEKPTHVVNAPESFRGSLAEWITQLSSSFLLQTAIDKSLLGNG  554

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
             D +++QFLR+ACNCV+   KER +M++ Y+ L
Sbjct  555  FDSEVMQFLRVACNCVLPTPKERPTMFEVYQLL  587



>ref|XP_008382538.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Malus domestica]
Length=626

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ RI +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPRISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q S   ++ D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWIMQLSSRSQLLDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             ++++ QFL++ACNCV   +KER +M++ Y+ L  +  +
Sbjct  554  VNDELFQFLKVACNCVGPIAKERPTMFEVYQLLRAIGEK  592



>ref|XP_008447262.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Cucumis melo]
Length=614

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLDE F+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEYS T++ +
Sbjct  428  HRNISSKCILLDERFEPKISDFGLARLMNPIDTHLSTFVNGEFGDIGYVAPEYSRTLVAT  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  ++ A E FKGNLV+W+ + S   ++++ +D ++ G+ 
Sbjct  488  PKGDVYSFGVVLLELVTGEKPTHVSKAPEDFKGNLVEWITKLSEESKVQEALDATLVGKN  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D +++QFL++A +CVV  +KER +M++ Y+ L      + I E Y+     FT QD
Sbjct  548  VDSELLQFLKVAQSCVVPTAKERPTMFEVYQLL------RAIGEGYN-----FTSQD  593



>ref|XP_009342388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
 ref|XP_009342389.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Pyrus x bretschneideri]
Length=626

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ RI +FGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDADFEPRISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++   ++ A E FKGNLV+W+ Q S   ++ D +DKS+ G+G
Sbjct  494  PKGDVYSFGTVLLELVTGERATHISKAPEDFKGNLVEWIMQLSSKSQLLDALDKSLVGKG  553

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             ++++ QFL++ACNCV   +KER +M++ Y+ L  +  +
Sbjct  554  VNDELFQFLKVACNCVGPIAKERPTMFEVYQLLRAIGEK  592



>ref|XP_011010442.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
 ref|XP_011010516.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 isoform X1 [Populus euphratica]
Length=623

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  430  HRNISSKCILLDGDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYLRTLVAT  489

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  + TA E FKG+LV+W+ Q S    +   +DK + G G
Sbjct  490  PKGDVYSFGVVLLELITGEKPTHVATAPESFKGSLVEWIRQLSDGPLLHTAVDKPLPGNG  549

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  550  YDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  588



>ref|NP_001238083.1| protein kinase precursor [Glycine max]
 gb|ACJ37414.1| protein kinase [Glycine max]
Length=572

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  375  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  434

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  ++ A E FKGNLV+W+ + + + ++ D ID
Sbjct  435  TRTLVATPKGDIYSFGTVLLELVTGERPTNVSKAPETFKGNLVEWITELTSNAKLHDAID  494

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +S+  +  D ++ QFL++ACNCV    KER +M++ Y+ L  +  +
Sbjct  495  ESLVRKDVDSELFQFLKVACNCVSPTPKERPTMFEVYQLLRAIGGR  540



>ref|XP_006598679.1| PREDICTED: protein kinase isoform X1 [Glycine max]
 gb|KHN16981.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=614

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  417  SCNPRIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  476

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL TG++P  ++ A E FKGNLV+W+ + + + ++ D ID
Sbjct  477  TRTLVATPKGDIYSFGTVLLELVTGERPTNVSKAPETFKGNLVEWITELTSNAKLHDAID  536

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +S+  +  D ++ QFL++ACNCV    KER +M++ Y+ L  +  +
Sbjct  537  ESLVRKDVDSELFQFLKVACNCVSPTPKERPTMFEVYQLLRAIGGR  582



>emb|CDP03993.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  425  HRNISSKCILLDVDFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVAT  484

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD +SFGVVLLEL TG+ P  +  A E FKGNLV+W++  S + ++ D ID+S+  +G
Sbjct  485  PKGDVFSFGVVLLELVTGELPTSVAKAPESFKGNLVEWISNLSINSKLHDAIDQSLVAKG  544

