BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016K03

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABW69693.1|  flavonoid 3'-hydrogenase                                207   5e-72   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               206   8e-72   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                204   7e-71   Ipomoea purpurea
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                202   6e-70   Ipomoea batatas [batate]
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                201   3e-69   Ipomoea batatas [batate]
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               204   3e-69   Ipomoea tricolor [campanilla]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                199   7e-69   Ipomoea batatas [batate]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                196   7e-69   Ipomoea ternifolia
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                198   1e-68   Ipomoea batatas [batate]
gb|ACS71532.1|  flavonoid 3' hydroxylase                                198   3e-68   Ipomoea horsfalliae [Kuhio-vine]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                194   4e-68   Ipomoea quamoclit [bejuco de cipres]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                194   1e-67   Ipomoea batatas [batate]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                194   3e-67   Ipomoea coccinea [red morning-glory]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               191   2e-64   Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               191   5e-64   Calystegia soldanella
emb|CDP19009.1|  unnamed protein product                                182   6e-58   Coffea canephora [robusta coffee]
emb|CDP19008.1|  unnamed protein product                                182   7e-58   Coffea canephora [robusta coffee]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       180   2e-57   Camellia sinensis [black tea]
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                179   8e-57   Camellia nitidissima
emb|CDP16533.1|  unnamed protein product                                177   3e-56   Coffea canephora [robusta coffee]
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              174   1e-55   Sesamum indicum [beniseed]
gb|EYU36856.1|  hypothetical protein MIMGU_mgv1a009393mg                174   8e-55   Erythranthe guttata [common monkey flower]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                174   1e-54   Cynara cardunculus var. scolymus [artichoke]
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                172   1e-54   Antirrhinum majus [garden snapdragon]
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             174   3e-54   Callistephus chinensis [Chinese aster]
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               171   4e-54   Antirrhinum kelloggii
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                183   4e-54   Paeonia lactiflora [common garden peony]
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               179   5e-54   Vaccinium ashei
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                177   5e-54   Eustoma exaltatum subsp. russellianum [bluebells]
emb|CBI15132.3|  unnamed protein product                                177   5e-54   Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    177   8e-54   Petunia x hybrida [garden petunia]
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               174   1e-53   Glandularia x hybrida [garden verbena]
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      177   1e-53   Diospyros kaki [Japanese persimmon]
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               176   2e-53   Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              176   2e-53   Vitis vinifera
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              177   3e-53   Prunus avium [gean]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 177   3e-53   Theobroma cacao [chocolate]
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                169   4e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                177   4e-53   Nekemias grossedentata
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                169   4e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                169   4e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                171   4e-53   Echinops bannaticus
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                169   4e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CAN62275.1|  hypothetical protein VITISV_007552                     175   4e-53   Vitis vinifera
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                169   4e-53   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGG18103.1|  flavonoid 3'-hydroxylase                                176   6e-53   Prunus persica
gb|AJO67966.1|  flavonoid-3'-hydroxylase                                176   7e-53   Prunus avium [gean]
gb|AJO67972.1|  flavonoid-3'-hydroxylase                                176   7e-53   Prunus avium [gean]
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           175   7e-53   Vitis vinifera
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               175   8e-53   Lobelia erinus
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       173   8e-53   Coreopsis grandiflora
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               176   8e-53   Vitis vinifera
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                174   9e-53   Iochroma calycinum
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                174   1e-52   Iochroma calycinum
emb|CAN68303.1|  hypothetical protein VITISV_041731                     176   1e-52   Vitis vinifera
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             176   1e-52   Gossypium arboreum [tree cotton]
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               176   1e-52   Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                176   1e-52   Vitis amurensis
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            174   1e-52   Daucus carota [carrots]
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                176   2e-52   Paeonia suffruticosa [moutan peony]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             174   2e-52   Prunus persica
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       171   2e-52   Dahlia pinnata
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                172   2e-52   Gerbera hybrid cultivar
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              174   2e-52   Prunus mume [ume]
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                167   2e-52   Osteospermum hybrid cultivar
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              169   2e-52   Nelumbo nucifera [Indian lotus]
gb|AEN71546.1|  flavanone 3'-hydroxylase                                176   2e-52   Paeonia suffruticosa [moutan peony]
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                174   3e-52   Gossypium hirsutum [American cotton]
gb|KJB51032.1|  hypothetical protein B456_008G198200                    174   3e-52   Gossypium raimondii
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                174   3e-52   Gossypium hirsutum [American cotton]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  174   3e-52   
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                173   3e-52   Cichorium intybus [radicchio]
gb|AGG18092.1|  flavonoid 3'-hydroxylase                                173   4e-52   Prunus armeniaca
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       169   4e-52   Dahlia pinnata
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                169   4e-52   Pilosella officinarum [mouse-ear hawkweed]
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              178   5e-52   Nicotiana tabacum [American tobacco]
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              178   5e-52   Nicotiana sylvestris
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                177   6e-52   Fragaria x ananassa
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                177   6e-52   Fragaria x ananassa
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         168   6e-52   
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                171   6e-52   Iochroma cyaneum
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                177   7e-52   Fragaria chiloensis
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    176   7e-52   Nicotiana sylvestris
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                177   8e-52   Fragaria vesca [alpine strawberry]
gb|KEH32010.1|  flavonoid hydroxylase                                   167   9e-52   Medicago truncatula
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              175   9e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             170   1e-51   Populus trichocarpa [western balsam poplar]
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                168   1e-51   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AJF48886.1|  flavonoid 3'-hydroxylase                                179   1e-51   Paeonia suffruticosa [moutan peony]
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              171   1e-51   Populus euphratica
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         172   1e-51   Eucalyptus grandis [rose gum]
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               176   1e-51   Fragaria x ananassa
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                166   1e-51   Penstemon neomexicanus
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                172   2e-51   Cosmos sulphureus [orange cosmos]
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      166   2e-51   Trifolium pratense [peavine clover]
gb|AJA79074.1|  flavonoid 3' hydroxylase                                173   2e-51   Prunus persica
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 177   2e-51   
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            172   2e-51   Malus domestica [apple tree]
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                169   2e-51   Centaurea cyanus [bachelor's-button]
ref|NP_001274347.1|  uncharacterized protein LOC101314754               175   2e-51   Fragaria vesca [alpine strawberry]
gb|AJD25177.1|  cytochrome P450 CYP75B79                                165   3e-51   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         171   3e-51   Eucalyptus grandis [rose gum]
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         171   3e-51   Malus domestica [apple tree]
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                175   3e-51   Fragaria virginiana
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                164   3e-51   Penstemon barbatus
gb|AHA49900.1|  flavonoid 3' hydroxylase                                171   3e-51   Malus hybrid cultivar
gb|AGL81348.1|  flavanone 3' hydroxylase                                170   4e-51   Pyrus communis
gb|ACO35755.1|  chalcone 3-hydroxylase                                  169   4e-51   Cosmos sulphureus [orange cosmos]
gb|ACR14867.1|  flavonoid 3' hydroxylase                                170   4e-51   Malus domestica [apple tree]
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               167   5e-51   Perilla frutescens var. crispa
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                167   6e-51   Rudbeckia hirta
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               174   6e-51   Torenia hybrid cultivar
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               173   7e-51   Gentiana triflora
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               167   8e-51   Gynura bicolor
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                174   1e-50   Ageratina adenophora
gb|ADE80872.1|  flavonoid 3'-hydroxylase                                174   1e-50   Cyclamen persicum
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              169   1e-50   Pyrus x bretschneideri [bai li]
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                172   1e-50   Pyrus pyrifolia [sha li]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                174   1e-50   Viola x wittrockiana
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                171   1e-50   Bidens aurea
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              166   1e-50   Cichorium intybus [radicchio]
gb|AAX51195.1|  cytochrome p450                                         175   2e-50   Ageratina adenophora
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                177   2e-50   Fragaria x ananassa
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                167   2e-50   Tagetes erecta [big marigold]
gb|AGI16386.1|  flavonoid 3' hydroxylase                                172   2e-50   Ribes nigrum [European black currant]
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           164   2e-50   Medicago truncatula
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                173   2e-50   Nicotiana tabacum [American tobacco]
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     167   3e-50   Eucalyptus grandis [rose gum]
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     167   3e-50   Eucalyptus grandis [rose gum]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              173   3e-50   Nicotiana tomentosiformis
gb|KEH33153.1|  flavonoid hydroxylase                                   164   4e-50   Medicago truncatula
gb|ABC48911.1|  flavonoid 3'-hydroxylase                                177   4e-50   Vitis vinifera
gb|ABC48913.1|  flavonoid 3'-hydroxylase                                177   4e-50   Vitis vinifera
gb|ABC48912.1|  flavonoid 3'-hydroxylase                                177   4e-50   Vitis vinifera
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         173   5e-50   Solanum tuberosum [potatoes]
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                164   5e-50   Garcinia mangostana [mangosteen]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         167   5e-50   
gb|AIB06740.1|  flavanone 3'-hydroxylase                                167   5e-50   Mangifera indica
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               162   6e-50   Rhododendron x pulchrum
gb|AJD25178.1|  cytochrome P450 CYP75B80                                167   6e-50   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   6e-50   Eucalyptus grandis [rose gum]
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      170   6e-50   Pelargonium x hortorum [bedding geranium]
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         164   9e-50   Morus notabilis
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                165   9e-50   Dahlia pinnata
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              164   1e-49   Morus notabilis
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                159   1e-49   Epimedium sagittatum
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         173   2e-49   Solanum lycopersicum
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             165   2e-49   Phaseolus vulgaris [French bean]
gb|AFK73718.1|  cytochrome P450                                         157   2e-49   Papaver somniferum
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         165   3e-49   Jatropha curcas
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              171   3e-49   Echinops bannaticus
gb|AEX07282.1|  F3'H                                                    163   6e-49   Arachis hypogaea [goober]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               167   9e-49   Dianthus caryophyllus [carnation]
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              159   2e-48   Glycine soja [wild soybean]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         158   2e-48   Nelumbo nucifera [Indian lotus]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                168   3e-48   Chromolaena odorata
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         160   3e-48   Phoenix dactylifera
gb|AGC29948.1|  CYP75B65                                                157   3e-48   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AAO47857.1|  flavonoid 3'-hydroxylase                                157   4e-48   Glycine max [soybeans]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               167   7e-48   Dianthus caryophyllus [carnation]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           157   7e-48   Glycine max [soybeans]
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                159   8e-48   Erythranthe guttata [common monkey flower]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                157   8e-48   Glycine max [soybeans]
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         155   9e-48   Camelina sativa [gold-of-pleasure]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                160   9e-48   Meconopsis quintuplinervia
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             155   1e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         155   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         157   1e-47   
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              154   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             154   3e-47   Capsella rubella
emb|CDX99037.1|  BnaC09g47980D                                          159   4e-47   
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               158   4e-47   Torenia hybrid cultivar
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              159   4e-47   Osteospermum hybrid cultivar
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              156   4e-47   Morus notabilis
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             152   5e-47   
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         156   6e-47   Elaeis guineensis
gb|AAO47851.1|  flavonoid 3'-hydroxylase                                157   6e-47   Glycine max [soybeans]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            152   7e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                160   7e-47   Papaver radicatum
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                159   9e-47   Meconopsis lancifolia
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                159   1e-46   Meconopsis punicea [red poppywort]
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                158   2e-46   Meconopsis pseudohorridula
gb|AAO47849.1|  flavonoid 3'-hydroxylase                                152   2e-46   Glycine max [soybeans]
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         159   2e-46   Elaeis guineensis
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              156   2e-46   Brassica rapa
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         157   3e-46   Glycine max [soybeans]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              157   3e-46   Glycine soja [wild soybean]
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             156   3e-46   
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         153   4e-46   Morus notabilis
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   154   5e-46   Callistephus chinensis [Chinese aster]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                157   5e-46   Meconopsis horridula [prickly blue-poppy]
gb|AES69199.2|  flavonoid hydroxylase                                   153   5e-46   Medicago truncatula
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                156   8e-46   Papaver nudicaule [Arctic poppy]
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           152   9e-46   
ref|XP_003598947.1|  Flavonoid 3'-hydroxylase                           154   1e-45   
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              154   1e-45   
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               166   1e-45   Tricyrtis hirta
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         156   1e-45   Citrus sinensis [apfelsine]
emb|CDX69984.1|  BnaA10g23330D                                          158   1e-45   
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                157   2e-45   Meconopsis delavayi
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         162   2e-45   Cucumis sativus [cucumbers]
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                160   3e-45   Iris x hollandica [Dutch iris]
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      152   3e-45   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         149   3e-45   Phoenix dactylifera
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      156   4e-45   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                156   4e-45   Brassica napus [oilseed rape]
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      153   4e-45   Matthiola incana
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         150   8e-45   Brachypodium distachyon [annual false brome]
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              160   1e-44   Cucumis melo [Oriental melon]
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                149   2e-44   Allium cepa
ref|NP_001141292.1|  uncharacterized protein LOC100273383               147   3e-44   
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               155   3e-44   Lilium hybrid division I
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                157   4e-44   Meconopsis henrici
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                161   4e-44   Cucumis sativus [cucumbers]
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                153   4e-44   Anthurium andraeanum [flamingo-lily]
gb|AHB18038.1|  flavonoid 3'-hydroxylase                                152   4e-44   Anthurium andraeanum [flamingo-lily]
gb|AFW72123.1|  red aleurone1                                           146   6e-44   
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               153   7e-44   Lilium hybrid division I
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              152   7e-44   Glycine soja [wild soybean]
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    152   7e-44   Glycine max [soybeans]
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               152   9e-44   Lilium hybrid division I
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          145   1e-43   Sorghum bicolor [broomcorn]
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                145   1e-43   Sorghum bicolor [broomcorn]
ref|XP_007155245.1|  hypothetical protein PHAVU_003G1855001g            151   1e-43   Phaseolus vulgaris [French bean]
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         151   1e-43   Glycine max [soybeans]
ref|XP_007155243.1|  hypothetical protein PHAVU_003G1855001g            151   2e-43   Phaseolus vulgaris [French bean]
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             149   2e-43   Pericallis cruenta
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    150   2e-43   
gb|AFP95893.1|  F3'H                                                    154   2e-43   Narcissus tazetta
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          145   2e-43   
ref|XP_007155244.1|  hypothetical protein PHAVU_003G1855001g            150   3e-43   Phaseolus vulgaris [French bean]
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            144   3e-43   
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         143   3e-43   Zea mays [maize]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                145   4e-43   Sorghum bicolor [broomcorn]
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                155   4e-43   Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                146   5e-43   Sorghum bicolor [broomcorn]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          146   6e-43   Sorghum bicolor [broomcorn]
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                146   6e-43   Sorghum bicolor [broomcorn]
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              148   6e-43   Pericallis cruenta
gb|ABQ81928.1|  flavonoid 3-hydroxylase                                 154   8e-43   Brassica rapa var. purpuraria [purple stem mustard]
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         142   9e-43   Oryza brachyantha
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                152   1e-42   Meconopsis racemosa
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                161   1e-42   Meconopsis wilsonii
gb|EMT05634.1|  Flavonoid 3'-monooxygenase                              140   2e-42   
ref|NP_001064338.1|  Os10g0320100                                       142   2e-42   
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                154   2e-42   Tulipa fosteriana
gb|AGL98409.1|  flavonoid 3'-hydroxylase                                154   3e-42   Tulipa fosteriana
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              148   5e-42   Iris x hollandica [Dutch iris]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                158   9e-42   Meconopsis zangnanensis
dbj|BAJ16337.1|  flavonoid 3' hydroxylase-like protein                  134   1e-41   Torenia fournieri [bluewings]
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                154   1e-41   Meconopsis betonicifolia [Himalayan blue-poppy]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         142   2e-41   Setaria italica
gb|AGG40645.1|  flavanone 3'-hydroxylase                                147   2e-41   Narcissus tazetta
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         142   3e-41   Brachypodium distachyon [annual false brome]
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                153   3e-41   Meconopsis simplicifolia
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                157   3e-41   Meconopsis paniculata
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          135   4e-41   
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         149   5e-41   
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                156   6e-41   Meconopsis gracilipes
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          144   6e-41   Sorghum bicolor [broomcorn]
gb|AEF33624.1|  flavonoid 3' hydroxylase                                142   8e-41   Zea mays [maize]
gb|EMT22073.1|  Flavonoid 3'-monooxygenase                              140   1e-40   
gb|EAY78004.1|  hypothetical protein OsI_33044                          149   2e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001064333.1|  Os10g0317900                                       149   2e-40   
dbj|BAJ95115.1|  predicted protein                                      140   2e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              142   3e-40   Indosasa hispida
gb|ABG76002.1|  flavonoid-3',5'-hydroxylase                             149   3e-40   Pericallis cruenta
gb|AII26680.1|  flavonoid 3'-hydroxylase                                142   3e-40   Indosasa hispida
ref|NP_001146311.1|  uncharacterized protein LOC100279887               144   6e-40   Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         144   6e-40   
gb|ACG38346.1|  flavonoid 3-monooxygenase                               144   6e-40   Zea mays [maize]
gb|AAS91654.1|  flavonoid 3'-hydroxylase                                130   1e-39   Triticum aestivum [Canadian hard winter wheat]
gb|EMS55165.1|  Flavonoid 3'-monooxygenase                              130   2e-39   Triticum urartu
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         141   3e-39   
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              140   3e-39   Glycine soja [wild soybean]
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              152   4e-39   Billardiera heterophylla
dbj|BAF96937.1|  flavonoid 3'-hydroxylase                               144   6e-39   Nicotiana tabacum [American tobacco]
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         136   5e-38   Brachypodium distachyon [annual false brome]
gb|EEE50732.1|  hypothetical protein OsJ_31043                          148   7e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ABR16821.1|  unknown                                                 137   8e-38   
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              143   3e-37   
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                146   4e-37   
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         134   4e-37   
dbj|BAJ98136.1|  predicted protein                                      129   7e-37   
dbj|BAJ93256.1|  predicted protein                                      140   2e-36   
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             142   3e-36   
gb|AIS35917.1|  flavonoid 3'-hydroxylase                                136   7e-36   
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    140   7e-36   
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             140   9e-36   
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             140   1e-35   
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            135   2e-35   
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            135   2e-35   
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            138   2e-35   
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            140   2e-35   
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             135   2e-35   
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             137   2e-35   
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            135   2e-35   
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            138   2e-35   
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        137   3e-35   
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             136   3e-35   
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            138   5e-35   
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            137   6e-35   
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             133   7e-35   
ref|XP_009788708.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           136   9e-35   
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            139   9e-35   
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            139   9e-35   
gb|EMS47586.1|  Flavonoid 3'-monooxygenase                              132   1e-34   
dbj|BAH89260.1|  putative flavonoid 3'5'-hydroxylase fragment           132   1e-34   
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         132   1e-34   
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              135   1e-34   
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             133   2e-34   
gb|KJB09328.1|  hypothetical protein B456_001G134900                    133   2e-34   
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              133   2e-34   
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            135   3e-34   
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            135   3e-34   
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            132   3e-34   
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              135   3e-34   
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             135   3e-34   
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     132   4e-34   
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            130   4e-34   
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             135   4e-34   
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     132   4e-34   
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   4e-34   
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   4e-34   
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             130   4e-34   
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            132   4e-34   
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            134   4e-34   
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            136   4e-34   
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             133   4e-34   
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            137   4e-34   
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            131   6e-34   
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            131   6e-34   
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            132   6e-34   
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            132   6e-34   
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            131   6e-34   
gb|KHN18347.1|  Flavonoid 3'-monooxygenase                              134   6e-34   
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            132   6e-34   
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       135   6e-34   
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              135   6e-34   
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            132   7e-34   
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    131   7e-34   
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             135   7e-34   
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            131   7e-34   
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            131   7e-34   
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             131   7e-34   
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             135   7e-34   
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             133   7e-34   
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   129   8e-34   
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      129   8e-34   
ref|XP_010932510.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        134   8e-34   
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    130   1e-33   
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             129   1e-33   
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            132   1e-33   
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    132   1e-33   
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      136   1e-33   
gb|AFG46916.1|  hypothetical protein 2_10188_01                         129   1e-33   
ref|XP_010905625.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      133   1e-33   
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      131   2e-33   
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             127   2e-33   
gb|AEW08451.1|  hypothetical protein 2_10188_01                         129   2e-33   
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            131   2e-33   
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            132   2e-33   
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   131   2e-33   
gb|AFG46917.1|  hypothetical protein 2_10188_01                         128   2e-33   
gb|AFG46926.1|  hypothetical protein 2_10188_01                         128   2e-33   
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           130   2e-33   
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            130   2e-33   
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            132   2e-33   
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            129   3e-33   
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    132   3e-33   
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             132   3e-33   
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    132   3e-33   
gb|AFG46915.1|  hypothetical protein 2_10188_01                         128   3e-33   
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              132   3e-33   
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           132   3e-33   
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   3e-33   
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            125   3e-33   
gb|ACH59623.1|  flavenoid 3-hydroxylase                                 127   4e-33   
gb|KHN23927.1|  Flavonoid 3',5'-hydroxylase 1                           134   4e-33   
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      131   4e-33   
gb|AEE65378.1|  flavonoid 3',5'-hydroxylase                             129   4e-33   
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             129   4e-33   
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             130   5e-33   
gb|ACH59632.1|  flavenoid 3-hydroxylase                                 127   5e-33   
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             133   6e-33   
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              129   6e-33   
gb|ACH59639.1|  flavenoid 3-hydroxylase                                 126   7e-33   
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             130   8e-33   
gb|AFG46930.1|  hypothetical protein 2_10188_01                         127   9e-33   
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            128   9e-33   
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            127   9e-33   
gb|AGC74041.1|  flavonoid-3',5'-hydroxylase                             134   1e-32   
gb|ACH59618.1|  flavenoid 3-hydroxylase                                 127   1e-32   
gb|AFG46914.1|  hypothetical protein 2_10188_01                         127   1e-32   
ref|XP_010651674.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      133   1e-32   
ref|XP_010932509.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      131   1e-32   
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             127   2e-32   
dbj|BAJ23912.1|  flavonoid 3',5'-hydroxylase                            127   2e-32   
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              133   2e-32   
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            130   2e-32   
ref|XP_007146137.1|  hypothetical protein PHAVU_006G015400g             123   2e-32   
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            129   2e-32   
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    133   2e-32   
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      127   2e-32   
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             130   2e-32   
ref|XP_002280662.2|  PREDICTED: flavonoid 3',5'-hydroxylase 2           128   2e-32   
dbj|BAJ16338.1|  flavonoid 3' 5'-hydroxylase-like protein               130   2e-32   
emb|CAN62887.1|  hypothetical protein VITISV_025543                     128   2e-32   
gb|ACH59617.1|  flavenoid 3-hydroxylase                                 126   3e-32   
ref|XP_003632212.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   3e-32   
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             132   3e-32   
gb|ACH59637.1|  flavenoid 3-hydroxylase                                 125   3e-32   
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            132   3e-32   
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           132   3e-32   
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                129   3e-32   
ref|NP_001268157.1|  flavonoid-3,5'-hydroxylase                         132   3e-32   
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             132   3e-32   
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        129   3e-32   
ref|NP_001268164.1|  uncharacterized protein LOC100261319               132   3e-32   
emb|CAN82588.1|  hypothetical protein VITISV_038260                     132   3e-32   
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             132   3e-32   
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           132   3e-32   
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           132   3e-32   
ref|XP_010922089.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   4e-32   
gb|EMT24088.1|  Flavonoid 3'-monooxygenase                              127   4e-32   
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    128   4e-32   
ref|XP_010651675.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      130   4e-32   
gb|ABC72066.1|  flavonoid 3',5'-hydroxylase                             132   5e-32   
gb|ABR17122.1|  unknown                                                 122   5e-32   
ref|XP_010922088.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   6e-32   
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             129   6e-32   
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             129   6e-32   
gb|ADQ12769.1|  cytochrome P450                                         122   6e-32   
emb|CAN81079.1|  hypothetical protein VITISV_007550                     131   7e-32   
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 127   7e-32   
ref|XP_008788485.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   7e-32   
gb|ABR16345.1|  unknown                                                 122   7e-32   
emb|CAN82604.1|  hypothetical protein VITISV_005589                     131   8e-32   
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             129   8e-32   
ref|XP_008789234.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like ...    131   8e-32   
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        121   8e-32   
gb|ABR16655.1|  unknown                                                 122   9e-32   
dbj|BAF49319.1|  flavonoid 3',5'-hydroxylase                            130   9e-32   
gb|ABC86841.1|  flavonoid 3',5'-hydroxylase                             131   9e-32   
gb|KEH33357.1|  flavonoid hydroxylase                                   121   9e-32   
dbj|BAF49320.1|  flavonoid 3',5'-hydroxylase                            130   9e-32   
dbj|BAF49322.1|  flavonoid 3',5'-hydroxylase                            130   9e-32   
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            123   1e-31   
ref|XP_010651527.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      131   1e-31   
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           131   1e-31   
gb|ACN40555.1|  unknown                                                 122   1e-31   
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      131   1e-31   
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             130   1e-31   
gb|ACH59624.1|  flavenoid 3-hydroxylase                                 124   1e-31   
emb|CAN61852.1|  hypothetical protein VITISV_020443                     131   1e-31   
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            125   1e-31   
gb|ACH59626.1|  flavenoid 3-hydroxylase                                 124   1e-31   
gb|ADQ12772.1|  cytochrome P450                                         122   1e-31   
gb|ADQ12775.1|  cytochrome P450                                         122   2e-31   
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    127   2e-31   
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             124   2e-31   
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           124   3e-31   
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             130   3e-31   
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             128   3e-31   
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             129   3e-31   
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             129   3e-31   
ref|XP_010922086.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        126   3e-31   
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             129   3e-31   
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             129   4e-31   
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   4e-31   
ref|XP_009383876.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      125   5e-31   
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           121   6e-31   
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             128   6e-31   
emb|CBI30128.3|  unnamed protein product                                121   6e-31   
emb|CAN60359.1|  hypothetical protein VITISV_034723                     127   7e-31   
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             128   8e-31   
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             127   1e-30   
emb|CAN80142.1|  hypothetical protein VITISV_038979                     120   1e-30   
gb|ACH59636.1|  flavenoid 3-hydroxylase                                 121   1e-30   
ref|XP_009386727.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      127   2e-30   
gb|ADQ12778.1|  cytochrome P450                                         122   2e-30   
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    122   4e-30   
ref|XP_009417895.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      119   1e-29   
gb|KDP25563.1|  hypothetical protein JCGZ_20719                         127   1e-29   
gb|AHI15953.1|  flavonoid 3',5'-hydroxylase                             124   2e-29   
gb|EPS62116.1|  hypothetical protein M569_12679                       85.5    4e-29   
ref|XP_011457549.1|  PREDICTED: geraniol 8-hydroxylase-like             118   4e-29   
gb|ABK24553.1|  unknown                                                 122   4e-29   
gb|ABI95365.1|  flavonoid 3',5'-hydroxylase                             118   5e-29   
gb|AGY46125.1|  flavonoid 3',5'-hydroxylase                             118   6e-29   
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               117   7e-29   
emb|CAC84484.1|  putative flavonoid 3'-hydroxylase                      116   1e-28   
ref|XP_002968761.1|  hypothetical protein SELMODRAFT_90326              117   1e-28   
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    114   1e-28   
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             117   2e-28   
ref|XP_002962614.1|  hypothetical protein SELMODRAFT_78428              121   2e-28   
ref|XP_002980472.1|  hypothetical protein SELMODRAFT_178226             121   2e-28   
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      118   2e-28   
ref|XP_008798387.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      115   2e-28   
gb|EYU31077.1|  hypothetical protein MIMGU_mgv1a024906mg                118   3e-28   



