BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016J05

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               404   3e-139   Sesamum indicum [beniseed]
emb|CDO99096.1|  unnamed protein product                                404   3e-139   Coffea canephora [robusta coffee]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             396   3e-136   Solanum tuberosum [potatoes]
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    395   1e-135   Catharanthus roseus [chatas]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               394   1e-135   Solanum lycopersicum
gb|AFK33413.1|  unknown                                                 389   2e-133   Lotus japonicus
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             389   2e-133   Vitis vinifera
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               388   5e-133   Eucalyptus grandis [rose gum]
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             387   1e-132   Medicago truncatula
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          387   1e-132   Sesamum indicum [beniseed]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        387   1e-132   Tarenaya hassleriana [spider flower]
gb|KHN30486.1|  40S ribosomal protein S3a                               386   1e-132   Glycine soja [wild soybean]
gb|EPS71864.1|  hypothetical protein M569_02887                         387   2e-132   Genlisea aurea
ref|NP_001241005.1|  uncharacterized protein LOC100805519               387   2e-132   Glycine max [soybeans]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          386   4e-132   Nelumbo nucifera [Indian lotus]
ref|NP_001239858.1|  uncharacterized protein LOC100808747               386   4e-132   Glycine max [soybeans]
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               385   4e-132   Elaeis guineensis
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  385   5e-132   Elaeis guineensis
gb|KDP23643.1|  hypothetical protein JCGZ_23476                         385   7e-132   Jatropha curcas
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          385   9e-132   Cicer arietinum [garbanzo]
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               385   1e-131   Cucumis melo [Oriental melon]
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          384   1e-131   Eucalyptus grandis [rose gum]
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a-like          384   1e-131   Cucumis sativus [cucumbers]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             384   2e-131   Phaseolus vulgaris [French bean]
ref|XP_010090259.1|  40S ribosomal protein S3a                          384   2e-131   Morus notabilis
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          384   2e-131   Elaeis guineensis
ref|XP_006382773.1|  40S ribosomal protein S3A                          384   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               383   4e-131   Populus euphratica
ref|XP_007030615.1|  Ribosomal protein S3Ae                             383   5e-131   
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        383   6e-131   Tarenaya hassleriana [spider flower]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               383   6e-131   Glycine max [soybeans]
ref|XP_004145387.1|  PREDICTED: 40S ribosomal protein S3a-like          383   6e-131   
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             383   6e-131   
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          382   8e-131   Cucumis melo [Oriental melon]
gb|ACU18272.1|  unknown                                                 382   8e-131   Glycine max [soybeans]
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                382   1e-130   Erythranthe guttata [common monkey flower]
gb|KHN02741.1|  40S ribosomal protein S3a                               382   1e-130   Glycine soja [wild soybean]
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        381   2e-130   Tarenaya hassleriana [spider flower]
ref|NP_001265990.1|  40S ribosomal protein S3a                          381   3e-130   Cicer arietinum [garbanzo]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          381   3e-130   Nelumbo nucifera [Indian lotus]
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               380   4e-130   Nicotiana sylvestris
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    380   4e-130   Nicotiana tomentosiformis
gb|ABK93399.1|  unknown                                                 380   6e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             380   1e-129   Nelumbo nucifera [Indian lotus]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             380   1e-129   Populus euphratica
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             379   1e-129   Capsella rubella
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     379   2e-129   
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               379   2e-129   Phoenix dactylifera
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    379   2e-129   Phoenix dactylifera
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    379   2e-129   Nicotiana tomentosiformis
ref|XP_006848758.1|  hypothetical protein AMTR_s00026p00042160          379   3e-129   Amborella trichopoda
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                379   3e-129   Ricinus communis
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          379   3e-129   Nicotiana sylvestris
gb|ABK56834.1|  RPS3                                                    379   3e-129   Cymbidium hybrid cultivar
ref|XP_002314671.2|  ribosomal protein S3a                              378   3e-129   Populus trichocarpa [western balsam poplar]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               378   4e-129   Solanum lycopersicum
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        378   5e-129   Camelina sativa [gold-of-pleasure]
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             378   5e-129   Phaseolus vulgaris [French bean]
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        378   6e-129   Nelumbo nucifera [Indian lotus]
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             377   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        377   8e-129   Populus euphratica