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +D ++ QFL++AC+CV+   KER +M++ Y+ L  +  +
Sbjct  545  YDGELFQFLKVACSCVLPAPKERPTMFEVYQLLRAIGQR  583



>ref|XP_006366814.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Solanum tuberosum]
Length=620

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD +++ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY+ T++ +
Sbjct  434  HRNISSKCILLDVEYEPKISDFGLARLMNPVDTHLSTFVNGEFGDFGYVAPEYARTLMAT  493

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+ P  +  A E FKGNLV+W+ Q SG  +++D ID S+  +G
Sbjct  494  PKGDVYSFGVVLLELVTGETPTSVAKAPETFKGNLVEWITQLSGESKLQDAIDHSLSSKG  553

Query  398  HDEQIVQFLRIACNCVVSRS-KERWSMYQAYEALNKMAAQ  282
            +D +I Q L++AC CV++ + KER +M++ Y+ L  +  +
Sbjct  554  YDSEIFQVLKVACRCVLAAAPKERPTMFELYQLLRAIGER  593



>ref|XP_006858332.1| hypothetical protein AMTR_s00064p00147190 [Amborella trichopoda]
 gb|ERN19799.1| hypothetical protein AMTR_s00064p00147190 [Amborella trichopoda]
Length=608

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            T NP   H+N SS  ILLDEDF+ +I +FGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct  416  TCNPRVIHRNISSKCILLDEDFEPKISEFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY  475

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
            + T++ + KGD YSFG VLLEL +G+KP  +  A E FKG+LV++V   SG+  +++ ID
Sbjct  476  ARTLVATPKGDVYSFGTVLLELVSGEKPTHVVNALESFKGSLVEYVIHLSGNSCLEECID  535

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            KS+ G+G D++++QFL++AC+CV    KER SM++ Y  L  +  +
Sbjct  536  KSLIGKGIDDELLQFLQVACSCVGQTPKERPSMFEVYHLLRAIGEK  581



>dbj|BAI94492.1| receptor-like kinase [Dianthus caryophyllus]
Length=619

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD +FD +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ST++ +
Sbjct  427  HRNISSKCILLDANFDPKISDFGLARLMNPVDTHLSTFVNGEFGDIGYVAPEYASTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P     A E F+GNLV+WV + S    +KD IDKS+   G
Sbjct  487  PKGDVYSFGTVLLELVTGERPTHAAKAPENFRGNLVEWVIELSHGPNLKDAIDKSLVTNG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL+IA  CV++  KER SM++ Y+ L  +  +
Sbjct  547  VDHELYQFLKIAIRCVLTNPKERPSMFEVYQLLRSIGER  585



>ref|XP_006379647.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|ERP57444.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
Length=578

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 113/165 (68%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY 
Sbjct  379  CNPRIIHRNISSKCILLDGDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYL  438

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
             T++ + KGD YSFGVVLLEL TG+KP  +  A E FKG+LV+W+ Q S    +   IDK
Sbjct  439  RTLVATPKGDVYSFGVVLLELITGEKPTHVANAPESFKGSLVEWIKQLSHGPLLHTAIDK  498

Query  416  SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             + G G+D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  499  PLPGNGYDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  543



>ref|XP_010109952.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC24928.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=335

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 4/167 (2%)
 Frame = -2

Query  770  ANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS  597
             NP   H+N SS  ILLD DF+ ++  FGLARLM P D H ++FV G+ G+ GYVAPEY 
Sbjct  131  CNPRIIHRNISSKCILLDMDFEPKLSGFGLARLMDPIDTHLSTFVNGEFGDLGYVAPEYP  190

Query  596  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK  417
              ++ + KGD YSFGVVLLEL TG+KP  +T A E FKG+LV+W+ + S    +K  IDK
Sbjct  191  QKLVATPKGDVYSFGVVLLELITGEKPTHVTKAPESFKGSLVEWITELSSKSLLKTAIDK  250