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   207 bits (526),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDI+G
Sbjct  379  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  476


 Score = 92.0 bits (227),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   206 bits (525),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDI+G
Sbjct  379  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  476


 Score = 92.0 bits (227),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   204 bits (520),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEF PHRFLPGGEKPNVDI+G
Sbjct  379  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFKPHRFLPGGEKPNVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  476


 Score = 90.5 bits (223),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL+NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLMNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   202 bits (515),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM AQ CEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDI+G
Sbjct  377  LPRMAAQSCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMVHLL+ATLVHAFDW
Sbjct  437  NDFEVIPFGAGRRICTGMSLGIRMVHLLIATLVHAFDW  474


 Score = 89.4 bits (220),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  471  AFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   201 bits (511),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM AQ CEINGYFIPKGATLLVNVWAIA DPNVWTNPLEFNPHRFLPGGEKPNVDI+G
Sbjct  378  LPRMAAQSCEINGYFIPKGATLLVNVWAIALDPNVWTNPLEFNPHRFLPGGEKPNVDIKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLL+ATLVHAFDW
Sbjct  438  NDFEVIPFGAGRRICSGMSLGIRMVHLLIATLVHAFDW  475


 Score = 89.0 bits (219),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  472  AFDWDLGNGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   204 bits (518),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRMGA+ CEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDI+G
Sbjct  382  LPRMGAESCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIKG  441

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  442  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  479


 Score = 85.9 bits (211),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F   LV+GQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPH+YTLN
Sbjct  476  AFDWGLVDGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHIYTLN  522



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   199 bits (507),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM AQ CEINGYFIPKGATLLVNVWAIA DPNVWTNPLEFNPHRFLPGG+KPNVDI+G
Sbjct  378  LPRMAAQSCEINGYFIPKGATLLVNVWAIALDPNVWTNPLEFNPHRFLPGGDKPNVDIKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLL+ATLVHAFDW
Sbjct  438  NDFEVIPFGAGRRICSGMSLGIRMVHLLIATLVHAFDW  475


 Score = 89.0 bits (219),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQRA+PLMLHPKPRLQPHLYTLN
Sbjct  472  AFDWDLGNGQSVETLNMEEAYGLTLQRAIPLMLHPKPRLQPHLYTLN  518



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   196 bits (498),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+GA+ CEINGYFIPKGATLLVNVWAIARDPN WTNPLEFNPHRFLPGGEK +VDI+G
Sbjct  379  LPRIGAESCEINGYFIPKGATLLVNVWAIARDPNAWTNPLEFNPHRFLPGGEKASVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLL+ATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLIATLVHAFDW  476


 Score = 92.4 bits (228),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   198 bits (503),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM AQ CEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNP+RFLPGGEKP+VDI+G
Sbjct  378  LPRMAAQSCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPNRFLPGGEKPSVDIKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMVHLL+ATLVHAFDW
Sbjct  438  NDFEVIPFGAGRRICTGMSLGIRMVHLLIATLVHAFDW  475


 Score = 89.7 bits (221),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  472  AFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   198 bits (504),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRMGA+ CEINGYFIPKGA LLVNVWAIARDPNVWTNPLEFNP RFLPGGEKPNVDI+G
Sbjct  377  LPRMGAESCEINGYFIPKGARLLVNVWAIARDPNVWTNPLEFNPDRFLPGGEKPNVDIKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  437  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  474


 Score = 88.2 bits (217),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSV+TLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  471  AFDWDLGNGQSVDTLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  517



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   194 bits (493),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+GA+ CEINGYFIPKGATLLVNVWAIARDPN WTNPL+FNP+RFLPGGEK NVDI+G
Sbjct  379  LPRIGAESCEINGYFIPKGATLLVNVWAIARDPNAWTNPLQFNPNRFLPGGEKTNVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLL+ATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLIATLVHAFDW  476


 Score = 91.7 bits (226),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DLVNGQSVETLNMEE+YGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLVNGQSVETLNMEESYGLTLQRAVPLMLHPKPRLQPHLYTLN  519



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   194 bits (494),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM AQ CEINGYFIPKGATL VNVWAIARDPNVWTNPLEFNP+RFLPGGEKP+VDI+G
Sbjct  378  LPRMAAQSCEINGYFIPKGATLPVNVWAIARDPNVWTNPLEFNPNRFLPGGEKPSVDIKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMVHLL+ATLVHAFDW
Sbjct  438  NDFEVIPFGAGRRICTGMSLGIRMVHLLIATLVHAFDW  475


 Score = 89.7 bits (221),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN
Sbjct  472  AFDWDLGNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  518



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   194 bits (492),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+GA+ C+INGYFIPKGATLLVNVWAIARDPN WTNPLEFNP RFLPGGEK NVDI+G
Sbjct  379  LPRIGAESCKINGYFIPKGATLLVNVWAIARDPNAWTNPLEFNPRRFLPGGEKTNVDIKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLGIRMVHLLVATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICSGMSLGIRMVHLLVATLVHAFDW  476


 Score = 89.4 bits (220),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
             F  DL NGQSVETLNMEEAYGLTLQR VPLMLHPKPRLQPHLYTLN
Sbjct  473  AFDWDLANGQSVETLNMEEAYGLTLQRVVPLMLHPKPRLQPHLYTLN  519



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   191 bits (485),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEINGYFIPKGATLLVNVWAIARDPNVWT+PLEFNP RFLPGGEKP+VDI+G
Sbjct  382  LPRMASENCEINGYFIPKGATLLVNVWAIARDPNVWTDPLEFNPARFLPGGEKPSVDIKG  441

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLG+RMVHLL+ATL+H+FDW
Sbjct  442  NDFEVIPFGAGRRICSGMSLGLRMVHLLIATLIHSFDW  479


 Score = 82.0 bits (201),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  DL +GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPHLY+
Sbjct  476  SFDWDLASGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHLYS  520



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   191 bits (485),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEINGYFIPKGATLLVNVWAIARDPNVWT+PLEFNP RFLPGGEKP+VDI+G
Sbjct  382  LPRMASENCEINGYFIPKGATLLVNVWAIARDPNVWTDPLEFNPARFLPGGEKPSVDIKG  441

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRICS MSLG+RMVHLL+ATL+H+FDW
Sbjct  442  NDFEVIPFGAGRRICSGMSLGLRMVHLLIATLIHSFDW  479


 Score = 81.3 bits (199),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  DLV+GQS+ETLNMEEAYGLTLQRAVPLM+HPKPRLQPH Y+
Sbjct  476  SFDWDLVSGQSIETLNMEEAYGLTLQRAVPLMVHPKPRLQPHQYS  520



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   182 bits (461),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEINGYFIPKG+TLLVNVWAIARDP++W +PLEF P RFLPGGEKPNVD+RG
Sbjct  374  LPRMATENCEINGYFIPKGSTLLVNVWAIARDPDIWADPLEFRPERFLPGGEKPNVDVRG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL+HAFDW
Sbjct  434  NDFEVIPFGAGRRICAGMSLGVRMVQLLTATLIHAFDW  471


 Score = 70.1 bits (170),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  468  AFDWDLPNGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   182 bits (461),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEINGYFIPKG+TLLVNVWAIARDP++W +PLEF P RFLPGGEKPNVD+RG
Sbjct  374  LPRMATENCEINGYFIPKGSTLLVNVWAIARDPDIWADPLEFRPERFLPGGEKPNVDVRG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL+HAFDW
Sbjct  434  NDFEVIPFGAGRRICAGMSLGVRMVQLLTATLIHAFDW  471


 Score = 70.1 bits (170),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL NGQ  E LNMEEAYGLTLQRA PLM+HPKPRL P++Y
Sbjct  468  AFDWDLPNGQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   180 bits (457),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  CEINGYFIPKG+TLLVNVWAIARDP+ W  PLEF P RFLPGGEKPN D+RG
Sbjct  379  LPRMASDSCEINGYFIPKGSTLLVNVWAIARDPDAWAEPLEFRPERFLPGGEKPNADVRG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  439  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  476


 Score = 70.1 bits (170),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +GQS E LNM+EAYGLTLQRA PLM+HP PRL PH+Y
Sbjct  473  AFDWDLADGQSTEKLNMDEAYGLTLQRAAPLMVHPWPRLAPHVY  516



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   179 bits (453),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  CEINGYFIPKG+TLLVNVWAIARDP+ W  PLEF P RFLPGGEKPNVD+RG
Sbjct  379  LPRMASDSCEINGYFIPKGSTLLVNVWAIARDPDAWAEPLEFRPERFLPGGEKPNVDVRG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAF+W
Sbjct  439  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFNW  476


 Score = 69.3 bits (168),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +GQS E L M+EAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  473  AFNWDLADGQSAEKLKMDEAYGLTLQRAAPLMVHPRPRLAPHVY  516



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   177 bits (449),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGYFIPKG+TLLVNVWAIARDP++W +PLEF P RFLPGGEKPNVD+RG
Sbjct  313  LPRIAAENCEINGYFIPKGSTLLVNVWAIARDPDMWADPLEFRPGRFLPGGEKPNVDVRG  372

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL A+L+H FDW
Sbjct  373  NDFEVIPFGAGRRICAGMSLGLRMVQLLTASLIHGFDW  410