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   377   8e-129   
ref|NP_195193.1|  40S ribosomal protein S3a-2                           377   9e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                377   9e-129   Ricinus communis
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             377   9e-129   Camelina sativa [gold-of-pleasure]
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   377   1e-128   Theobroma cacao [chocolate]
ref|XP_004168031.1|  PREDICTED: 40S ribosomal protein S3a-like          375   1e-128   
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    377   1e-128   Nicotiana tomentosiformis
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             377   1e-128   Eutrema salsugineum [saltwater cress]
ref|XP_003638196.1|  40S ribosomal protein S3a                          376   2e-128   
gb|ACJ85751.1|  unknown                                                 377   2e-128   Medicago truncatula
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             376   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        376   3e-128   Camelina sativa [gold-of-pleasure]
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    376   4e-128   Daucus carota [carrots]
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         375   6e-128   Helianthus annuus
emb|CDO98656.1|  unnamed protein product                                375   7e-128   Coffea canephora [robusta coffee]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             375   9e-128   Phaseolus vulgaris [French bean]
gb|KHG05975.1|  40S ribosomal S3a                                       374   1e-127   Gossypium arboreum [tree cotton]
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        374   2e-127   Tarenaya hassleriana [spider flower]
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               374   2e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    374   2e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                387   2e-127   Erythranthe guttata [common monkey flower]
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             374   3e-127   Eutrema salsugineum [saltwater cress]
gb|KJB34507.1|  hypothetical protein B456_006G069600                    374   3e-127   Gossypium raimondii
ref|NP_001066631.1|  Os12g0406200                                       373   3e-127   
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             373   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002882377.1|  40S ribosomal protein S3A                          373   4e-127   
gb|KJB72261.1|  hypothetical protein B456_011G167500                    373   4e-127   Gossypium raimondii
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        373   5e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002312545.2|  ribosomal protein S3a                              373   6e-127   
gb|KDP40219.1|  hypothetical protein JCGZ_02217                         372   1e-126   Jatropha curcas
gb|KHG19560.1|  40S ribosomal S3a                                       372   1e-126   Gossypium arboreum [tree cotton]
emb|CDX75453.1|  BnaA01g02490D                                          372   2e-126   
ref|NP_187135.1|  40S ribosomal protein S3a-1                           371   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869131.1|  40S ribosomal protein S3A                          371   2e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               371   3e-126   Brachypodium distachyon [annual false brome]
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          371   3e-126   Brachypodium distachyon [annual false brome]
emb|CDX76296.1|  BnaA08g11040D                                          371   3e-126   
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          371   4e-126   Oryza brachyantha
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          370   4e-126   Oryza brachyantha
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          370   4e-126   Oryza brachyantha
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        370   5e-126   Camelina sativa [gold-of-pleasure]
ref|XP_006838990.1|  hypothetical protein AMTR_s00002p00271660          370   5e-126   
emb|CDX69078.1|  BnaC01g03750D                                          370   5e-126   
dbj|BAA00860.1|  cyc07                                                  369   6e-126   Catharanthus roseus [chatas]
ref|NP_001275123.1|  cyc07-like protein                                 370   8e-126   Solanum tuberosum [potatoes]
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        370   9e-126   Brassica rapa
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               369   1e-125   Solanum lycopersicum
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             369   1e-125   Prunus mume [ume]
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    369   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        369   1e-125   Vitis vinifera
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    369   2e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     369   2e-125   Solanum tuberosum [potatoes]
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             369   2e-125   Brassica rapa
gb|KJB38202.1|  hypothetical protein B456_006G241700                    369   3e-125   Gossypium raimondii
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             369   3e-125   Capsella rubella
ref|NP_001049289.1|  Os03g0200500                                       368   3e-125   
gb|ABB55362.1|  cyc07-like                                              368   3e-125   Solanum tuberosum [potatoes]
emb|CDY50760.1|  BnaAnng10670D                                          368   4e-125   Brassica napus [oilseed rape]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          368   4e-125   Setaria italica
emb|CDY21109.1|  BnaA01g33400D                                          368   4e-125   Brassica napus [oilseed rape]
gb|ABK22319.1|  unknown                                                 367   4e-125   Picea sitchensis
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          368   4e-125   Oryza brachyantha