Query  416  SICGRGHD--EQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            ++  +G D   ++ QFL++ACNCV+   KER +M++ Y+ L  +  +
Sbjct  251  TLLQKGFDNENELTQFLKVACNCVLPTPKERPTMFEVYQLLRAIGEK  297



>gb|KDO72412.1| hypothetical protein CISIN_1g040267mg [Citrus sinensis]
Length=538

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 111/168 (66%), Gaps = 27/168 (16%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            HQN SS  IL+DEDFDARIMDFG +RL             GD                 S
Sbjct  392  HQNISSSVILVDEDFDARIMDFGFSRL-----------TNGD----------------AS  424

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             + D + FGVVLLEL TGQKP E+  +EEG+KGNLV+W++Q S SGRIKDVIDK++ G+G
Sbjct  425  LQKDVHGFGVVLLELVTGQKPFEINASEEGYKGNLVNWIDQLSSSGRIKDVIDKALTGKG  484

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDE  255
            +D++I+QFL+IAC CV  R KE+WSMYQ Y +L  +A Q G SE Y+E
Sbjct  485  YDDEILQFLQIACKCVAVRPKEKWSMYQVYISLCSIAEQLGFSEFYEE  532



>ref|XP_010673854.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Beta vulgaris subsp. vulgaris]
Length=615

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 117/181 (65%), Gaps = 0/181 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLDEDF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HRNISSKCILLDEDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLVAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFG VLLEL TG++P  ++ A E FKG+LV+W+   S    ++  IDKS+  +G
Sbjct  487  PKGDIYSFGTVLLELITGERPTRVSNAPETFKGSLVEWICLLSDKNDLRSAIDKSLLDQG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS  219
             D ++ QFL++ACNCV    KER +M++ Y+ L  +      +   +E  ++    D   
Sbjct  547  VDNELTQFLKVACNCVSPMPKERPTMFEVYQLLRAIGENYHFTAAENEIMVLTENSDAGF  606

Query  218  P  216
            P
Sbjct  607  P  607



>emb|CDX85334.1| BnaC07g26450D [Brassica napus]
Length=623

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 127/191 (66%), Gaps = 20/191 (10%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  424  SCNPRIIHRNISSKCILLTADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  483

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAE------EGFKGNLVDWVNQHSGSGR  438
            S TM+ + KGD YSFGVVLLEL TGQK   +TT        EGFKGNLV+WV + S   +
Sbjct  484  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTTGSEEAEEEEGFKGNLVEWVTKLSSESK  543

Query  437  IKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPY  261
            +++ IDKS+ G+G +++I + L++ACNCV+   +K+R +M++ Y+ L      + I E Y
Sbjct  544  LQEAIDKSLLGKGVNDEIFKVLKVACNCVLPEVAKQRPTMFEVYQFL------RAIGESY  597

Query  260  DEFPLIFTEQD  228
            +     FT +D
Sbjct  598  N-----FTTED  603



>ref|XP_006379646.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 ref|XP_002312207.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|ERP57443.1| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
 gb|EEE89574.2| hypothetical protein POPTR_0008s07830g [Populus trichocarpa]
Length=630

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  437  HRNISSKCILLDGDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYLRTLVAT  496

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  +  A E FKG+LV+W+ Q S    +   IDK + G G
Sbjct  497  PKGDVYSFGVVLLELITGEKPTHVANAPESFKGSLVEWIKQLSHGPLLHTAIDKPLPGNG  556

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
            +D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  557  YDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  595



>ref|XP_004161543.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At5g48380-like [Cucumis 
sativus]
Length=614

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLDE F+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEYS T++ +
Sbjct  428  HRNISSKCILLDETFEPKISDFGLARLMNPIDTHLSTFVNGEFGDIGYVAPEYSRTLVAT  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  ++ A E FKGNLV+W+ + S   ++++ +D +  G+ 
Sbjct  488  PKGDVYSFGVVLLELVTGEKPTHVSKAPEDFKGNLVEWITKLSEESKVQEALDATFVGKN  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D +++QFL++A +CVV  +KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  548  VDGELLQFLKVARSCVVPTAKERPTMFEVYQLL------RAIGEGYN-----FTSED  593