 Score = 69.3 bits (168),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  DL NGQ  E LNMEEAYGLTLQRA PLM+HP+PRL+PH Y
Sbjct  408  FDWDLPNGQVAEKLNMEEAYGLTLQRASPLMVHPRPRLKPHSY  450



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   174 bits (440),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEINGYFIPKG+TLLVNVWAIARDP++W+NPLEF P RFLPGGE+P VD++G
Sbjct  372  LPRMADESCEINGYFIPKGSTLLVNVWAIARDPDLWSNPLEFQPARFLPGGERPVVDVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRR+C+ MSLGIRMV LL+ATL+HAFD+
Sbjct  432  NDFELIPFGAGRRVCAGMSLGIRMVQLLIATLIHAFDF  469


 Score = 70.1 bits (170),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +GQ  ETL+MEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  466  AFDFDLADGQLAETLSMEEAYGLTLQRAEPLMVHPKPRLAPHVY  509



>gb|EYU36856.1| hypothetical protein MIMGU_mgv1a009393mg [Erythranthe guttata]
Length=343

 Score =   174 bits (441),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CE+NGYFIPKG+TLLVNVWAIARDP+ W++PLEF P RFL GGEKPNVD+RG
Sbjct  203  LPRISDKSCEVNGYFIPKGSTLLVNVWAIARDPDAWSDPLEFKPERFLMGGEKPNVDVRG  262

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL+HAFD+
Sbjct  263  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDF  300


 Score = 67.8 bits (164),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  +L NGQ  ETLNMEEAYGLTLQR  PL +HPKPRL PHLY 
Sbjct  297  AFDFELANGQLPETLNMEEAYGLTLQRDEPLSVHPKPRLAPHLYN  341



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   174 bits (441),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+NGY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPN +++G
Sbjct  372  LPRIASESCEVNGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRPSRFLPGGEKPNANVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL+A+LVHAFDW
Sbjct  432  NDFEIIPFGAGRRICAGMSLGLRMVQLLIASLVHAFDW  469


 Score = 66.6 bits (161),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNMEEAYGLTLQRA PLM+HP PRL PHLY
Sbjct  466  AFDWELANGLDPEKLNMEEAYGLTLQRAAPLMVHPSPRLAPHLY  509



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   172 bits (437),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CE+NGY IPKG+TLLVNVWAIARDPNVW  PLEF P RFL GGEKPNVD+RG
Sbjct  381  LPRIAHESCEVNGYLIPKGSTLLVNVWAIARDPNVWDEPLEFRPERFLKGGEKPNVDVRG  440

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLGIRMV LL ATL+HAFD+
Sbjct  441  NDFELIPFGAGRRICAGMSLGIRMVQLLTATLIHAFDF  478


 Score = 67.8 bits (164),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +GQ  E+LNMEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  475  AFDFDLADGQLPESLNMEEAYGLTLQRADPLVVHPKPRLAPHVY  518



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   174 bits (442),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CE++GY+IPKG+TLLVNVWAIARDP +WTNPLEF P RFLPGGEKP+ DI+G
Sbjct  378  LPRMASESCEVDGYYIPKGSTLLVNVWAIARDPKMWTNPLEFRPSRFLPGGEKPDADIKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  438  NDFEVIPFGAGRRICAGMSLGMRMVQLLIATLVQTFDW  475


 Score = 65.1 bits (157),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  473  FDWELANGLDPEKLNMEEAYGLTLQRAEPLMVHPRPRLSPHVY  515



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   171 bits (434),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  Q CE+NGYFIPKG+TLLVNVWAIARDPN W  PLEF P RFL GGE+PNVD+RG
Sbjct  370  LPRIAHQSCEVNGYFIPKGSTLLVNVWAIARDPNAWDEPLEFRPERFLKGGERPNVDVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDF+VIPFGAGRRIC+ MSLGIRMV LL+A+L+HAF++
Sbjct  430  NDFQVIPFGAGRRICAGMSLGIRMVQLLIASLIHAFNF  467


 Score = 68.2 bits (165),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +GQ  E LNMEEAYGLTLQRA PL+LHPKPRL PH+Y
Sbjct  464  AFNFDLADGQLPERLNMEEAYGLTLQRADPLVLHPKPRLAPHVY  507



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   183 bits (464),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +Q CEINGY+IPKG+TLLVNVWAIARDPNVW  PLEF P RFLPGGEKPN+DI+G
Sbjct  370  LPRMASQSCEINGYYIPKGSTLLVNVWAIARDPNVWAEPLEFRPDRFLPGGEKPNIDIKG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  467


 Score = 56.2 bits (134),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ  E L MEEAYGLTLQRAVPL+L+P+PRL  H+Y
Sbjct  464  AFDWGLPEGQIPEKLQMEEAYGLTLQRAVPLVLYPQPRLSSHVY  507



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   179 bits (454),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGYFIPKG+TLLVNVWAIARDP  W NPLEF P RFLPGGE+PN DIRG
Sbjct  378  LPRMAAESCEINGYFIPKGSTLLVNVWAIARDPEAWDNPLEFKPERFLPGGERPNADIRG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVH+F+W
Sbjct  438  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHSFNW  475


 Score = 59.7 bits (143),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  G+  E LNM+EAYGLTLQRA PLM+HP+PR   H+Y
Sbjct  472  SFNWDLPEGKLAEKLNMDEAYGLTLQRAEPLMVHPRPRFGAHVY  515



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   177 bits (450),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++GCEINGY IPKG+TLLVNVW+IARDP++W +PLEF P RFLPGGEKPNVD+RG
Sbjct  380  LPRMASEGCEINGYSIPKGSTLLVNVWSIARDPSIWADPLEFRPSRFLPGGEKPNVDVRG  439

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVH+F+W
Sbjct  440  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHSFNW  477


 Score = 61.2 bits (147),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  DL+NG S + L+MEEAYGLTLQRA PL++HPKPRL   +Y 
Sbjct  474  SFNWDLLNGMSPDKLDMEEAYGLTLQRASPLIVHPKPRLASSMYV  518



>emb|CBI15132.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   177 bits (450),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  249  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  308

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  309  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  346


 Score = 61.2 bits (147),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  343  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  386



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   177 bits (448),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLL+NVWAIARDPN W +PLEF P RFLPGGEKP VD+RG
Sbjct  373  LPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LGIRMV L++ATL+HAF+W
Sbjct  433  NDFEVIPFGAGRRICAGMNLGIRMVQLMIATLIHAFNW  470


 Score = 61.2 bits (147),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DLV+GQ  E LNMEEAYGLTLQRA PL++HP+PRL+   Y
Sbjct  467  AFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHPRPRLEAQAY  510



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   174 bits (442),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGYFIPKG+TLLVNVWAIARDPNVW +PLEF P RF+PGGEKPNVD++G
Sbjct  320  LPRIAEKSCEINGYFIPKGSTLLVNVWAIARDPNVWADPLEFRPERFMPGGEKPNVDVKG  379

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLGIRMV LL A L+H FD+
Sbjct  380  NDFELIPFGAGRRICAGMSLGIRMVQLLTANLIHGFDF  417


 Score = 63.5 bits (153),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG S + L+MEEAYGLTLQRA PL++HPKPRL PH+Y
Sbjct  415  FDFELGNGLSAQQLSMEEAYGLTLQRAEPLVVHPKPRLAPHVY  457



>dbj|BAH89259.1| putative flavonoid 3'-hydroxylase [Diospyros kaki]
Length=416

 Score =   177 bits (449),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGYFIPKG+TLLVNVWAIARDP  W +PLEF P RFLPGGE+PN D+RG
Sbjct  277  LPRMAAESCEINGYFIPKGSTLLVNVWAIARDPEAWADPLEFRPERFLPGGERPNADVRG  336

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATL+HAFDW
Sbjct  337  NDFEVIPFGAGRRICAGMSLGLRMVQLVTATLIHAFDW  374


 Score = 60.1 bits (144),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  G+  E LNM+EAYGLTLQRAVPLM+HP+PRL  H+Y
Sbjct  371  AFDWALPEGEEPEKLNMDEAYGLTLQRAVPLMVHPRPRLAGHVY  414



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   176 bits (446),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 60.8 bits (146),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   176 bits (446),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 60.8 bits (146),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  507



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   177 bits (448),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W +PLEF P RFLPGGEKP+VD+RG
Sbjct  368  LPRMASENCEINGFHIPKGATLLVNVWAISRDPEQWKDPLEFRPERFLPGGEKPHVDVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  465


 Score = 59.7 bits (143),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  462  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   177 bits (448),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEINGY IPKGATLLVNVWAIARDP+ W +PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMASESCEINGYHIPKGATLLVNVWAIARDPDEWKDPLEFRPERFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVQLLAATLVHAFDW  467


 Score = 59.3 bits (142),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G   E LNMEEA+GLTLQRA PLM+HP+PRL P  Y
Sbjct  464  AFDWELADGLMPEKLNMEEAFGLTLQRAAPLMVHPRPRLSPRAY  507



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 66.2 bits (160),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   177 bits (450),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFKPSRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATL+HAFDW
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLIHAFDW  467


 Score = 58.2 bits (139),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +GQ  E LNM+EAYGLTLQRA PLM+HP+ RL P  +
Sbjct  464  AFDWELADGQVPEKLNMDEAYGLTLQRAAPLMVHPRSRLSPQAF  507



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 66.6 bits (161),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 66.2 bits (160),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   171 bits (433),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ +  CE++GY+IPKG+TLLVNVWAI+RDP +W+NPLEF P RFLPGGEKP+ D++G
Sbjct  368  LPRIASDTCEVDGYYIPKGSTLLVNVWAISRDPKIWSNPLEFQPTRFLPGGEKPDADVKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG++MV LL ATLVHAFDW
Sbjct  428  NDFELIPFGAGRRICAGMSLGLKMVQLLTATLVHAFDW  465


 Score = 65.1 bits (157),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   + LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  462  AFDWELANGLDPDKLNMEEAYGLTLQRATPLMVHPRPRLAPHVY  505



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 66.2 bits (160),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   175 bits (444),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  332  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPNRFLPGGERPNADVRG  391

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  392  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  429


 Score = 60.5 bits (145),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  426  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPRPRLSPQVF  469



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 66.2 bits (160),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANGLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AGG18103.1| flavonoid 3'-hydroxylase, partial [Prunus persica]
Length=264

 Score =   176 bits (445),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEIN + IPKGATLLVNVWAI+RDP  W  PLEF P RFLPGGEKP+VD+RG
Sbjct  122  LPRMASESCEINSFHIPKGATLLVNVWAISRDPEQWKEPLEFRPERFLPGGEKPHVDVRG  181

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  182  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  219


 Score = 59.7 bits (143),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  216  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|AJO67966.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=208

 Score =   176 bits (446),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W +PLEF P RFLPGGEKP+VD+RG
Sbjct  66   LPRMASENCEINGFHIPKGATLLVNVWAISRDPEQWKDPLEFRPERFLPGGEKPHVDVRG  125

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  126  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  163


 Score = 59.3 bits (142),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  160  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  203



>gb|AJO67972.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=209

 Score =   176 bits (445),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W +PLEF P RFLPGGEKP+VD+RG
Sbjct  67   LPRMASENCEINGFHIPKGATLLVNVWAISRDPEQWKDPLEFRPERFLPGGEKPHVDVRG  126

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  127  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  164


 Score = 59.3 bits (142),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  161  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  204



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   175 bits (444),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPSRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 59.7 bits (143),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP+PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAPPLMVHPRPRLSPQVF  507



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   175 bits (444),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGYFIPKG+T+LVNVWAIARDP++W  PLEF P RFLPGGEK NVD++G
Sbjct  376  LPRMAAESCEINGYFIPKGSTVLVNVWAIARDPDIWAEPLEFRPQRFLPGGEKANVDVKG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRR+C+ +SLG+RMV L+ ATLVH+FDW
Sbjct  436  NDFEVIPFGAGRRVCAGLSLGLRMVQLVTATLVHSFDW  473


 Score = 59.7 bits (143),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +GQ  E LNMEE YGLTLQRA PL +HP+PRL  H+Y
Sbjct  470  SFDWELADGQKPEELNMEEGYGLTLQRAKPLKVHPRPRLSEHVY  513



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   173 bits (438),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKG+TLLVNVWAIARDP +WTNPL+F P RF+PGGEKPN D++G
Sbjct  372  LPRIASESCEINGYNIPKGSTLLVNVWAIARDPKMWTNPLQFQPARFMPGGEKPNADVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLV AFDW
Sbjct  432  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVQAFDW  469


 Score = 62.0 bits (149),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG     LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  466  AFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  509



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   176 bits (446),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 58.9 bits (141),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   174 bits (440),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W +PLEF P RFLPGGEKP VD++G
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPERFLPGGEKPKVDVKG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE IPFGAGRRIC+ MSLGIRMV L+ ATL+H+F+W
Sbjct  436  NDFEAIPFGAGRRICAGMSLGIRMVQLMTATLIHSFNW  473


 Score = 61.2 bits (147),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
             F  DL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y +
Sbjct  470  SFNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVYGI  515



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   174 bits (440),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W +PLEF P RFLPGGEKP VD++G
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPERFLPGGEKPKVDVKG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE IPFGAGRRIC+ MSLGIRMV L+ ATL+H+F+W
Sbjct  436  NDFEAIPFGAGRRICAGMSLGIRMVQLMTATLIHSFNW  473


 Score = 60.8 bits (146),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  470  SFNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  513



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   176 bits (445),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPSRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 58.9 bits (141),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   176 bits (445),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  C+INGY IPKGATLLVNVWAI+RDPN W NPLEF P RFLPGGE+PN D+RG
Sbjct  373  LPRMASDSCDINGYHIPKGATLLVNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HAFDW
Sbjct  433  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAFDW  470


 Score = 58.9 bits (141),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  467  AFDWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   176 bits (445),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPSRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 58.9 bits (141),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM+HP PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF  507



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   176 bits (445),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPSRFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  467


 Score = 58.5 bits (140),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNM+EAYGLTLQRA PLM++P+PRL P ++
Sbjct  464  AFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVYPRPRLSPQVF  507



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   174 bits (440),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEINGY IP+G+TLLVNVWAIARDP  W +PLEF P RFLPGGE+PN D+RG
Sbjct  385  LPRMASESCEINGYSIPEGSTLLVNVWAIARDPKAWADPLEFRPERFLPGGERPNADVRG  444

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV LL ATLVHAFDW
Sbjct  445  NDFEVIPFGAGRRICAGLSLGLRMVQLLTATLVHAFDW  482


 Score = 60.1 bits (144),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +GQ    +NM+EAYGLTLQRAVPLM+HP PRL P  Y
Sbjct  479  AFDWTLADGQEAAKINMDEAYGLTLQRAVPLMVHPSPRLSPVAY  522



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   176 bits (447),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +Q CEINGY+IPKG+TLLVNVWAIARDP+VW  PLEF P RFL GGEKPNVDI+G
Sbjct  375  LPRMASQSCEINGYYIPKGSTLLVNVWAIARDPDVWAEPLEFRPDRFLLGGEKPNVDIKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  435  NNFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  472


 Score = 57.8 bits (138),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  414  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  477  GQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   174 bits (442),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEIN + IPKGATLLVNVWAI+RDP  W  PLEF P RFLPGGEKP+VD+RG
Sbjct  368  LPRMASESCEINSFHIPKGATLLVNVWAISRDPEQWKEPLEFRPERFLPGGEKPHVDVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  465


 Score = 59.3 bits (142),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  462  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   171 bits (433),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ +  CE++GY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD++G
Sbjct  368  LPRIASDSCEVDGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  465


 Score = 62.8 bits (151),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELASGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   172 bits (436),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CE+ GY+IPKG+TLLVNVWAI+RDP +W +PLEF P RFLPGGEKPN DI+G
Sbjct  370  LPRMALESCEVGGYYIPKGSTLLVNVWAISRDPKIWADPLEFQPTRFLPGGEKPNTDIKG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLG+RMV LL ATL+HAFDW
Sbjct  430  NDFEVIPFGAGRRICVGMSLGLRMVQLLTATLIHAFDW  467


 Score = 61.2 bits (147),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G + + LNMEEAYGLTLQRA PL++HP+PRL PH+Y
Sbjct  464  AFDWELADGLNPKKLNMEEAYGLTLQRAAPLVVHPRPRLAPHVY  507



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   174 bits (441),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W +PL F P RFLPGGEKP+VD+RG
Sbjct  368  LPRMASESCEINGFHIPKGATLLVNVWAISRDPEQWKDPLVFRPERFLPGGEKPHVDVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  465


 Score = 59.3 bits (142),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  462  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   167 bits (422),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+NGY IPKG+TLLVNVWAIARDP +W+ PLEF P RFLPGGEKP+ D++G
Sbjct  374  LPRIASESCEVNGYHIPKGSTLLVNVWAIARDPKMWSEPLEFRPARFLPGGEKPDADVKG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRR C+ MSLG+RMV LLVATLV  FDW
Sbjct  434  NDFEVIPFGAGRRSCAGMSLGLRMVQLLVATLVQTFDW  471


 Score = 66.6 bits (161),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L NG   E LNMEEAYGLTLQRA PL++HPKPRL PH+Y  N
Sbjct  469  FDWELANGLKPEKLNMEEAYGLTLQRAAPLLVHPKPRLAPHVYGSN  514



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   169 bits (429),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PRM ++GCEINGY+IPKG+TLLVNVWAIARDP +W  PL+F P RFLPG +  NVD+RG
Sbjct  372  VPRMASEGCEINGYYIPKGSTLLVNVWAIARDPAIWPEPLQFRPERFLPGSKHANVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMVHLL ATLVHA DW
Sbjct  432  NDFEVIPFGAGRRICAGMNLGLRMVHLLTATLVHALDW  469


 Score = 63.9 bits (154),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  423  LVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            L  GQ  E LNMEEAYGLTLQRAVPL +HP+PRL PH+Y
Sbjct  471  LQEGQMAEKLNMEEAYGLTLQRAVPLTVHPRPRLAPHVY  509



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   176 bits (445),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +Q CEINGY+IPKG+TLLVNVWAIARDP+VW  PLEF P RFL GGEKPNVDI+G
Sbjct  375  LPRMASQSCEINGYYIPKGSTLLVNVWAIARDPDVWAEPLEFRPDRFLLGGEKPNVDIKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEV+PFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  435  NNFEVVPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  472