>ref|XP_004148962.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380-like [Cucumis sativus]
 gb|KGN44710.1| hypothetical protein Csa_7G373530 [Cucumis sativus]
Length=614

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLDE F+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEYS T++ +
Sbjct  428  HRNISSKCILLDETFEPKISDFGLARLMNPIDTHLSTFVNGEFGDIGYVAPEYSRTLVAT  487

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  ++ A E FKGNLV+W+ + S   ++++ +D +  G+ 
Sbjct  488  PKGDVYSFGVVLLELVTGEKPTHVSKAPEDFKGNLVEWITKLSEESKVQEALDATFVGKN  547

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD  228
             D +++QFL++A +CVV  +KER +M++ Y+ L      + I E Y+     FT +D
Sbjct  548  VDGELLQFLKVARSCVVPTAKERPTMFEVYQLL------RAIGEGYN-----FTSED  593



>ref|XP_001774216.1| predicted protein [Physcomitrella patens]
 gb|EDQ60992.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 125/184 (68%), Gaps = 4/184 (2%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS+ ILLDE+F+ RI DFGLARLM P D H ++ V GD G+ GYVAPEY
Sbjct  421  SCNPRIIHRNISSNCILLDEEFEPRITDFGLARLMNPVDTHISTAVNGDFGDVGYVAPEY  480

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID  420
              T++ + +GD YSFGVVLLEL T QKP+++   +  FKG LV+WV   + SG I + +D
Sbjct  481  VRTLVATMRGDVYSFGVVLLELVTTQKPVDV-VVDRDFKGTLVEWVGMLASSGCIANALD  539

Query  419  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFP-LI  243
             S+ GRG D++++Q L+IA +CV + ++ER SMY+    L  +  +   S+ YDE P L+
Sbjct  540  SSLRGRGADDEMLQVLKIAWSCVNATARERPSMYEVTGLLRAVGQRYSFSDDYDECPELL  599

Query  242  FTEQ  231
             TE+
Sbjct  600  ETER  603



>ref|XP_002315108.2| hypothetical protein POPTR_0010s18550g [Populus trichocarpa]
 gb|EEF01279.2| hypothetical protein POPTR_0010s18550g [Populus trichocarpa]
Length=628

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  437  HRNISSKCILLDNDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDMGYVAPEYLRTLVAT  496

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  +  A E FKG+LV+W+ Q +    +   IDK + G G
Sbjct  497  PKGDVYSFGVVLLELITGEKPTHVANAPESFKGSLVEWIRQLTDGPLLHTSIDKPLLGNG  556

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  557  FDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  595



>ref|XP_011015926.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Populus euphratica]
Length=802

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H+N SS  ILLD DF+ ++ DFGLARLM P D H ++FV G+ G+ GYVAPEY  T++ +
Sbjct  611  HRNISSKCILLDNDFEPKLSDFGLARLMNPIDTHLSTFVNGEFGDMGYVAPEYLRTLVAT  670

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
             KGD YSFGVVLLEL TG+KP  +  A E FKG+LV+W+ Q +    +   IDK + G G
Sbjct  671  PKGDVYSFGVVLLELITGEKPTHVANAPESFKGSLVEWIRQLTDGPLLHTSIDKPLLGNG  730

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ  282
             D ++ QFL++ACNCVV  +KER +M++ ++ L  +  +
Sbjct  731  FDHELNQFLKVACNCVVENAKERPTMFEVHQLLRAIGER  769



>gb|AAL32637.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=620

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 121/181 (67%), Gaps = 15/181 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  420  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA------EEGFKGNLVDWVNQHSGSGR  438
            S TM+ + KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   +
Sbjct  480  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESK  539

Query  437  IKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPY  261
            +++ ID+S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E Y
Sbjct  540  LQEAIDRSLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL------RAIGESY  593

Query  260  D  258
            +
Sbjct  594  N  594



>ref|NP_568696.1| BAK1-interacting receptor-like kinase BIR1 [Arabidopsis thaliana]
 sp|Q9ASS4.1|Y5838_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32899.1|AF367312_1 AT5g48380/MJE7_1 [Arabidopsis thaliana]
 gb|AAL67082.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59384.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95662.1| BAK1-interacting receptor-like kinase BIR1 [Arabidopsis thaliana]
Length=620

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 121/181 (67%), Gaps = 15/181 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  420  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA------EEGFKGNLVDWVNQHSGSGR  438
            S TM+ + KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   +
Sbjct  480  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESK  539

Query  437  IKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPY  261
            +++ ID+S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E Y
Sbjct  540  LQEAIDRSLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL------RAIGESY  593

Query  260  D  258
            +
Sbjct  594  N  594



>dbj|BAA96958.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=618

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 121/181 (67%), Gaps = 15/181 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  418  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA------EEGFKGNLVDWVNQHSGSGR  438
            S TM+ + KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   +
Sbjct  478  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESK  537

Query  437  IKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPY  261
            +++ ID+S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E Y
Sbjct  538  LQEAIDRSLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL------RAIGESY  591

Query  260  D  258
            +
Sbjct  592  N  592



>gb|AAN60365.1| unknown [Arabidopsis thaliana]
Length=620

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 121/181 (67%), Gaps = 15/181 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  420  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  479

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA------EEGFKGNLVDWVNQHSGSGR  438
            S TM+ + KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   +
Sbjct  480  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESK  539

Query  437  IKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPY  261
            +++ ID+S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E Y
Sbjct  540  LQEAIDRSLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL------RAIGESY  593

Query  260  D  258
            +
Sbjct  594  N  594



>ref|XP_010493657.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Camelina sativa]
Length=623

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 14/180 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  424  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  483

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA-----EEGFKGNLVDWVNQHSGSGRI  435
            S TM+ + KGD YSFGVVLLEL TGQK   +T       EE FKGNLV+W+ + S   ++
Sbjct  484  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEECEEESFKGNLVEWITKLSSESKL  543

Query  434  KDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPYD  258
            ++ ID+S+ G G D++I + L++ACNCV+    K+R +M++ Y+ L      + I E Y+
Sbjct  544  QEAIDRSLLGNGVDDEIFKVLKVACNCVLPEVPKQRPTMFEVYQLL------RAIGESYN  597



>ref|XP_010482086.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Camelina sativa]
Length=623

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 14/180 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  424  SCNPRIIHRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  483

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA-----EEGFKGNLVDWVNQHSGSGRI  435
            S TM+ + KGD YSFGVVLLEL TGQK   +T       EE FKGNLV+W+ + S   ++
Sbjct  484  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEGEEESFKGNLVEWITKLSSESKL  543

Query  434  KDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPYD  258
            ++ ID+S+ G G D++I + L++ACNCV+    K+R +M++ Y+ L      + I E Y+
Sbjct  544  QEAIDRSLLGNGVDDEIFKVLKVACNCVLPEVPKQRPTMFEVYQLL------RAIGESYN  597



>ref|XP_006280190.1| hypothetical protein CARUB_v10026094mg [Capsella rubella]
 gb|EOA13088.1| hypothetical protein CARUB_v10026094mg [Capsella rubella]
Length=616

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 119/180 (66%), Gaps = 14/180 (8%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N S+  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  418  SCNPRIIHRNISTKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  477

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA-----EEGFKGNLVDWVNQHSGSGRI  435
            S TM+ + KGD YSFGVVLLEL TGQK   +T       EE FKGNLV+W+ + S   ++
Sbjct  478  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEAEEESFKGNLVEWITKLSSESKL  537

Query  434  KDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEPYD  258
            +D +D+S+ G G D++I + L+I CNCV+    K+R +M++ Y+ L      + I E Y+
Sbjct  538  QDAVDRSLLGNGVDDEIFKVLKIGCNCVLPEVPKQRPTMFEVYQFL------RAIGESYN  591