 Score = 57.8 bits (138),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  414  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            GQ  E L MEEAYGLTLQRAVPL+LHP+PRL  H+Y
Sbjct  477  GQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   174 bits (441),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  C+INGY IPKGATLLVNVWAI+RDPN W NPLEF P RFLPGGE+PN D+RG
Sbjct  373  LPRMASDSCDINGYHIPKGATLLVNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HAF+W
Sbjct  433  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAFEW  470


 Score = 58.9 bits (141),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  467  AFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   174 bits (441),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  C+INGY IPKGATLLVNVWAI+RDPN W NPLEF P RFLPGGE+PN D+RG
Sbjct  373  LPRMASDSCDINGYHIPKGATLLVNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HAF+W
Sbjct  433  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAFEW  470


 Score = 58.9 bits (141),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  467  AFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   174 bits (441),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  C+INGY IPKGATLLVNVWAI+RDPN W NPLEF P RFLPGGE+PN D+RG
Sbjct  373  LPRMASDSCDINGYHIPKGATLLVNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HAF+W
Sbjct  433  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAFEW  470


 Score = 58.9 bits (141),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L +G   E L+MEEAYGLTLQRA PLM+HP+PRL  H Y
Sbjct  467  AFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   174 bits (440),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEING+ IPKG+TLLVNVWAIARDP +WTNPLEF P RFLP GEK NVD++G
Sbjct  319  LPRMATESCEINGFHIPKGSTLLVNVWAIARDPKIWTNPLEFQPERFLPTGEKSNVDVKG  378

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ M+LG+RMV+LL+ATL+HAFDW
Sbjct  379  NDFELIPFGAGRRICAGMNLGLRMVNLLIATLIHAFDW  416


 Score = 58.9 bits (141),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNMEEAYGLTLQR VPL++ P+PRL P++Y
Sbjct  413  AFDWELENGLKAEELNMEEAYGLTLQRLVPLIVRPRPRLSPNVY  456



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   173 bits (438),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKG+TLLVNVWAIARDP +WTNPL+F P RF+PGGEKPN D++G
Sbjct  372  LPRIASESCEINGYNIPKGSTLLVNVWAIARDPKMWTNPLQFQPARFMPGGEKPNADVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLV AFDW
Sbjct  432  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVQAFDW  469


 Score = 59.7 bits (143),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG     LNMEEAYGLTLQRA PL++HP+PRL P++Y
Sbjct  466  AFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLAPYVY  509



>gb|AGG18092.1| flavonoid 3'-hydroxylase, partial [Prunus armeniaca]
Length=264

 Score =   173 bits (438),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEIN + IPKGATLLVNVWAI+RDP  W +PL F P RFLPGGEKP+VD+RG
Sbjct  122  LPRMASESCEINSFHIPKGATLLVNVWAISRDPEQWKDPLVFRPERFLPGGEKPHVDVRG  181

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  182  NDFEVIPFGAGRRICAGMSLGLRMVHLMAATLVHAFDW  219


 Score = 59.7 bits (143),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  216  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  259



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   169 bits (429),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ +  CE++GY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD +G
Sbjct  368  LPRIASDSCEVDGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDAKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  465


 Score = 62.8 bits (151),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L +G   E LNM EAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELASGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLAPHVY  505



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   169 bits (429),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKG+TLLVNVWAIARDP +WT PLEF P RFLP GEKPN D++G
Sbjct  372  LPRIASESCEINGYNIPKGSTLLVNVWAIARDPKMWTEPLEFRPSRFLPDGEKPNADVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL+ AFDW
Sbjct  432  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLIQAFDW  469


 Score = 62.8 bits (151),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG     LNMEEAYGLTLQRA PLM+HP+PRL PH+Y
Sbjct  466  AFDWELANGLEPRNLNMEEAYGLTLQRAQPLMVHPRPRLAPHVY  509



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   178 bits (451),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W NPLEF P RFLPGGEKP VD+RG
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWVNPLEFRPERFLPGGEKPKVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LGIRMV L+ ATL+HAF+W
Sbjct  436  NDFEVIPFGAGRRICAGMNLGIRMVQLITATLIHAFNW  473


 Score = 54.3 bits (129),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  470  AFNWDLPIGQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  513



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   178 bits (451),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W NPLEF P RFLPGGEKP VD+RG
Sbjct  375  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWINPLEFRPERFLPGGEKPKVDVRG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LGIRMV L+ ATL+HAF+W
Sbjct  435  NDFEVIPFGAGRRICAGMNLGIRMVQLITATLIHAFNW  472


 Score = 54.3 bits (129),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  469  AFNWDLPIGQSSEKLNMEEAFGLTLQRADPLVVHPGLRLEAQAY  512



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   177 bits (450),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.7 bits (130),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   177 bits (449),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.7 bits (130),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   168 bits (425),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI  Y IPKGATLLVNVWAI+RDPN W NPLEF P RFLPGGEK +VDI+G
Sbjct  365  LPRVATESCEIFNYHIPKGATLLVNVWAISRDPNEWANPLEFKPERFLPGGEKFDVDIKG  424

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGI+MV LL ATLVHAFDW
Sbjct  425  NDFEVIPFGAGRRICAGMSLGIKMVQLLTATLVHAFDW  462


 Score = 63.9 bits (154),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  +L NG + E LNM EAYGLTLQR VPL++HP+PRL PHLY+
Sbjct  459  AFDWELENGCNPEKLNMAEAYGLTLQREVPLLVHPRPRLSPHLYS  503



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   171 bits (433),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI+GYFIPKG+TLLVNVWAIARDPN W +PLEF P RFLPGGEKP VD++G
Sbjct  375  LPRIASESCEIDGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPERFLPGGEKPKVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVI FGAGRRIC+ MSLGIRMV L+ ATL+H+F+W
Sbjct  435  NDFEVITFGAGRRICAGMSLGIRMVQLMTATLIHSFNW  472


 Score = 60.8 bits (146),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  DL NGQ  E LNMEEAYGLTLQRA PL++HP+PRL+  +Y
Sbjct  470  FNWDLPNGQLPEKLNMEEAYGLTLQRADPLVVHPRPRLEAQVY  512



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   177 bits (449),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.7 bits (130),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   176 bits (445),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVW IARDPN W NPLEF P RFLPGGEKP VD+RG
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWVIARDPNEWVNPLEFRPERFLPGGEKPKVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LGIRMV L+ ATL+HAF+W
Sbjct  436  NDFEVIPFGAGRRICAGMNLGIRMVQLMTATLIHAFNW  473


 Score = 55.8 bits (133),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQS E LNME+A+GLTL RA PL++HP+PRL+   Y
Sbjct  470  AFNWDLPIGQSSEKLNMEDAFGLTLHRADPLVVHPRPRLEAQAY  513



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   177 bits (448),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.3 bits (129),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   167 bits (422),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  Q CEI  Y IPKGATLLVNVWAI+RDP  W+NPLEF P RFLPGGEK +VD+RG
Sbjct  372  LPRVATQSCEIFNYHIPKGATLLVNVWAISRDPKEWSNPLEFKPERFLPGGEKFDVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HA+DW
Sbjct  432  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAYDW  469


 Score = 64.7 bits (156),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            +L NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  470  ELENGVSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   175 bits (443),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A  CEINGY+IPK  TLLVNVWAIARDPNVW++PLEF P RFLPGGE+PN D++G
Sbjct  373  LPRISADPCEINGYYIPKNTTLLVNVWAIARDPNVWSSPLEFQPERFLPGGERPNADVKG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVH FDW
Sbjct  433  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHGFDW  470


 Score = 56.2 bits (134),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            F   L +G   E LNMEEAYGLTLQR +PL +HP PRL  H Y L
Sbjct  468  FDWKLADGLMSEKLNMEEAYGLTLQRKIPLAVHPLPRLSAHAYNL  512



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   170 bits (431),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEI GY IPKG+T+LVNVWAIARDP+VWT PLEF P RFLPGG+K +VD++G
Sbjct  380  LPRIAAESCEIGGYHIPKGSTVLVNVWAIARDPDVWTKPLEFRPERFLPGGDKADVDVKG  439

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL ATL+HAFDW
Sbjct  440  NDFELIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDW  477


 Score = 60.8 bits (146),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL +G   E LNM+EAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  474  AFDWDLADGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVY  517



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   168 bits (425),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE +GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKP  D+RG
Sbjct  368  LPRISSESCEADGYYIPKGSTLLVNVWAIARDPKMWADPLEFRPSRFLPGGEKPGADVRG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL+ATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICAGMSLGLRMVQLLIATLVQTFDW  465


 Score = 63.2 bits (152),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L N    E LNMEEAYGLTLQRA PLM+HPKPRL PH+Y
Sbjct  463  FDWELANRLEPEMLNMEEAYGLTLQRAAPLMVHPKPRLAPHVY  505



>gb|AJF48886.1| flavonoid 3'-hydroxylase, partial [Paeonia suffruticosa]
Length=252

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +Q CEINGY+IPKG+TLLVNVWAIARDP+VW  PLEF P RFL GGEKPNVDI+G
Sbjct  134  LPRMASQSCEINGYYIPKGSTLLVNVWAIARDPDVWAEPLEFRPDRFLLGGEKPNVDIKG  193

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  194  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  231



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   171 bits (433),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEI GY IPKG T+LVNVWAIARDP+VWT PLEF P RFLPGGEK +VD++G
Sbjct  380  LPRIAAESCEIGGYHIPKGTTVLVNVWAIARDPDVWTKPLEFRPERFLPGGEKADVDVKG  439

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL ATL+HAFDW
Sbjct  440  NDFELIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDW  477


 Score = 60.1 bits (144),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G   E LNM+EAYGLTLQRAVPLM+HP+PRL P  Y
Sbjct  474  AFDWQLADGLVPEKLNMDEAYGLTLQRAVPLMVHPRPRLSPKAY  517



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   172 bits (435),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR+GA+GCEINGY IPKGA LLVNVWAIARDP+ W  PL F P RFLPGGEKPN D+RG
Sbjct  373  IPRVGAEGCEINGYHIPKGAKLLVNVWAIARDPDAWAEPLVFRPERFLPGGEKPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC  MS+G+RMV L+ ATL HAFDW
Sbjct  433  NDFEIIPFGAGRRICIGMSMGLRMVQLMTATLAHAFDW  470


 Score = 59.3 bits (142),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  G S E LNM+EAYGLTLQRA PL +HPKPRL  H+Y
Sbjct  467  AFDWELAGGVSPEKLNMDEAYGLTLQRAEPLSVHPKPRLASHVY  510



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   176 bits (447),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLVTATLVHAFDW  468


 Score = 54.3 bits (129),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTRLAPHAY  507



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   166 bits (419),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY IPKG+TLLVNVWAIARDPNVW +PLEF P RF+  G+KPN D++G
Sbjct  378  LPRVAQESCEINGYLIPKGSTLLVNVWAIARDPNVWESPLEFQPQRFMADGQKPNADVKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDF+VIPFGAGRRIC+ M LGIRMV LL ATL+HAFD+
Sbjct  438  NDFDVIPFGAGRRICAGMGLGIRMVQLLTATLIHAFDF  475


 Score = 65.1 bits (157),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  472  AFDFELANGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   172 bits (437),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI+GYFIPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD++G
Sbjct  368  LPRIASESCEIDGYFIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  428  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  465


 Score = 57.8 bits (138),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNM EA+GLTLQRA PL+++PKPRL PH+Y
Sbjct  463  FDWELANGVLPEKLNMNEAFGLTLQRAEPLIVYPKPRLAPHVY  505



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   166 bits (419),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+    CEI  Y IPKGATLLVNVWAI+RDP  WTNPLEF P RFLPGGEK +VDIRG
Sbjct  372  LPRVATNSCEIFNYHIPKGATLLVNVWAISRDPKEWTNPLEFKPERFLPGGEKFDVDIRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATL HA+DW
Sbjct  432  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLAHAYDW  469


 Score = 64.7 bits (156),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            +L NG S E LNM+EAYGLTLQRAVP++ HP+PRL PHLY
Sbjct  470  ELENGLSPEKLNMDEAYGLTLQRAVPILAHPRPRLSPHLY  509



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   173 bits (439),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEIN + IPKGATLLVNVWAI+RDP  W  PLEF P RFLPGGEKP+VD+RG
Sbjct  373  LPRMASESCEINSFHIPKGATLLVNVWAISRDPEQWKEPLEFRPERFLPGGEKPHVDVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRR+C+ MSLG+RMVHL+ ATLVHAFDW
Sbjct  433  NDFEVIPFGAGRRMCAGMSLGLRMVHLMAATLVHAFDW  470


 Score = 57.0 bits (136),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPH  313
             F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH
Sbjct  467  AFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPH  508



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   177 bits (449),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEINGY IPKGATLLVNVWAIARDP+ W +PLEF P RFLPGGE+PN D+RG
Sbjct  370  LPRMASESCEINGYHIPKGATLLVNVWAIARDPDEWKDPLEFRPERFLPGGERPNADVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  430  NDFEVIPFGAGRRICAGMSLGLRMVQLLAATLVHAFDW  467


 Score = 53.5 bits (127),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  325
             F  +L +G   E LNMEEA+GLTLQRA PLM+HP+PR
Sbjct  464  AFDWELADGLMPEKLNMEEAFGLTLQRAAPLMVHPRPR  501



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   172 bits (435),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFRPERFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMV L++ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMTLGLRMVSLMIATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   169 bits (427),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CE++GY+IPKG+TLLVNVWAIARDP +W +PLEF P RFLP GEKPN +++G
Sbjct  374  LPRMALESCEVDGYYIPKGSTLLVNVWAIARDPKMWDDPLEFRPRRFLPRGEKPNANVKG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL ATLVHAFDW
Sbjct  434  NDFEIIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDW  471


 Score = 61.6 bits (148),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L NG   E LNM+EAYGLTLQR VPLM+HP PRL P LY
Sbjct  468  AFDWKLANGLDSEKLNMKEAYGLTLQRDVPLMVHPSPRLAPELY  511



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   175 bits (444),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEING+ IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGFHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.7 bits (130),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   165 bits (418),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY IPKG+TLLVNVWAI+RDP  WT PLEF P RFL  GEKPNVD+RG
Sbjct  372  LPRIAEESCEINGYHIPKGSTLLVNVWAISRDPEQWTQPLEFRPDRFLAAGEKPNVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLGIRMV LL ATLVHAF++
Sbjct  432  NDFELIPFGAGRRICAGMSLGIRMVQLLTATLVHAFNF  469


 Score = 64.3 bits (155),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL NG S + LNM+EAYGLTLQRA PL++HP PRL PH+Y
Sbjct  466  AFNFDLANGLSPQNLNMDEAYGLTLQRAQPLIVHPNPRLAPHVY  509



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   171 bits (433),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IPKGATLLVNVWAIARDP+ W  PL F P RFLPGGEKPNVD++G
Sbjct  373  LPRVAAESCEINGYHIPKGATLLVNVWAIARDPDTWAEPLAFRPERFLPGGEKPNVDVKG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL HAFDW
Sbjct  433  NDFEVIPFGAGRRICAGVSLGLRMVQFMTATLAHAFDW  470


 Score = 58.9 bits (141),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM+EAYGLTLQRA PL +HPKPRL  H Y
Sbjct  467  AFDWELANGALPEKLNMDEAYGLTLQRAEPLSVHPKPRLAAHAY  510



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   171 bits (433),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFRPERFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMTLGLRMVSLMTATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   175 bits (443),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVN+WAI+RDP  W  PLEF P RFLPG EKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNIWAISRDPAEWAEPLEFRPERFLPGSEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 54.7 bits (130),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+ RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMMHPRTRLAPHAY  507



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   164 bits (415),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY IPKG+TLLVNVWAIARDP+ W +PLEF P RF+ GG+KPNVD++G
Sbjct  378  LPRVAQESCEINGYLIPKGSTLLVNVWAIARDPDEWESPLEFRPQRFMAGGQKPNVDVKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ M LGIRMV LL ATL+HAFD+
Sbjct  438  SDFELIPFGAGRRICAGMGLGIRMVQLLTATLIHAFDF  475


 Score = 65.5 bits (158),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NGQ  E LNMEEAYGL L RA PLM+HPKPRL+PH+Y
Sbjct  472  AFDFELANGQLPENLNMEEAYGLQLTRADPLMVHPKPRLEPHVY  515



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   171 bits (432),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFRPERFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMTLGLRMVSLMTATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   170 bits (431),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFL GGEKPNVD+RG
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFKPERFLSGGEKPNVDVRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHGFDW  466


 Score = 58.9 bits (141),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   169 bits (429),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDPNVW +PLEF P RFLPGGEKPNVD++G
Sbjct  372  LPRIASESCEVDGYYIPKGSTLLVNVWAIARDPNVWADPLEFRPMRFLPGGEKPNVDVQG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  432  NNFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  469


 Score = 59.7 bits (143),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG + E LNM+EA+GLTLQ+A PLM+HP PRL PH+Y
Sbjct  467  FDWELANGLNPEKLNMDEAFGLTLQKAEPLMVHPMPRLAPHVY  509



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   170 bits (431),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEING+ IPKGATLLVNVWA++RDP+ W+ PLEF P RF+ GGEKPNVDIRG
Sbjct  369  LPRMATESCEINGFHIPKGATLLVNVWAVSRDPDQWSEPLEFRPERFMSGGEKPNVDIRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   167 bits (423),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY+IPK +TLLVNVWAI RDPNVW +PLEF P RFL GGEKPNVD+RG
Sbjct  382  LPRVAQESCEINGYYIPKDSTLLVNVWAIGRDPNVWPDPLEFRPERFLMGGEKPNVDVRG  441

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFG+GRRIC+ M+LGIRMV LL+AT+VHAFD+
Sbjct  442  NDFELIPFGSGRRICAGMNLGIRMVQLLIATMVHAFDF  479


 Score = 61.6 bits (148),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NGQ  + LNMEEAYG+TLQRA PL++HP+PRL  H+Y
Sbjct  476  AFDFELANGQLAKDLNMEEAYGITLQRADPLVVHPRPRLARHVY  519



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   167 bits (423),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRISSENCEVDGYHIPKGSTLLVNVWAIARDPKMWADPLEFRPTRFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  429  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  466


 Score = 61.6 bits (148),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM EAYGLTLQR  PLM+HPKPRL PH+Y
Sbjct  463  TFDWELANGLEPEKLNMNEAYGLTLQREEPLMVHPKPRLAPHVY  506



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   174 bits (440),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY++ +G+TLLVNVWAIARDPN W NPL+FNP RFL GGEKPNVD++G
Sbjct  318  LPRMAAEDCEINGYYVSEGSTLLVNVWAIARDPNAWANPLDFNPTRFLAGGEKPNVDVKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMV L+ A+LVH+FDW
Sbjct  378  NDFEVIPFGAGRRICAGMSLGIRMVQLVTASLVHSFDW  415


 Score = 55.1 bits (131),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  423  LVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            L++G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  417  LLDGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  457



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   173 bits (439),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY++ +G+TLLVNVWAIARDPN W NPL+FNP RFL GGEKPNVD++G
Sbjct  385  LPRMAAEDCEINGYYVSEGSTLLVNVWAIARDPNAWANPLDFNPTRFLAGGEKPNVDVKG  444

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMV L+ A+LVH+FDW
Sbjct  445  NDFEVIPFGAGRRICAGMSLGIRMVQLVTASLVHSFDW  482


 Score = 54.7 bits (130),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  423  LVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            L++G   E L+MEE YGLTLQRA PL++HPKPRL   +Y +
Sbjct  484  LLDGLKPEKLDMEEGYGLTLQRASPLIVHPKPRLSAQVYCM  524



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   167 bits (424),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKG+TLLVNVWAIARDP  W +PLEF P RFLPGGEKP+VD+RG
Sbjct  371  LPRIASESCEINGYHIPKGSTLLVNVWAIARDPKKWADPLEFRPARFLPGGEKPDVDVRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LL+ATLV  FDW
Sbjct  431  NDFEVIPFGAGRRICVGLSLGMRMVQLLIATLVQTFDW  468


 Score = 60.5 bits (145),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   E LNMEEAYGLTLQRA PLM+HP  RL PH+Y
Sbjct  466  FDWELANGLMPEKLNMEEAYGLTLQRAAPLMVHPMSRLAPHVY  508



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   174 bits (441),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD+RG
Sbjct  370  LPRISSEACEVDGYYIPKGSTLLVNVWAIARDPEMWTDPLEFRPSRFLPGGEKPNVDVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  M+LG+RMV LLVATLV  FDW
Sbjct  430  NDFEVIPFGAGRRICVGMTLGLRMVQLLVATLVQTFDW  467


 Score = 53.9 bits (128),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L  G   E LNM+EAYGLTLQRA  L++HPKPRL P +Y
Sbjct  465  FDWELAKGLEPEKLNMDEAYGLTLQRAEQLIVHPKPRLAPGVY  507



>gb|ADE80872.1| flavonoid 3'-hydroxylase, partial [Cyclamen persicum]
Length=176

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++GCEINGY IPKG+TLLVNVW+IARDP++W +PLEF P RFLPGGEKPN D+RG
Sbjct  62   LPRMASEGCEINGYSIPKGSTLLVNVWSIARDPSIWADPLEFRPARFLPGGEKPNADVRG  121

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV LL ATLVH+F+W
Sbjct  122  NDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHSFNW  159



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   169 bits (428),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFL GGEKP VD+RG
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFKPERFLSGGEKPTVDVRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   172 bits (435),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEING+ IPKGATLLVNVWAI+RDP  W+ PLEF P RFLPGGEKPNVD+RG
Sbjct  369  LPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSKPLEFRPERFLPGGEKPNVDVRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMTLGLRMVSLMTATLVHGFDW  466


 Score = 55.5 bits (132),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L NG + + L M+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLANGLTPDKLIMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   174 bits (440),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++GCEINGY IPKG+TLLVNVWAIARDP+VW  PLEF P RFLPGGEK +VD+RG
Sbjct  367  LPRIASEGCEINGYEIPKGSTLLVNVWAIARDPDVWAQPLEFRPERFLPGGEKASVDVRG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  427  NDFELIPFGAGRRICAGMSLGLRMVQLMTATLVHAFDW  464


 Score = 53.5 bits (127),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  G     LNM+EAYGLTLQRA PL++HPKPRL    Y
Sbjct  461  AFDWDLEEGVDPLKLNMDEAYGLTLQRAAPLIVHPKPRLSTQAY  504



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   171 bits (433),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD++G
Sbjct  372  LPRISSESCEVDGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  432  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  469


 Score = 56.2 bits (134),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQP  316
            F  +L NG   E LNM EAYGLTLQRA PL++HPKPRL P
Sbjct  467  FDWELANGVQPEKLNMNEAYGLTLQRAEPLIVHPKPRLAP  506



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   166 bits (421),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKG+TLL +VWAIARDP +WT+PL+F P RFLPGGEKPN D++G
Sbjct  374  LPRIASENCEINGYNIPKGSTLLTHVWAIARDPKIWTDPLKFQPTRFLPGGEKPNADVKG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDF++IPFGAGRRIC+ MSLG+RMV LL+ATLV AFDW
Sbjct  434  NDFDLIPFGAGRRICAGMSLGVRMVQLLIATLVQAFDW  471


 Score = 60.8 bits (146),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  +L N    E LNMEEAYGL L+RA PLM+HP+PRL PH+YT
Sbjct  468  AFDWELANCLEPENLNMEEAYGLALRRAEPLMVHPRPRLSPHVYT  512



>gb|AAX51195.1| cytochrome p450 [Ageratina adenophora]
Length=214

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVNVWAIARDP +WT+PLEF P RFLPGGEKPNVD+RG
Sbjct  102  LPRISSEACEVDGYYIPKGSTLLVNVWAIARDPEMWTDPLEFRPSRFLPGGEKPNVDVRG  161

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  M+LG+RMV LLVATLV  FDW
Sbjct  162  NDFEVIPFGAGRRICVGMTLGLRMVQLLVATLVQTFDW  199



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   177 bits (449),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPKG+TLLVNVWAI+RDP  W  PLEF P RFLPGGEKPNVDIRG
Sbjct  371  LPRMAAESCEINGYHIPKGSTLLVNVWAISRDPAEWAEPLEFRPERFLPGGEKPNVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  431  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHAFDW  468


 Score = 50.1 bits (118),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = -1

Query  402  ETLNMEEAYGLTLQRAVPLMLHPKP-RLQPHLY  307
            E LNM+EA+GLTLQRA PLM+HP+  RL PH Y
Sbjct  476  EKLNMDEAFGLTLQRAAPLMVHPRTGRLAPHAY  508



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   167 bits (424),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRISSENCEVDGYHIPKGSTLLVNVWAIARDPKMWADPLEFRPTRFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  429  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  466


 Score = 59.7 bits (143),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  463  TFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   172 bits (437),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY IPKGATLLVNVWAI+RD NVW  PLEF P+RFLP GEKPN D+RG
Sbjct  387  LPRVASESCEINGYHIPKGATLLVNVWAISRDSNVWDEPLEFRPNRFLPNGEKPNADVRG  446

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LGIRMV LL ATL+HAFDW
Sbjct  447  NDFEVIPFGAGRRICAGMTLGIRMVQLLTATLIHAFDW  484


 Score = 54.3 bits (129),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  GQ  E LNMEEAYGLTLQR  PLM+HP+ RL  ++Y
Sbjct  481  AFDWELPAGQIAEKLNMEEAYGLTLQRHTPLMVHPRTRLSQNVY  524



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   164 bits (414),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI GY IPKG+TLLVNVWAIARDP  W +PLEF P RFLPGGEK +VD++G
Sbjct  375  LPRIASESCEIFGYHIPKGSTLLVNVWAIARDPKEWVDPLEFKPERFLPGGEKCDVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLG+RMV LL ATL H+FDW
Sbjct  435  NDFEVIPFGAGRRICPGMSLGLRMVQLLTATLAHSFDW  472


 Score = 63.5 bits (153),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG +   +NM+E YGLTLQRAVPL++HPKPRL PH+Y+
Sbjct  470  FDWELENGLNAGKMNMDEGYGLTLQRAVPLLVHPKPRLSPHVYS  513



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   173 bits (439),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W +PLEF P RFLPGGEKP VD+RG
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPERFLPGGEKPKVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+ GIRMV L+ ATL+HAF+W
Sbjct  436  NDFEVIPFGAGRRICAGMNSGIRMVQLMTATLIHAFNW  473


 Score = 53.5 bits (127),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  470  AFNWDLSIGQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   167 bits (422),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IPKGATLLVNVWAIARDP  W  PL F P RFLPGGEK NVD++G
Sbjct  337  LPRIAAESCEINGYRIPKGATLLVNVWAIARDPEAWAEPLAFRPERFLPGGEKANVDVKG  396

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC  MSLG+RMV  + ATL HAFDW
Sbjct  397  NDFELIPFGAGRRICVGMSLGLRMVQFMTATLAHAFDW  434


 Score = 59.3 bits (142),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  ++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  431  AFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  474



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   167 bits (422),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IPKGATLLVNVWAIARDP  W  PL F P RFLPGGEK NVD++G
Sbjct  324  LPRIAAESCEINGYRIPKGATLLVNVWAIARDPEAWAEPLAFRPERFLPGGEKANVDVKG  383

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC  MSLG+RMV  + ATL HAFDW
Sbjct  384  NDFELIPFGAGRRICVGMSLGLRMVQFMTATLAHAFDW  421


 Score = 59.3 bits (142),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  ++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  418  AFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  461



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   173 bits (439),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W +PLEF P RFLPGGEKP VD+RG
Sbjct  376  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNEWADPLEFRPERFLPGGEKPKVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+ GIRMV L+ ATL+HAF+W
Sbjct  436  NDFEVIPFGAGRRICAGMNSGIRMVQLMTATLIHAFNW  473


 Score = 52.8 bits (125),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQS E LNMEEA+GLTLQRA PL++HP  RL+   Y
Sbjct  470  AFNWDLPIGQSPEKLNMEEAFGLTLQRADPLVVHPCLRLEAQAY  513



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   164 bits (414),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI GY IPKG+TLLVNVWAIARDP  W +PLEF P RFLPGGEK +VD++G
Sbjct  375  LPRIASESCEIFGYHIPKGSTLLVNVWAIARDPKEWVDPLEFKPERFLPGGEKCDVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLG+RMV LL ATL H+FDW
Sbjct  435  NDFEVIPFGAGRRICPGMSLGLRMVQLLTATLAHSFDW  472


 Score = 62.4 bits (150),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG +   +NM+E YGLTLQRAVPL +HPKPRL PH+Y+
Sbjct  470  FDWELENGLNAGKMNMDEGYGLTLQRAVPLSVHPKPRLSPHVYS  513



>gb|ABC48911.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABC48914.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  200  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  259

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  260  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  297



>gb|ABC48913.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  200  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  259

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  260  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  297



>gb|ABC48912.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=313

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGY IPK ATLLVNVWAIARDP VW  PLEF P+RFLPGGE+PN D+RG
Sbjct  200  LPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRG  259

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMVHLL ATLVHAF+W
Sbjct  260  NDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNW  297



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   173 bits (439),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAI+RDPN W +PLEF P RFLPGGEKP VD++G
Sbjct  375  LPRIASESCEINGYFIPKGSTLLVNVWAISRDPNEWADPLEFRPERFLPGGEKPKVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLGIRMV L+ ATL+H+F+W
Sbjct  435  NDFEVIPFGAGRRICPGMSLGIRMVQLMTATLIHSFNW  472


 Score = 52.4 bits (124),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ  E LNMEEA+GLTLQRA PL++HP PRL+  +Y
Sbjct  469  SFNWALPTGQLPEKLNMEEAFGLTLQRADPLVVHPIPRLEAQVY  512



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   164 bits (414),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEI+GY IPKGATLLVNVWAIARDP+VW  PL F P RFLPGGEK  VD+RG
Sbjct  366  LPRMAAESCEIDGYHIPKGATLLVNVWAIARDPDVWAEPLVFMPERFLPGGEKAKVDVRG  425

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFG GRRIC+ +S G+R+V+L+ ATL+HAFDW
Sbjct  426  NDFELIPFGGGRRICAGLSYGLRVVYLMAATLLHAFDW  463


 Score = 62.0 bits (149),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM+EAYGLTLQRA PLM+HPKPRL P  Y
Sbjct  460  AFDWELANGLIPEKLNMDEAYGLTLQRAAPLMVHPKPRLSPQAY  503



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   167 bits (422),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEING+ IPKGATLLVNVWA +RDP+ W+ PLEF P RF+ GGEKPNVD RG
Sbjct  369  LPRMATESCEINGFHIPKGATLLVNVWAXSRDPDQWSEPLEFRPERFMSGGEKPNVDXRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV L+ ATLVH FDW
Sbjct  429  NDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHGFDW  466


 Score = 58.5 bits (140),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L +G + E LNM+EAYGLTLQRA PLM+HP+ RL PH Y
Sbjct  464  FDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAY  506



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   167 bits (424),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IP+G+TLLVNVWAIARDP+ W  PL F P RFLPGGEK NVD+RG
Sbjct  376  LPRVAAKSCEINGYHIPEGSTLLVNVWAIARDPDEWAEPLVFRPERFLPGGEKANVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            ND+E+IPFGAGRRIC+ MSLG+RMV LL ATL+HAFDW
Sbjct  436  NDYEIIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDW  473


 Score = 57.8 bits (138),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  D  +G + E LNMEEAYGLTLQRA PL++HP+PRL P  Y
Sbjct  470  AFDWDFPSGLTPEKLNMEEAYGLTLQRADPLIVHPRPRLTPKAY  513



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   162 bits (410),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CEINGYFIPKG+TLLVNVWAIARDP+ W NPLEF P RFLPGGEKPNVDIRG
Sbjct  340  LPRMAAESCEINGYFIPKGSTLLVNVWAIARDPDAWANPLEFQPERFLPGGEKPNVDIRG  399

Query  539  NDF-EVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
              F     FGAGRRIC+ MSLG+RMV LL ATLV AF+W
Sbjct  400  ERFLRSFRFGAGRRICAGMSLGLRMVQLLTATLVQAFNW  438


 Score = 63.2 bits (152),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  G+S E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  435  AFNWELPEGKSAEKLNMDEAYGLTLQRADPLMVHPRPRLAAHLY  478



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   167 bits (423),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGYFIPK +TLLVNVWAIARDPNVW +PLEF P RFL GGE+PN D+RG
Sbjct  373  LPRIAQESCEINGYFIPKDSTLLVNVWAIARDPNVWADPLEFRPGRFLRGGERPNADVRG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE++PFGAGRR+C+ MSLGIRMV L+ ATL+HAFD+
Sbjct  433  NDFELMPFGAGRRVCAGMSLGIRMVQLMFATLIHAFDF  470


 Score = 58.2 bits (139),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG S + L+MEEAYGLTLQRA PL+++P+PRL  H+Y
Sbjct  467  AFDFELGNGLSAQNLSMEEAYGLTLQRAEPLVVYPRPRLASHVY  510



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   166 bits (420),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IPKGATLLVNVWAIARDP  W  PL F P RFLPGGEK NVD++G
Sbjct  373  LPRIAAESCEINGYRIPKGATLLVNVWAIARDPEAWAEPLAFRPERFLPGGEKANVDVKG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC  MSLG+RMV  + ATL HAFDW
Sbjct  433  NDFELIPFGAGRRICVGMSLGLRMVQFMTATLAHAFDW  470


 Score = 58.9 bits (141),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  ++ +G S E LNM+EA+GLTLQRA PL++HPKPRL  H+Y
Sbjct  467  AFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLASHVY  510



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   170 bits (431),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  Q CEINGY IPKGATLLVNVWAIARDP+VW +PL F P RFLPG EK NVD++G
Sbjct  374  LPRIATQSCEINGYHIPKGATLLVNVWAIARDPDVWADPLSFRPERFLPGSEKENVDVKG  433

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL ATL+HAF+W
Sbjct  434  NDFELIPFGAGRRICAGMSLGLRMVQLLTATLLHAFNW  471


 Score = 54.7 bits (130),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQ  + LNM+EAYGLTLQRA PL + P+PRL  HLY
Sbjct  468  AFNWDLPQGQIPQELNMDEAYGLTLQRASPLHVRPRPRLPSHLY  511



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   164 bits (415),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PRM  + CEINGY IPKG TLLVNVWAIARDP  WT+PLEF P RFLPGGEK  VDIRG
Sbjct  371  VPRMANESCEINGYHIPKGTTLLVNVWAIARDPAEWTDPLEFRPERFLPGGEKAQVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFD  429
            NDFEVIPFGAGRRIC+ MSLG+RMV LL A+LVH F+
Sbjct  431  NDFEVIPFGAGRRICAGMSLGVRMVQLLTASLVHGFN  467


 Score = 60.5 bits (145),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F L L NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  466  FNLGLPNGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   165 bits (417),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY IPKG+TLLVNVWAIARDP +W +PLEF P RFLPGGEKPNVD++G
Sbjct  369  LPRISSENCEVDGYHIPKGSTLLVNVWAIARDPKMWADPLEFRPARFLPGGEKPNVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVAT V  FDW
Sbjct  429  NDFEVIPFGAGRRICVGISLGLRMVQLLVATSVQTFDW  466


 Score = 59.7 bits (143),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM EAYGLTLQR  PL++HPKPRL PH+Y
Sbjct  463  TFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVY  506



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   164 bits (415),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PRM  + CEINGY IPKG TLLVNVWAIARDP  WT+PLEF P RFLPGGEK  VDIRG
Sbjct  371  VPRMANESCEINGYHIPKGTTLLVNVWAIARDPAEWTDPLEFRPERFLPGGEKAQVDIRG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFD  429
            NDFEVIPFGAGRRIC+ MSLG+RMV LL A+LVH F+
Sbjct  431  NDFEVIPFGAGRRICAGMSLGVRMVQLLTASLVHGFN  467


 Score = 60.5 bits (145),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F L L NG   E LNM+EAYGLTLQRA PLM+HP+PRL  HLY
Sbjct  466  FNLGLPNGLLPEKLNMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   159 bits (401),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CEI+GY IPK +TLLVNVWAIARDP+VW+ PLEF P RFLPGG+  ++D++G
Sbjct  372  LPRMASESCEIDGYHIPKNSTLLVNVWAIARDPDVWSEPLEFKPDRFLPGGKNAHMDVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             DFEVIPFGAGRRIC+ MS+G+RMV  + ATLVH FDW
Sbjct  432  TDFEVIPFGAGRRICAGMSMGMRMVQYVTATLVHGFDW  469


 Score = 65.5 bits (158),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  ++  GQ VE LNMEE+YGLTLQRA PL++HP+PRL PH+Y  N
Sbjct  467  FDWEMPEGQMVEKLNMEESYGLTLQRAAPLVVHPRPRLAPHVYQTN  512