>emb|CDX86309.1| BnaA06g30260D [Brassica napus]
Length=468

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 126/192 (66%), Gaps = 21/192 (11%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  268  SCNPRIIHRNISSKCILLTADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  327

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTA-------EEGFKGNLVDWVNQHSGSG  441
            S TM+ + KGD YSFGVV+LEL TGQK   +TT        EEGFKGNLV+WV   S   
Sbjct  328  SRTMVATPKGDVYSFGVVILELVTGQKATSVTTGPEEEAEEEEGFKGNLVEWVTMLSRES  387

Query  440  RIKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEP  264
            ++++ IDKS+ G+  +++I + L++ACNCV+   +K+R +M++ Y+ L      + I E 
Sbjct  388  KLQEAIDKSLLGKDVNDEIFKVLKVACNCVLPEVAKQRPTMFEVYQFL------RAIGES  441

Query  263  YDEFPLIFTEQD  228
            Y+     FT +D
Sbjct  442  YN-----FTTED  448



>ref|XP_010037095.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g48380 [Eucalyptus grandis]
 gb|KCW48741.1| hypothetical protein EUGRSUZ_K02378 [Eucalyptus grandis]
Length=583

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = -2

Query  758  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS  579
            H N SS  ILLD DF+ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY+ T++ +
Sbjct  427  HCNISSKCILLDADFEPQISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYARTLMAT  486

Query  578  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG  399
              GD YSFGVVLLEL TG++P +++ A E F+GNLV+W+++ S S ++ D ID+ + G+G
Sbjct  487  PNGDVYSFGVVLLELVTGERPTQVSKAPESFEGNLVEWISELSNSSKLHDAIDRFLVGKG  546

Query  398  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL  300
             D+++ + L++AC+CV+   K+R +M++ ++ L
Sbjct  547  IDDEVFKVLKVACSCVLPAPKDRPTMFEVHQFL  579



>ref|XP_006395190.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
 gb|ESQ32476.1| hypothetical protein EUTSA_v10003825mg [Eutrema salsugineum]
Length=622

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 125/192 (65%), Gaps = 21/192 (11%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  422  SCNPRIIHRNISSKCILLTADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELT-------TAEEGFKGNLVDWVNQHSGSG  441
            S TM+ + KGD YSFGVVLLEL TGQK   +T         EE FKGNLV+W+ + S   
Sbjct  482  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTRESEEGEEEEESFKGNLVEWITKLSSES  541

Query  440  RIKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEP  264
            ++++ ID+S+ G+G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E 
Sbjct  542  KLQEAIDRSLLGKGVDDEIFKVLKVACNCVLPEVAKQRPTMFEVYQFL------RAIGES  595

Query  263  YDEFPLIFTEQD  228
            Y+     FT  D
Sbjct  596  YN-----FTTDD  602



>dbj|BAJ33754.1| unnamed protein product [Thellungiella halophila]
Length=622

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 125/192 (65%), Gaps = 21/192 (11%)
 Frame = -2

Query  773  TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY  600
            + NP   H+N SS  ILL  DF+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEY
Sbjct  422  SCNPRIIHRNISSKCILLTADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEY  481

Query  599  SSTMIPSTKGDAYSFGVVLLELATGQKPLELT-------TAEEGFKGNLVDWVNQHSGSG  441
            S TM+ + KGD YSFGVVLLEL TGQK   +T         EE FKGNLV+W+ + S   
Sbjct  482  SRTMVATPKGDVYSFGVVLLELVTGQKATSVTRESEEGEEEEESFKGNLVEWITKLSSES  541

Query  440  RIKDVIDKSICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEALNKMAAQQGISEP  264
            ++++ ID+S+ G+G D++I + L++ACNCV+   +K+R +M++ Y+ L      + I E 
Sbjct  542  KLQEAIDRSLLGKGVDDEIFKVLKVACNCVLPEVAKQRPTMFEVYQFL------RAIGES  595

Query  263  YDEFPLIFTEQD  228
            Y+     FT  D
Sbjct  596  YN-----FTTDD  602



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730