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   173 bits (439),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGYFIPKG+TLLVNVWAIARDPN W +P+EF P RFLPGGEKP VD++G
Sbjct  375  LPRIASESCEINGYFIPKGSTLLVNVWAIARDPNQWADPIEFRPERFLPGGEKPKVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLGIRMV L+ ATL+H+F+W
Sbjct  435  NDFEVIPFGAGRRICPGMSLGIRMVQLMTATLIHSFNW  472


 Score = 50.1 bits (118),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  414  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            GQ  + LNMEEA+GLTLQRA PL++HP PRL+  ++
Sbjct  477  GQLPDKLNMEEAFGLTLQRADPLVVHPIPRLEAQVF  512



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   165 bits (417),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEI GY IPKG+TLLVNVWAIARDP  W +PLEF P RFLPGGEK +VD++G
Sbjct  367  LPRVAAESCEIFGYHIPKGSTLLVNVWAIARDPKEWADPLEFRPERFLPGGEKADVDVKG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV LL ATL H+FDW
Sbjct  427  NDFEVIPFGAGRRICAGLSLGLRMVQLLTATLAHSFDW  464


 Score = 58.5 bits (140),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
             F  +L NG + E LNM+EAYGLTLQRA PL +HP+PRL  H+Y+
Sbjct  461  SFDWELENGLNPEKLNMDEAYGLTLQRAEPLSVHPRPRLASHVYS  505



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   157 bits (397),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP++W +PL F P RFLPG EK NVDI+G
Sbjct  333  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPSMWPDPLRFEPERFLPGSEKANVDIKG  392

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + A L+H F+W
Sbjct  393  NDFEVIPFGAGRRICAGLSLGLRMVQFMTAALIHGFNW  430


 Score = 66.2 bits (160),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPKPRL+ H+Y+
Sbjct  428  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKPRLEAHVYS  471



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   165 bits (417),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEINGY IPKG+TLLVNVWAIARDP  W  PL F P RFL GGEK NVD+RG
Sbjct  370  LPRIAAESCEINGYHIPKGSTLLVNVWAIARDPEEWVEPLVFRPERFLAGGEKANVDVRG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV LL ATLVHAF+W
Sbjct  430  NDFELIPFGAGRRICAGMSLGLRMVQLLTATLVHAFEW  467


 Score = 58.2 bits (139),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  322
             F  +L +G   E LNMEEAYGLTLQRAVPLM+HPKPRL
Sbjct  464  AFEWELADGLLPEKLNMEEAYGLTLQRAVPLMVHPKPRL  502



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   171 bits (432),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CE+NGY+IPKG+TLLVNVWAIARDP +WT+PLEF   RFLPGGEKP+VD++G
Sbjct  370  LPRMATESCEVNGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRATRFLPGGEKPDVDVKG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFG GRRIC+ M+LG++MV LL+ATLVHAFDW
Sbjct  430  NDFELIPFGGGRRICAGMNLGLKMVQLLIATLVHAFDW  467


 Score = 52.0 bits (123),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L +G   E LNMEEA GL L R VPLM+HPKPRL  H Y
Sbjct  464  AFDWKLADGLDPEKLNMEEAPGLALHRVVPLMVHPKPRLAHHAY  507



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   163 bits (412),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEI GY IP+GATLLVNVWAIARDP  W  PLEF P RFL GGEK +VD+RG
Sbjct  376  LPRVAAKSCEIFGYHIPEGATLLVNVWAIARDPKEWAEPLEFRPERFLKGGEKADVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ M+LG+RMV LL ATL H+FDW
Sbjct  436  NDFEVIPFGAGRRICAGMTLGLRMVQLLTATLAHSFDW  473


 Score = 58.9 bits (141),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L  G   E LNM+EAYGLTLQRA+PL +HPKPRL  H+Y+
Sbjct  471  FDWELEGGLKQEDLNMDEAYGLTLQRALPLSVHPKPRLSSHVYS  514



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   167 bits (424),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY IPK  TLLVNVWAIARDP VW +PLEF P RFLPGGEKPNVD++G
Sbjct  373  LPRVANESCEINGYHIPKNTTLLVNVWAIARDPEVWADPLEFKPERFLPGGEKPNVDVKG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+RMV L+ ATL H +DW
Sbjct  433  NDFELIPFGAGRRICAGLSLGLRMVQLMTATLAHTYDW  470


 Score = 53.5 bits (127),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  423  LVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            L +G   E LNM+EAYGLTLQR VPLM+HP  RL  H+Y
Sbjct  472  LADGLMPEKLNMDEAYGLTLQRKVPLMVHPTRRLSAHVY  510



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   159 bits (402),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RG
Sbjct  372  VPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG++MV LL ATL H+FDW
Sbjct  432  NDFEVIPFGAGRRICAGLSLGLQMVQLLTATLAHSFDW  469


 Score = 60.8 bits (146),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  467  FDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   158 bits (399),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CEING+FIPKG+TLLVNVWAIARDP VW  PL+F P RFLPG E  +VD+RG
Sbjct  372  LPRIAAENCEINGFFIPKGSTLLVNVWAIARDPAVWPEPLKFRPERFLPGSEHAHVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDWI  423
            NDFE++PFGAGRRIC+ MS G+RMV  L ATLV AFDW+
Sbjct  432  NDFELMPFGAGRRICAGMSWGLRMVLFLTATLVQAFDWV  470


 Score = 62.0 bits (149),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  414  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            GQ+ E LNMEEAYGLTLQRAVPL++H +PRL PH+Y 
Sbjct  474  GQTPENLNMEEAYGLTLQRAVPLLVHTRPRLAPHVYC  510



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   168 bits (426),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ +  CE++GY IPKG+TLLVNVW IARDP VWT+PLEF P RFLPGGEKPNVD+RG
Sbjct  367  LPRVSSDDCEVSGYHIPKGSTLLVNVWGIARDPEVWTDPLEFRPTRFLPGGEKPNVDVRG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV LLVATLV  FDW
Sbjct  427  NDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDW  464


 Score = 51.2 bits (121),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHL  310
            F  +L  G   E LNM+E YGLTLQRA PLM+HPK RL  H+
Sbjct  462  FDWELAKGLEPEKLNMDETYGLTLQRAEPLMVHPKSRLAHHV  503



>ref|XP_008794133.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=510

 Score =   160 bits (406),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A  CEINGY IPKGATLLVNVWAI RDP  W +PLEF P RFLPGG   +VDI+G
Sbjct  370  LPRVAAGHCEINGYHIPKGATLLVNVWAIGRDPATWADPLEFRPSRFLPGGGHEHVDIKG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV L+ ATLVHAFDW
Sbjct  430  NDFEIIPFGAGRRICAGMSLGLRMVQLMAATLVHAFDW  467


 Score = 58.9 bits (141),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  414  GQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            GQ  E LNMEEA+GLTLQRAVPL + PKPRL PH+Y
Sbjct  472  GQDPEKLNMEEAFGLTLQRAVPLAVCPKPRLAPHVY  507



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   157 bits (398),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CEING++IPK +TLLVNVWAIARDP+VW  PLEF P RF+PGG   ++D++G
Sbjct  373  LPRMATESCEINGFYIPKDSTLLVNVWAIARDPSVWPEPLEFKPERFVPGGRNAHMDVKG  432

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MS+GIRMV  + ATLVH F+W
Sbjct  433  NDFEVIPFGAGRRICAGMSMGIRMVTFVAATLVHGFNW  470


 Score = 61.6 bits (148),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L  GQ  E LNM+EAYGLTLQRAVPL++HP+PRL PH Y
Sbjct  468  FNWELPEGQMPEKLNMDEAYGLTLQRAVPLVVHPQPRLAPHAY  510



>gb|AAO47857.1| flavonoid 3'-hydroxylase, partial [Glycine max]
Length=323

 Score =   157 bits (398),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RG
Sbjct  182  VPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRG  241

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG++MV LL A L H+FDW
Sbjct  242  NDFEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDW  279


 Score = 61.2 bits (147),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  277  FDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  322



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   167 bits (424),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEINGY IPK  TLLVNVWAIARDP VW +PLEF P RFLPGGEKPNVD++G
Sbjct  372  LPRVANESCEINGYHIPKNTTLLVNVWAIARDPEVWADPLEFKPERFLPGGEKPNVDVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+RMV L+ ATL H +DW
Sbjct  432  NDFELIPFGAGRRICAGLSLGLRMVQLMTATLAHTYDW  469


 Score = 50.8 bits (120),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  423  LVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            L +G   E LNM+EAYGLTLQR VPLM+HP  RL   +Y
Sbjct  471  LADGLMPEKLNMDEAYGLTLQRKVPLMVHPTRRLSARVY  509



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   157 bits (397),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RG
Sbjct  372  VPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG++MV LL A L H+FDW
Sbjct  432  NDFEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDW  469


 Score = 60.8 bits (146),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  467  FDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   159 bits (403),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR+  + CEINGYFIPKG+TLLVN+WAIARDPN+W +PL+F P RFLPGGEK +VD+RG
Sbjct  397  VPRIAHESCEINGYFIPKGSTLLVNIWAIARDPNIWADPLQFRPDRFLPGGEKADVDVRG  456

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE++PFG+GRRIC+ + L +R V LL ATL+H FD+
Sbjct  457  NDFELMPFGSGRRICAGLGLAVRTVQLLTATLIHGFDF  494


 Score = 58.5 bits (140),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L +G+    LNMEEAYGLTLQRA PLM+HP+PRL P +Y
Sbjct  492  FDFELGDGKLGHELNMEEAYGLTLQRAEPLMVHPRPRLAPRVY  534



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   157 bits (397),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RG
Sbjct  372  VPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG++MV LL A L H+FDW
Sbjct  432  NDFEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDW  469


 Score = 60.8 bits (146),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  467  FDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  512



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   155 bits (393),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + A+ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  367  LPHIAAESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFKPERFLPGGEKAGVDVKG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + +L ATLVH F+W
Sbjct  427  SDFELIPFGAGRRICAGLSLGLRTIQMLTATLVHGFEW  464


 Score = 62.4 bits (150),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  462  FEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   160 bits (405),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W+ PLEF P RFLPG EK NVDI+G
Sbjct  320  LPRVSIEDCEIDGYFIPKNTTLLTNVWAIARDPLMWSGPLEFKPERFLPGNEKANVDIKG  379

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV  + ATL+H F+W
Sbjct  380  NDFEVIPFGAGRRICAGMSLGLRMVQFMTATLIHGFNW  417


 Score = 57.4 bits (137),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  DL  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  415  FNWDLPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  453



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   155 bits (392),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  368  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFRPERFLPGGEKFGVDVKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + LL ATLVH FDW
Sbjct  428  SDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFDW  465


 Score = 62.8 bits (151),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEEAYG+TLQRAVPL++HPKPRL P +Y L 
Sbjct  463  FDWELAGGITPEKLNMEEAYGITLQRAVPLVVHPKPRLAPGIYGLG  508



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   155 bits (392),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD+RG
Sbjct  367  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFKPERFLPGGEKAGVDVRG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + +L ATLVH F+W
Sbjct  427  SDFELIPFGAGRRICAGLSLGLRTIQILTATLVHGFEW  464


 Score = 62.0 bits (149),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  462  FEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   157 bits (396),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  716  PRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRGN  537
            PR+ ++ C+I GY IPKG+TLLVNVWAIARDP  W +PL+F P RFL GGEK +VD++GN
Sbjct  369  PRIASESCDIFGYHIPKGSTLLVNVWAIARDPKEWNDPLDFKPERFLQGGEKCDVDVKGN  428

Query  536  DFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            DFEVIPFGAGRRIC  MSLGIRMV LL ATL H+F+W
Sbjct  429  DFEVIPFGAGRRICVGMSLGIRMVQLLTATLTHSFNW  465


 Score = 60.8 bits (146),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG + +T+NMEEAYGLTLQRAVPL +HPK RL  H+Y+
Sbjct  463  FNWELENGLNEKTMNMEEAYGLTLQRAVPLSVHPKRRLSQHVYS  506



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   154 bits (390),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  367  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFKPERFLPGGEKAGVDVKG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + +L ATLVH F+W
Sbjct  427  SDFELIPFGAGRRICAGLSLGLRTIQMLTATLVHGFEW  464


 Score = 62.4 bits (150),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  462  FEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGLG  507



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   154 bits (389),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  367  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKG  426

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + +L ATLVH F+W
Sbjct  427  SDFELIPFGAGRRICAGLSLGLRTIQILTATLVHGFEW  464


 Score = 62.0 bits (149),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            F  +L  G + E LNMEE YGLTLQRAVPL++HPKPRL P++Y L
Sbjct  462  FEWELAGGVTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYGL  506



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   159 bits (402),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ WT+PL F P RFLPGGEK  VD++G
Sbjct  575  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWTDPLSFRPERFLPGGEKAGVDVKG  634

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  635  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  672


 Score = 57.0 bits (136),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  670  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDMSAYGLG  715



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   158 bits (399),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+    CEI+GY IPKG+TLLVNVWAIARDP VW +PLEF P RFL GGEK +VD++G
Sbjct  375  LPRLAEDDCEIDGYLIPKGSTLLVNVWAIARDPKVWADPLEFRPERFLTGGEKADVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFD  429
            NDFE+IPFGAGRRIC+ + LGIRMV LL A+L+HAFD
Sbjct  435  NDFELIPFGAGRRICAGVGLGIRMVQLLTASLIHAFD  471


 Score = 57.8 bits (138),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F LDL NG   + LNMEEAYGLTLQRA PL++HP+ RL  H+Y
Sbjct  469  AFDLDLANGLLPQNLNMEEAYGLTLQRAEPLLVHPRLRLATHVY  512



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   159 bits (403),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+NGY IPKG+TLLVN+WAI R P VW +PLEF P RFLPGGEKP V+++ 
Sbjct  370  LPRIASESCEVNGYHIPKGSTLLVNIWAIGRHPEVWADPLEFRPARFLPGGEKPGVNVKV  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEV+PFGAGRRIC+ MSL ++MVHLL+ATL+ AFDW
Sbjct  430  NDFEVLPFGAGRRICAGMSLALKMVHLLIATLIQAFDW  467


 Score = 56.2 bits (134),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNMEE +G+++Q+A PLM+HP+PRL PH Y
Sbjct  464  AFDWELANGLDPERLNMEEEFGISVQKAEPLMVHPRPRLAPHTY  507



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   156 bits (395),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ C+INGY IPKG TLLVNVWAIARDP  WT+PL F P RFLPGGEK  VD+RG
Sbjct  349  LPRIAAENCDINGYHIPKGTTLLVNVWAIARDPAEWTDPLLFRPERFLPGGEKAEVDVRG  408

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFG+GRR+C  MSLG+R V LL A+LVHAF++
Sbjct  409  NDFEVIPFGSGRRMCVGMSLGLRTVQLLTASLVHAFNF  446


 Score = 59.3 bits (142),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  443  AFNFGLANGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  486



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   152 bits (383),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  372  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFKPDRFLPGGEKSGVDVKG  431

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R +  L ATLV  FDW
Sbjct  432  SDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDW  469


 Score = 63.5 bits (153),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE+YGLTLQRAVPLM+HPKPRL P++Y + 
Sbjct  467  FDWELAGGITPEKLNMEESYGLTLQRAVPLMVHPKPRLAPNVYGIG  512



>ref|XP_010936313.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=508

 Score =   156 bits (395),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A  CEINGY IPKGA LLVN+WAI RDP  W +PLEF P RFLPGG   ++DI+G
Sbjct  368  LPRIAADNCEINGYHIPKGANLLVNIWAIGRDPATWADPLEFRPSRFLPGGGHEHIDIKG  427

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLG+RMV L++AT+VH FDW
Sbjct  428  NDFEIIPFGAGRRICAGMSLGLRMVQLMLATMVHGFDW  465


 Score = 58.9 bits (141),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F   L+ GQ  E LNMEEA+GLTLQRA PL L PKPRL PH YT
Sbjct  463  FDWALLMGQVPEKLNMEEAFGLTLQRAEPLSLWPKPRLAPHAYT  506



>gb|AAO47851.1| flavonoid 3'-hydroxylase [Glycine max]
Length=325

 Score =   157 bits (398),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RG
Sbjct  184  VPRAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRG  243

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG++MV LL A L H+FDW
Sbjct  244  NDFEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDW  281


 Score = 57.8 bits (138),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQ AVPL +HP+PRL PH+Y+++
Sbjct  279  FDWELEDCMNPEKLNMDEAYGLTLQPAVPLSVHPRPRLAPHVYSMS  324



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   152 bits (384),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  371  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R +  L ATLV  FDW
Sbjct  431  SDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDW  468


 Score = 62.8 bits (151),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE+YGLTLQRAVPL++HPKPRL P++Y L 
Sbjct  466  FDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGLG  511



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   160 bits (404),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W  PL+F P RFLPG EK NVDI+G
Sbjct  315  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPEPLKFKPERFLPGSEKANVDIKG  374

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H+FDW
Sbjct  375  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHSFDW  412


 Score = 55.1 bits (131),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  410  FDWELPEGQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   159 bits (402),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W++PL+F P RFLPG EK NVDI+G
Sbjct  342  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWSDPLKFKPERFLPGNEKANVDIKG  401

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H F+W
Sbjct  402  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHGFNW  439


 Score = 55.5 bits (132),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  437  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  475



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   159 bits (402),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W++PLEF P RFLPG EK NVDI+G
Sbjct  351  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWSDPLEFKPERFLPGNEKANVDIKG  410

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV  + A L+H F+W
Sbjct  411  NDFEVIPFGAGRRICAGMSLGLRMVQFMTAALIHGFNW  448


 Score = 55.5 bits (132),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  446  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  484



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   158 bits (400),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W++PL+F P RFLPG EK N+DI+G
Sbjct  318  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWSDPLKFKPERFLPGNEKANIDIKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H F+W
Sbjct  378  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHGFNW  415


 Score = 55.1 bits (131),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  413  FNWELPAGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  451



>gb|AAO47849.1| flavonoid 3'-hydroxylase [Glycine max]
Length=140

 Score =   152 bits (384),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  713  RMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRGND  534
            R  A+ CEI GY IPKGATLLVN+WAIARDP  W +PLEF P RFL GGEK +VD+RGND
Sbjct  1    RAAAESCEIFGYHIPKGATLLVNIWAIARDPKEWNDPLEFRPERFLLGGEKADVDVRGND  60

Query  533  FEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            FEVIPFGAGRRIC+ +SLG++MV LL A L H+FDW
Sbjct  61   FEVIPFGAGRRICAGLSLGLQMVQLLTAALAHSFDW  96


 Score = 61.2 bits (147),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L +  + E LNM+EAYGLTLQRAVPL +HP+PRL PH+Y+++
Sbjct  94   FDWELEDCMNPEKLNMDEAYGLTLQRAVPLSVHPRPRLAPHVYSMS  139



>ref|XP_010939156.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=516

 Score =   159 bits (402),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ CE+ GY IP+GATLLVNVWAIARDP VW +PLEF P RFLPGG   ++D++G
Sbjct  379  LPRMSSEACEVAGYHIPQGATLLVNVWAIARDPAVWHDPLEFQPARFLPGGGYEHMDVKG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ MSLGIRMV  ++A+LVHAFDW
Sbjct  439  NDFEIIPFGAGRRICAGMSLGIRMVQFMIASLVHAFDW  476


 Score = 54.3 bits (129),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ  E L+MEEAYGLTLQRA+PLM+HP PRL    Y
Sbjct  473  AFDWALPEGQMAEKLDMEEAYGLTLQRAMPLMVHPVPRLASAAY  516



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   156 bits (395),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  369  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFRPERFLPGGEKAGVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  429  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  466


 Score = 57.0 bits (136),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  464  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGLG  509



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   157 bits (398),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RFLPGGEK +VDIRG
Sbjct  369  LPRVAEESCEIFNYHIPKGATLLVNVWAIGRDPKEWLDPLEFKPERFLPGGEKADVDIRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC  MSLGI++V LL+A+L HAFDW
Sbjct  429  NNFEVIPFGAGRRICVGMSLGIKVVQLLIASLAHAFDW  466


 Score = 55.1 bits (131),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  464  FDWELENGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  507



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   157 bits (398),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RFLPGGEK +VDIRG
Sbjct  364  LPRVAEESCEIFNYHIPKGATLLVNVWAIGRDPKEWLDPLEFKPERFLPGGEKADVDIRG  423

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC  MSLGI++V LL+A+L HAFDW
Sbjct  424  NNFEVIPFGAGRRICVGMSLGIKVVQLLIASLAHAFDW  461


 Score = 55.1 bits (131),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG   + LNM+EAYGLTLQRAVPL +H  PRL  H+Y+
Sbjct  459  FDWELENGYDPKKLNMDEAYGLTLQRAVPLSIHTHPRLSQHVYS  502



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   156 bits (395),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR  ++ C+INGY IPKG+TLLVN+WAIARDPN W +PLEF P RFLPGGEK NVD++G
Sbjct  399  LPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKG  458

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            ND+E+IPFGAGRRIC+ +S G+RMV L  ATL HAF+W
Sbjct  459  NDYELIPFGAGRRICAGLSWGLRMVQLGTATLAHAFNW  496


 Score = 56.6 bits (135),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  G   E LNM+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  493  AFNWELPGGLKPEKLNMDEAYGLTLQRAAPLVVHPRPRLSPNAY  536



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   153 bits (387),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ C+INGY IPKG TLLVNVWAIARDP  WT+PL F P RFLPGGEK  VD+RG
Sbjct  376  LPRIAAENCDINGYHIPKGTTLLVNVWAIARDPAEWTDPLLFRPERFLPGGEKAEVDVRG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFG+GRR+C  M LG+R V LL A+LVHAF++
Sbjct  436  NDFEVIPFGSGRRMCVGMRLGLRTVQLLTASLVHAFNF  473


 Score = 58.9 bits (141),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L NG   E LNM+EAYGLTLQRA PLM+HP PRL  H+Y
Sbjct  470  AFNFGLANGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVY  513



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   154 bits (389),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE++GY+IPKG+TLLVN+WAI R P VWT+PLEF P RFLPGGEKP + ++ 
Sbjct  370  LPRIASESCEVDGYYIPKGSTLLVNIWAIGRHPEVWTDPLEFRPTRFLPGGEKPGIVVKV  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEV+PFGAGRRIC+ MSL +R V LL+ TLV AFDW
Sbjct  430  NDFEVLPFGAGRRICAGMSLALRTVQLLMGTLVQAFDW  467


 Score = 57.8 bits (138),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNM+EA+GL++QRA PL++HP+PRL PH+Y
Sbjct  464  AFDWELANGIKPEKLNMDEAFGLSVQRAEPLVVHPRPRLPPHVY  507



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   157 bits (396),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W +PL+F P RFLPG EK NVDI+G
Sbjct  350  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPDPLKFKPERFLPGNEKANVDIKG  409

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H F+W
Sbjct  410  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHGFNW  447


 Score = 55.5 bits (132),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  445  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVHPKLRLE  483



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   153 bits (386),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI GY IPK +TLLVNVWAIARD  +W +PL+F P RFLPGGE  +VD++G
Sbjct  375  LPRIASESCEIFGYHIPKDSTLLVNVWAIARDQEIWVDPLKFKPERFLPGGENCDVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ ++LGIRMV L +ATL H+F+W
Sbjct  435  NDFEVIPFGAGRRICAGLNLGIRMVQLQIATLAHSFNW  472


 Score = 59.3 bits (142),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  470  FNWELENGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   156 bits (394),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARD  +W  PL+F P RFLPG EK NVDI+G
Sbjct  315  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDLLMWPEPLKFKPERFLPGSEKANVDIKG  374

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H+FDW
Sbjct  375  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHSFDW  412


 Score = 55.1 bits (131),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+HPK RL+
Sbjct  410  FDWELPEGQLIEKLNMDEAYGLTLQRASPLMVHPKLRLE  448



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   152 bits (383),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI GY IPK +TLLVNVWAIARD  +W +PL+F P RFLPGGE  +VD++G
Sbjct  375  LPRIASESCEIFGYHIPKDSTLLVNVWAIARDQEIWVDPLKFKPERFLPGGENCDVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ ++LGIRMV L +ATL H+F+W
Sbjct  435  NDFEVIPFGAGRRICAGLNLGIRMVQLQIATLAHSFNW  472


 Score = 59.3 bits (142),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG + + +NM+E++GL +QRAVPL++HPKPRL PH+Y+
Sbjct  470  FNWELENGINAKDINMDESFGLGIQRAVPLLVHPKPRLLPHVYS  513



>ref|XP_003598947.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69198.1| flavonoid hydroxylase [Medicago truncatula]
Length=286

 Score =   154 bits (388),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEI GY +PK +TLLVNVWAIARDP  W +PL F P RFL GGEK +VD++G
Sbjct  145  LPRIASESCEIFGYHVPKSSTLLVNVWAIARDPKEWVDPLGFKPERFLLGGEKCDVDVKG  204

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  MSLG+RMV LL ATL H+FDW
Sbjct  205  NDFEVIPFGAGRRICVGMSLGLRMVQLLTATLAHSFDW  242


 Score = 57.4 bits (137),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG + E  N +E YGLTLQR VPL +HPKPRL PH+++
Sbjct  240  FDWELENGLNAEKKNKDEGYGLTLQRIVPLSVHPKPRLSPHVFS  283



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   154 bits (388),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+ GY IP+GATLLVN+WAI  DP  W NPLEFNP RFLPGG   +VD+RG
Sbjct  379  LPRVASEACEVGGYQIPRGATLLVNIWAITHDPASWPNPLEFNPARFLPGGGHESVDLRG  438

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             DFE+IPFGAGRRIC+ MSLGIRMV  + ATLVHAFDW
Sbjct  439  QDFELIPFGAGRRICAGMSLGIRMVQFMTATLVHAFDW  476


 Score = 57.4 bits (137),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ  E L+MEEAYGLTLQRAVPLM+HP+PRL    Y
Sbjct  473  AFDWSLPEGQKPEKLDMEEAYGLTLQRAVPLMVHPRPRLTSAAY  516



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   166 bits (421),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CEINGY+IPK ATLLVNVWAIARDP VW++PLEF P RF+PGGEK NVD++G
Sbjct  363  LPRISSEPCEINGYYIPKNATLLVNVWAIARDPAVWSDPLEFKPERFMPGGEKANVDVKG  422

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV  + ATLVH F+W
Sbjct  423  NDFEVIPFGAGRRICAGMSLGLRMVQFMTATLVHGFEW  460


 Score = 44.7 bits (104),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  322
            F   L  G + E L+MEE+YGLTLQR VPL + P PRL
Sbjct  458  FEWGLPEGVNAEKLDMEESYGLTLQRKVPLTVQPIPRL  495



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   156 bits (395),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR  ++ C+INGY IPKG+TLLVN+WAIARDPN W +PLEF P RFLPGGEK NVD++G
Sbjct  377  LPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            ND+E+IPFGAGRRIC+ +S G+RMV L  ATL HAF+W
Sbjct  437  NDYELIPFGAGRRICAGLSWGLRMVQLGTATLAHAFNW  474


 Score = 54.3 bits (129),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L  G   E L+M+EAYGLTLQRA PL++HP+PRL P+ Y
Sbjct  471  AFNWELPGGLKPEKLSMDEAYGLTLQRAAPLVVHPRPRLSPNAY  514



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   158 bits (399),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ WT+PL F P RFLPGGEK  VD++G
Sbjct  369  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWTDPLSFRPERFLPGGEKAGVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  429  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  466


 Score = 52.4 bits (124),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  464  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   157 bits (398),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W +PL+F P RFLPG EK NVDI+G
Sbjct  342  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPDPLKFKPERFLPGNEKANVDIKG  401

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H F+W
Sbjct  402  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHGFNW  439


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQ  319
            F  +L  GQ +E LNM+EAYGLTLQRA  LM+HPK RL+
Sbjct  437  FNWELPQGQVIEKLNMDEAYGLTLQRASTLMVHPKLRLE  475



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   162 bits (411),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  CE+NGY IPKG+TLLV+VWAI RDP  W +PLEF P+RFLP GEKP+VD++G
Sbjct  376  LPRMASDSCEVNGYHIPKGSTLLVDVWAIGRDPKQWVDPLEFRPNRFLPNGEKPHVDVKG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV +L AT+VH+FDW
Sbjct  436  NDFEVIPFGAGRRICVGLSLGLRMVQMLTATIVHSFDW  473


 Score = 47.4 bits (111),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  322
             F   L NG + + LNM+E YGLTL+RA PL++HP+PRL
Sbjct  470  SFDWTLPNGLTPDKLNMDEHYGLTLRRAQPLIMHPRPRL  508



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   160 bits (406),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C I GY IPK AT LVNVWAI RDP+VWT+PLEF P RFLPGGE+ +VD+RG
Sbjct  375  LPRMSSEECVIGGYRIPKHATPLVNVWAIGRDPSVWTDPLEFRPARFLPGGEREHVDVRG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLGIRMV L+ AT+VHAFDW
Sbjct  435  NDFEVIPFGAGRRICAGMSLGIRMVQLMTATIVHAFDW  472


 Score = 48.9 bits (115),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
             F   L  G   E L+MEEAYGLTLQRAVPL LHP PRL    Y +
Sbjct  469  AFDWTLPGGFKPEHLDMEEAYGLTLQRAVPLDLHPVPRLLKQSYLI  514



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   152 bits (385),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  369  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFRPERFLPGGEKAGVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SL +R + LL ATLVH F+W
Sbjct  429  NDFELIPFGAGRRICAGLSLWLRTIQLLTATLVHGFEW  466


 Score = 57.0 bits (136),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPKPRL    Y L 
Sbjct  464  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYGLG  509



>ref|XP_008791304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=517

 Score =   149 bits (377),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM A+ CE+ GY IPKGATLLVNVWAIARDP VW +PLEF P RFLP G    +D++G
Sbjct  378  LPRMAAEECEVAGYCIPKGATLLVNVWAIARDPAVWRDPLEFRPARFLPDGGCEGMDVKG  437

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDF +IPFGAGRRIC+ MSLGIRMV  + ATL HAF W
Sbjct  438  NDFGIIPFGAGRRICAGMSLGIRMVQFMTATLAHAFHW  475


 Score = 60.1 bits (144),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  DL  GQ  E L+MEEAYGLTLQRA PLM+HP PRL P  Y
Sbjct  472  AFHWDLPEGQITEKLDMEEAYGLTLQRATPLMVHPVPRLAPTAY  515



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   156 bits (395),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  369  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFRPERFLPGGEKAGVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  429  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  466


 Score = 52.4 bits (124),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  464  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   156 bits (395),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CEINGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  369  LPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFRPERFLPGGEKAGVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  429  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  466


 Score = 52.4 bits (124),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+TLQRAVPL++HPK RL    Y L 
Sbjct  464  FEWELAGGVTPEKLNMEETYGITLQRAVPLVVHPKLRLDMSAYGLG  509



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   153 bits (387),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + A+ CEINGY IPKG+TLL N+WAIARDP  W++PL F P RFLPGGEK  VD++G
Sbjct  371  LPHIAAESCEINGYHIPKGSTLLTNIWAIARDPEQWSDPLAFRPERFLPGGEKFGVDVKG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  431  SDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  468


 Score = 55.8 bits (133),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTLN  298
            F  +L  G + E LNMEE YG+T+QRAVPL++HPKPRL  ++Y + 
Sbjct  466  FEWELAGGVTPEKLNMEETYGITVQRAVPLIVHPKPRLALNVYGVG  511



>ref|XP_003574810.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=548

 Score =   150 bits (378),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++GY IPKG TLLVNVWAIARDP  W +PLEF P RFLPGG    VD++G
Sbjct  405  LPRLAAEECEVDGYRIPKGTTLLVNVWAIARDPASWADPLEFRPARFLPGGSHEGVDVKG  464

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             D+E+IPFGAGRRIC+ +S G+RMV L+ ATLVH FDW
Sbjct  465  GDYELIPFGAGRRICAGLSWGLRMVTLMTATLVHGFDW  502


 Score = 58.2 bits (139),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            F   LVNG + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y +
Sbjct  500  FDWALVNGMTPDKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYAV  544



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   160 bits (406),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  CE+NGY IPKG+TLLV+VWAI RDP  W +PLEF P+RFLP GEKP+VD++G
Sbjct  380  LPRMASDSCEVNGYHIPKGSTLLVDVWAIGRDPKEWVDPLEFGPNRFLPDGEKPHVDVKG  439

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE IPFGAGRRIC  +SLG+RMV +L AT+VH+FDW
Sbjct  440  NDFEAIPFGAGRRICVGLSLGLRMVQMLTATIVHSFDW  477


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  322
             F   L NG + + LNM+E YGLTL+RA PL++HP+PRL
Sbjct  474  SFDWALPNGLTPDKLNMDEHYGLTLRRAQPLVVHPRPRL  512



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   149 bits (377),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ C +NGY IPK  TLLVNVWAI+RDP VW  PLEF P RFL GG    VD++G
Sbjct  369  LPRISSEACTVNGYLIPKNTTLLVNVWAISRDPGVWKEPLEFRPERFLGGGGYETVDLKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRR+C+ +SLG+RMV  L ATLVH FDW
Sbjct  429  NDFELIPFGAGRRVCAGLSLGLRMVQFLTATLVHGFDW  466


 Score = 57.4 bits (137),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   LV+GQS E L+MEEAYGL LQRAVPLM+ P PRL    Y
Sbjct  464  FDWKLVDGQSAEKLDMEEAYGLPLQRAVPLMVRPVPRLDEKAY  506



>ref|NP_001141292.1| uncharacterized protein LOC100273383 [Zea mays]
 gb|ACF85998.1| unknown [Zea mays]
Length=457

 Score =   147 bits (371),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PLEF P RFLPGG    VD++G
Sbjct  318  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLEFRPARFLPGGSHAGVDVKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  378  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  415


 Score = 58.9 bits (141),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  416  DLADGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  456



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   155 bits (392),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C INGY IPK ATLLVNVWAIARDP VW  P+EF P RF+PGG+  ++D++G
Sbjct  320  LPRMASESCTINGYHIPKNATLLVNVWAIARDPAVWAAPVEFKPDRFMPGGDGAHLDVKG  379

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFEVIPFGAGRRIC+ MSLG+RMV  + ATLVH FDW
Sbjct  380  SDFEVIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDW  417


 Score = 50.8 bits (120),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRL  322
            F   L NG   E L+MEEAYGLTLQRAVPLM+ P PRL
Sbjct  415  FDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVVPVPRL  452



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   157 bits (397),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W +PL+F P RFLPG EK NVDI+G
Sbjct  318  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPDPLKFKPERFLPGNEKANVDIKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV  + ATL+H F+W
Sbjct  378  NDFEVIPFGAGRRICAGLSLGLRMVQFMTATLIHGFNW  415


 Score = 48.5 bits (114),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  337
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+H
Sbjct  413  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVH  445



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   161 bits (408),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM +  CE+NGY IPKG+TLLV+VWAI RDP  W +PLEF P+RFLP GEKP+VD++G
Sbjct  350  LPRMASDSCEVNGYHIPKGSTLLVDVWAIGRDPKQWVDPLEFRPNRFLPNGEKPHVDVKG  409

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC  +SLG+RMV +L AT+VH+FDW
Sbjct  410  NDFEVIPFGAGRRICVGLSLGLRMVQMLTATIVHSFDW  447


 Score = 44.7 bits (104),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKP  328
             F   L NG + + LNM+E YGLTL+RA PL++HP+P
Sbjct  444  SFDWTLPNGLTPDKLNMDEHYGLTLRRAQPLIMHPRP  480



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   153 bits (387),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR     CE+ GY IP GATLLVNVWAIARDP VW  PLEF P RFLPGGE  +VD+RG
Sbjct  369  LPRASTGSCEVGGYHIPGGATLLVNVWAIARDPAVWPCPLEFRPERFLPGGEHTHVDVRG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             DFE+IPFGAGRRIC+ M++G+RMV  L ATLVHAFDW
Sbjct  429  TDFELIPFGAGRRICAGMTMGLRMVQFLTATLVHAFDW  466


 Score = 52.4 bits (124),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L  GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  464  FDWALPEGQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  506



>gb|AHB18038.1| flavonoid 3'-hydroxylase, partial [Anthurium andraeanum]
Length=292

 Score =   152 bits (385),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR  +  CE+ GY IP GATLLVNVWAIARDP VW  PLEF P RFLPGGE  +VD+RG
Sbjct  150  LPRASSGSCEVGGYHIPGGATLLVNVWAIARDPAVWPCPLEFRPERFLPGGEHTHVDVRG  209

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             DFE+IPFGA RRIC+ M++G+RMV  L ATLVHAFDW
Sbjct  210  TDFELIPFGAARRICAGMTMGLRMVQFLTATLVHAFDW  247


 Score = 53.1 bits (126),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ+ E L+MEEA+GLTLQRAVPL   P PRL P  Y
Sbjct  244  AFDWALPEGQTPEKLDMEEAFGLTLQRAVPLQARPTPRLSPEAY  287



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   146 bits (369),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PLEF P RFLPGG    VD++G
Sbjct  376  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLEFRPARFLPGGSHAGVDVKG  435

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  436  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  473


 Score = 58.9 bits (141),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  474  DLADGMTADKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  514



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   153 bits (386),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C INGY IPK ATLLVNVWAIARDP VW  P+EF P RF+PGG+  ++D++G
Sbjct  371  LPRMASESCTINGYHIPKNATLLVNVWAIARDPAVWAAPVEFKPDRFMPGGDGAHLDVKG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ MSLG+RMV  + ATLVH FDW
Sbjct  431  SDFEMIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDW  468


 Score = 52.0 bits (123),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  466  FDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   152 bits (383),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR     CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RF PGGEK +VD++G
Sbjct  369  LPRFAENSCEIFNYHIPKGATLLVNVWAIGRDPKEWIDPLEFKPERFFPGGEKDDVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FE+IPFGAGRRIC  MSLG+++V LL+ATL H+FDW
Sbjct  429  NNFELIPFGAGRRICVGMSLGLKVVQLLIATLAHSFDW  466


 Score = 53.1 bits (126),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  464  FDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   152 bits (383),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR     CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RF PGGEK +VD++G
Sbjct  369  LPRFAENSCEIFNYHIPKGATLLVNVWAIGRDPKEWIDPLEFKPERFFPGGEKDDVDVKG  428

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FE+IPFGAGRRIC  MSLG+++V LL+ATL H+FDW
Sbjct  429  NNFELIPFGAGRRICVGMSLGLKVVQLLIATLAHSFDW  466


 Score = 53.1 bits (126),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  464  FDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  506



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   152 bits (385),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C INGY IPK ATLLVNVWAIARDP VW  P+EF P RF+PGG+  ++D++G
Sbjct  371  LPRMASESCTINGYHIPKNATLLVNVWAIARDPAVWAAPVEFKPDRFMPGGDGVHLDVKG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ MSLG+RMV  + ATLVH FDW
Sbjct  431  SDFEMIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDW  468


 Score = 52.0 bits (123),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F   L NG   E L+MEEAYGLTLQRAVPLM+ P PRL    Y
Sbjct  466  FDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVLPVPRLAKQAY  508



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   145 bits (367),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 58.5 bits (140),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  475  DLADGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  515



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   145 bits (367),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  375  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  434

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  435  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  472


 Score = 58.5 bits (140),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  473  DLADGMTADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYA  513



>ref|XP_007155245.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27239.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=368

 Score =   151 bits (381),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR+  + CEI GY IPKGATLLVNVWAI RDP  W++PLEF P RFL GGEK  VD++G
Sbjct  226  IPRISEESCEIFGYHIPKGATLLVNVWAIGRDPKEWSDPLEFKPERFLLGGEKGGVDVKG  285

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC+ MSLG+  V LL ATL HAFDW
Sbjct  286  NNFEVIPFGAGRRICAGMSLGLVEVQLLTATLAHAFDW  323


 Score = 52.8 bits (125),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  325
             F  +L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  320  AFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  357



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   151 bits (381),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR     CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RFLPG EK +VD++G
Sbjct  371  LPRFAENSCEIFNYHIPKGATLLVNVWAIGRDPKEWIDPLEFKPERFLPGNEKVDVDVKG  430

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FE+IPFGAGRRIC  MSLG+++V LL+ATL H+FDW
Sbjct  431  NNFELIPFGAGRRICVGMSLGLKIVQLLIATLAHSFDW  468


 Score = 52.8 bits (125),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            F  +L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y+
Sbjct  466  FDWELENGTDPKRLNMDETYGITLQKAMPLSVHPHPRLSQHVYS  509



>ref|XP_007155243.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
 gb|ESW27237.1| hypothetical protein PHAVU_003G1855001g, partial [Phaseolus vulgaris]
Length=364

 Score =   151 bits (381),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR+  + CEI GY IPKGATLLVNVWAI RDP  W++PLEF P RFL GGEK  VD++G
Sbjct  222  IPRISEESCEIFGYHIPKGATLLVNVWAIGRDPKEWSDPLEFKPERFLLGGEKGGVDVKG  281

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC+ MSLG+  V LL ATL HAFDW
Sbjct  282  NNFEVIPFGAGRRICAGMSLGLVEVQLLTATLAHAFDW  319


 Score = 52.8 bits (125),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  325
             F  +L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  316  AFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  353



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   149 bits (375),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+ GY +PKG+ L VNVWAIAR   +WT+PLEF P RFL  GEKPNV+++ 
Sbjct  364  LPRIASESCEVKGYHVPKGSILFVNVWAIARQSELWTDPLEFRPGRFLIPGEKPNVEVKP  423

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE++PFG GRRIC+ MSLG+RMV+LL+ATLV AFDW
Sbjct  424  NDFEIVPFGGGRRICAGMSLGLRMVNLLIATLVQAFDW  461


 Score = 55.1 bits (131),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG  +E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  458  AFDWELANGLELEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>ref|XP_006579509.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Glycine 
max]
Length=365

 Score =   150 bits (380),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR     CEI  Y IPKGATLLVNVWAI RDP  W +PLEF P RF PGGEK +VD++G
Sbjct  222  LPRFAENSCEIFNYHIPKGATLLVNVWAIGRDPKEWIDPLEFKPERFFPGGEKDDVDVKG  281

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FE+IPFGAGRRIC  MSLG+++V LL+ATL H+FDW
Sbjct  282  NNFELIPFGAGRRICVGMSLGLKVVQLLIATLAHSFDW  319


 Score = 52.8 bits (125),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L NG   + LNM+E YG+TLQ+A+PL +HP PRL  H+Y
Sbjct  317  FDWELENGADPKRLNMDETYGITLQKALPLFVHPHPRLSQHVY  359



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   154 bits (390),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP M ++ CE+NGY IP+  T+L+N+WAI+RDP VWT+PLEF P RFLPGG   ++D++G
Sbjct  388  LPHMSSESCEVNGYHIPQNTTVLINIWAISRDPAVWTDPLEFRPSRFLPGGGYEHIDVKG  447

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRR+C+ +SLG+RMV L+ ATLVHAFDW
Sbjct  448  NDFELIPFGAGRRMCAGLSLGLRMVQLVTATLVHAFDW  485


 Score = 48.9 bits (115),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  411  QSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            Q  E L+MEEAYG+TLQR VPLM HP PRL    Y
Sbjct  491  QRAEELDMEEAYGVTLQREVPLMAHPIPRLAQKAY  525



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   145 bits (367),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 57.4 bits (137),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  475  DLADGMTANKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>ref|XP_007155244.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
 gb|ESW27238.1| hypothetical protein PHAVU_003G1855001g [Phaseolus vulgaris]
Length=329

 Score =   150 bits (379),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            +PR+  + CEI GY IPKGATLLVNVWAI RDP  W++PLEF P RFL GGEK  VD++G
Sbjct  187  IPRISEESCEIFGYHIPKGATLLVNVWAIGRDPKEWSDPLEFKPERFLLGGEKGGVDVKG  246

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N+FEVIPFGAGRRIC+ MSLG+  V LL ATL HAFDW
Sbjct  247  NNFEVIPFGAGRRICAGMSLGLVEVQLLTATLAHAFDW  284


 Score = 52.8 bits (125),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPR  325
             F  +L NG   ++LNM+EAYGLTLQRAVPL +HP+PR
Sbjct  281  AFDWELENGLDPKSLNMDEAYGLTLQRAVPLSVHPRPR  318



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   144 bits (362),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  804  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPARFLPGGSHAGVDVKG  863

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA +W
Sbjct  864  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALEW  901


 Score = 58.9 bits (141),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  902  DLADGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  942



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   143 bits (361),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  381  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPARFLPGGSHAGVDVKG  440

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA +W
Sbjct  441  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALEW  478


 Score = 59.3 bits (142),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + E L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  479  DLADGVTAEKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  519



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   145 bits (367),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 56.6 bits (135),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G +   L+MEEAYGLTLQRAVPLM+ P PRL P  Y 
Sbjct  475  DLADGMTAYKLDMEEAYGLTLQRAVPLMVRPAPRLLPSAYA  515



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   155 bits (393),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W +PL F P RFLPG EK NVDI+G
Sbjct  318  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPDPLRFKPERFLPGNEKANVDIKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ +SLG+RMV    ATL+H F+W
Sbjct  378  NDFEVIPFGAGRRICAGLSLGLRMVQFTTATLIHGFNW  415


 Score = 46.6 bits (109),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  337
            F  +L  GQ +E L+M+EAYGLTLQRA PLM+H
Sbjct  413  FNWELPEGQVIEKLSMDEAYGLTLQRASPLMVH  445



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   146 bits (368),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRIAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 55.8 bits (133),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  475  DLADGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   146 bits (368),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRIAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 55.8 bits (133),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  475  DLADGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   146 bits (368),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ A+ CE++G+ IP G TLLVNVWAIARDP  W  PL+F P RFLPGG    VD++G
Sbjct  377  LPRIAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRPDRFLPGGSHAGVDVKG  436

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFE+IPFGAGRRIC+ +S G+RMV L+ ATLVHA DW
Sbjct  437  SDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDW  474


 Score = 55.8 bits (133),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  426  DLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYT  304
            DL +G + + L+MEEAYGLTLQRAVPL + P PRL P  Y 
Sbjct  475  DLADGMTADKLDMEEAYGLTLQRAVPLKVRPAPRLLPSAYA  515



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   148 bits (374),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+ ++ CE+ GY +PKG+ L VNVWAIAR   +WT+PLEF P RFL  GEKPNV+++ 
Sbjct  364  LPRIASESCEVKGYHVPKGSILFVNVWAIARQSELWTDPLEFRPGRFLIPGEKPNVEVKP  423

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE++PFG GRRIC+ MSLG+RMV+LL+ATLV AFDW
Sbjct  424  NDFEIVPFGGGRRICAGMSLGLRMVNLLIATLVQAFDW  461


 Score = 53.5 bits (127),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F  +L NG   E LNMEE +G++LQR  PL++HP+PRL  H+Y
Sbjct  458  AFDWELANGLEPEKLNMEEVFGISLQRVQPLLVHPRPRLARHVY  501



>gb|ABQ81928.1| flavonoid 3-hydroxylase [Brassica rapa var. purpuraria]
Length=189

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LP + ++ CE+NGY IPKG+TLL N+WAIARDP+ W++PL F P RFLPGGEK  VD++G
Sbjct  78   LPHIASESCEVNGYHIPKGSTLLTNIWAIARDPDQWSDPLTFRPERFLPGGEKAGVDVKG  137

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFE+IPFGAGRRIC+ +SLG+R + LL ATLVH F+W
Sbjct  138  NDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEW  175



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   142 bits (357),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR  A  CE++GY IPKG TLLVNVWAI RDP +W +PLE+ P RFLPGG    VD++G
Sbjct  383  LPREAAGDCEVDGYSIPKGTTLLVNVWAIGRDPAMWPDPLEYRPARFLPGGTHAEVDVKG  442

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DF +IPFGAGRRIC+ +S G+RMV L+ ATL+H FDW
Sbjct  443  SDFGLIPFGAGRRICAGLSWGLRMVTLMTATLLHGFDW  480


 Score = 59.3 bits (142),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            F   L NG++ + LNMEEAYGLTLQRAVPLM+ P PRL P  Y L
Sbjct  478  FDWALANGETPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGL  522



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   152 bits (385),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W +PL+F P RFLPG EK NVDI+G
Sbjct  318  LPRVSVEDCEIDGYFIPKNTTLLTNVWAIARDPLMWPDPLKFKPERFLPGNEKANVDIKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEV+PFGAGRRIC+ +SLG+RMV  + ATL+  F+W
Sbjct  378  NDFEVVPFGAGRRICAGLSLGLRMVQFMTATLIPGFNW  415


 Score = 48.5 bits (114),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLH  337
            F  +L  GQ +E LNM+EAYGLTLQRA PLM+H
Sbjct  413  FNWELPEGQVIEKLNMDEAYGLTLQRASPLMVH  445



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI GYFIPK  TLL NVWAIARDP++W +PL+F P RFLPG EK NVDI+G
Sbjct  318  LPRVSVEDCEIEGYFIPKNTTLLTNVWAIARDPSMWPDPLKFKPERFLPGSEKANVDIKG  377

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV  + ATL+H +DW
Sbjct  378  NDFEVIPFGAGRRICAGMSLGLRMVQFMTATLIHGYDW  415



>gb|EMT05634.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=241

 Score =   140 bits (353),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVW-TNPLEFNPHRFLPGGEKPNVDIR  543
            LPR+ A+ CE++GY IPK  TLLVNVWAIARDP  W  + LEF P RFLPGG   +VD++
Sbjct  101  LPRVAAEDCEVDGYRIPKDTTLLVNVWAIARDPASWGDDVLEFRPTRFLPGGSHESVDVK  160

Query  542  GNDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            G D+E+IPFGAGRRIC+ +S G+RMV L  ATLVHAFDW
Sbjct  161  GGDYELIPFGAGRRICAGLSWGLRMVTLTTATLVHAFDW  199


 Score = 60.1 bits (144),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
             F   LV+G + E L+MEEAYGLTLQRAVPLM+ P PRL P  YT+
Sbjct  196  AFDWTLVDGMTPEKLDMEEAYGLTLQRAVPLMVQPVPRLLPSAYTM  241



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   142 bits (359),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR  A+ CE++GY IPKGATLLVNVWAIARDP  W +PL++ P RFLPG    +VD++G
Sbjct  387  LPREAAEECEVDGYRIPKGATLLVNVWAIARDPTQWPDPLQYQPSRFLPGRMHADVDVKG  446

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
             DF +IPFGAGRRIC+ +S G+RMV L+ ATLVH FDW
Sbjct  447  ADFGLIPFGAGRRICAGLSWGLRMVTLMTATLVHGFDW  484


 Score = 57.4 bits (137),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLYTL  301
            F   L NG + + LNMEEAYGLTLQRAVPLM+ P PRL P  Y +
Sbjct  482  FDWTLANGATPDKLNMEEAYGLTLQRAVPLMVQPVPRLLPSAYGV  526



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   154 bits (390),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C ING+ IPK ATLLVNVWAIARDP VW++P+EF P RF+PGG+   +D++G
Sbjct  370  LPRMASESCTINGFHIPKHATLLVNVWAIARDPAVWSDPVEFKPSRFMPGGDGARLDVKG  429

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFEVIPFGAGRRIC+ MSLG+RMV  + ATLVH FDW
Sbjct  430  SDFEVIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDW  467


 Score = 45.4 bits (106),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  435  F*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
            F  +L  G   E L+MEEAYGLTLQRAVPL + P  RL    Y
Sbjct  465  FDWELPKGVVAEKLDMEEAYGLTLQRAVPLTVMPVQRLTARAY  507



>gb|AGL98409.1| flavonoid 3'-hydroxylase, partial [Tulipa fosteriana]
Length=216

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM ++ C ING+ IPK ATLLVNVWAIARDP VW++P+EF P RF+PGG+   +D++G
Sbjct  77   LPRMASESCTINGFHIPKHATLLVNVWAIARDPAVWSDPVEFKPSRFMPGGDGARLDVKG  136

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            +DFEVIPFGAGRRIC+ MSLG+RMV  + ATLVH FDW
Sbjct  137  SDFEVIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDW  174



>gb|AHX02955.1| flavonoid 3'5'-hydroxylase [Iris x hollandica]
Length=535

 Score =   148 bits (374),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPRM  + CE++G+ IPKGATLLVN+WA+ RDP++W NP  F+P RFLPGG+  +VD+RG
Sbjct  395  LPRMALEDCEVDGFRIPKGATLLVNIWAMGRDPSIWPNPHVFSPARFLPGGQGEHVDVRG  454

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            N FE++PFGAGRRIC+  S+GIR+VH  VATL+HAFDW
Sbjct  455  NSFELMPFGAGRRICAGTSMGIRVVHSTVATLIHAFDW  492


 Score = 50.4 bits (119),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F   L  GQ  E ++MEEA+G++LQ+A+PLM HP PRL    Y
Sbjct  489  AFDWALPKGQVAEDMDMEEAFGISLQKAIPLMAHPIPRLASKAY  532



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  719  LPRMGAQGCEINGYFIPKGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRG  540
            LPR+  + CEI+GYFIPK  TLL NVWAIARDP +W++PL+F P RFLPG EK NVDI G
Sbjct  323  LPRVSDEDCEIDGYFIPKNTTLLTNVWAIARDPLMWSDPLKFKPERFLPGNEKANVDIMG  382

Query  539  NDFEVIPFGAGRRICSRMSLGIRMVHLLVATLVHAFDW  426
            NDFEVIPFGAGRRIC+ MSLG+RMV  + ATL+H F+W
Sbjct  383  NDFEVIPFGAGRRICAGMSLGLRMVQFMTATLIHGFNW  420



>dbj|BAJ16337.1| flavonoid 3' hydroxylase-like protein, partial [Torenia fournieri]
Length=121

 Score =   134 bits (338),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -2

Query  668  KGATLLVNVWAIARDPNVWTNPLEFNPHRFLPGGEKPNVDIRGNDFEVIPFGAGRRICSR  489
            KG+TLLVNVWAIARDP VW +PLEF P RFL GGEK +VD++GNDFEVIPFGAGRRIC+ 
Sbjct  1    KGSTLLVNVWAIARDPKVWADPLEFRPERFLTGGEKADVDVKGNDFEVIPFGAGRRICAG  60

Query  488  MSLGIRMVHLLVATLVHAFD  429
            + LGIRMV LL A+L+HAFD
Sbjct  61   VGLGIRMVQLLTASLIHAFD  80


 Score = 63.5 bits (153),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  438  CF*LDLVNGQSVETLNMEEAYGLTLQRAVPLMLHPKPRLQPHLY  307
             F LDL NG   + LNMEEAYGLTLQRA PL++HP+PRL  H+Y
Sbjct  78   AFDLDLANGLLAQNLNMEEAYGLTLQRAEPLLVHPRPRLATHVY  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425