emb|CDY30019.1|  BnaC01g39890D                                          369   5e-125   Brassica napus [oilseed rape]
gb|ABB72808.1|  cyc07-like protein                                      367   8e-125   Solanum tuberosum [potatoes]
emb|CDY40680.1|  BnaC03g33960D                                          367   8e-125   Brassica napus [oilseed rape]
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          367   9e-125   Brachypodium distachyon [annual false brome]
dbj|BAA05057.1|  cyc07                                                  366   1e-124   Catharanthus roseus [chatas]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        367   1e-124   Brassica rapa
gb|KHG11221.1|  40S ribosomal S3a                                       366   2e-124   Gossypium arboreum [tree cotton]
ref|XP_010092425.1|  40S ribosomal protein S3a                          366   2e-124   
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          366   2e-124   Glycine max [soybeans]
emb|CDX74165.1|  BnaA03g28820D                                          366   2e-124   
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    366   3e-124   Setaria italica
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             366   3e-124   Brassica rapa
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        365   4e-124   Brassica rapa
ref|NP_001046578.1|  Os02g0287000                                       365   4e-124   
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             365   6e-124   Citrus clementina [clementine]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             365   7e-124   Prunus persica
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    365   7e-124   Arabis alpina [alpine rockcress]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          370   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    363   2e-123   
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   363   2e-123   Citrus sinensis [apfelsine]
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             364   2e-123   Selaginella moellendorffii
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    363   3e-123   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   362   3e-123   Citrus sinensis [apfelsine]
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             363   4e-123   Citrus clementina [clementine]
gb|KEH32959.1|  40S ribosomal protein S3a-1                             363   4e-123   Medicago truncatula
dbj|BAJ93929.1|  predicted protein                                      362   8e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             362   9e-123   Fragaria vesca subsp. vesca
gb|ABE66401.1|  S phase protein                                         359   1e-122   Striga asiatica [witchweed]
ref|NP_001152574.1|  40S ribosomal protein S3a                          362   1e-122   Zea mays [maize]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               361   2e-122   Fragaria vesca subsp. vesca
ref|XP_001761018.1|  predicted protein                                  361   2e-122   
gb|ACN40078.1|  unknown                                                 361   2e-122   Picea sitchensis
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    361   2e-122   Arabis alpina [alpine rockcress]
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          360   4e-122   Sorghum bicolor [broomcorn]
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          360   4e-122   Sorghum bicolor [broomcorn]
ref|NP_001141038.1|  hypothetical protein                               360   4e-122   Zea mays [maize]
ref|NP_001288829.1|  40S ribosomal protein S3a                          360   6e-122   Brassica rapa
gb|AFW89330.1|  40S ribosomal protein S3a                               362   6e-122   
gb|AFW89335.1|  40S ribosomal protein S3a                               362   6e-122   
ref|XP_001765967.1|  predicted protein                                  360   8e-122   
ref|NP_001149096.1|  40S ribosomal protein S3a                          359   1e-121   Zea mays [maize]
gb|AGT16352.1|  40S ribosomal protein S3a                               358   5e-121   Saccharum hybrid cultivar R570
ref|XP_001767326.1|  predicted protein                                  357   1e-120   
gb|ACG33267.1|  40S ribosomal protein S3a                               356   1e-120   Zea mays [maize]
gb|ACG34058.1|  40S ribosomal protein S3a                               356   2e-120   Zea mays [maize]
gb|KJB38201.1|  hypothetical protein B456_006G241700                    355   3e-120   Gossypium raimondii
gb|EMT30223.1|  40S ribosomal protein S3a                               355   4e-120   
gb|EEE53089.1|  hypothetical protein OsJ_35850                          371   7e-120   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69140.1|  hypothetical protein OsI_38068                          372   1e-119   Oryza sativa Indica Group [Indian rice]
gb|EYU30365.1|  hypothetical protein MIMGU_mgv1a021183mg                352   1e-119   Erythranthe guttata [common monkey flower]
gb|EYU26004.1|  hypothetical protein MIMGU_mgv1a019927mg                351   2e-119   Erythranthe guttata [common monkey flower]
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               353   5e-119   Prunus mume [ume]
gb|KJB28385.1|  hypothetical protein B456_005G045000                    352   8e-119   Gossypium raimondii
gb|AAX55706.1|  cyc07                                                   350   2e-118   Vitis vinifera
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    351   7e-118   
gb|AAC98779.1|  S-phase-specific ribosomal protein                      349   9e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774632.1|  predicted protein                                  348   3e-117   
ref|XP_001755439.1|  predicted protein                                  347   1e-116   
gb|KJB28386.1|  hypothetical protein B456_005G045000                    346   2e-116   Gossypium raimondii
ref|XP_001777314.1|  predicted protein                                  345   4e-116   
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        342   8e-115   Malus domestica [apple tree]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        341   1e-114   Malus domestica [apple tree]
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     340   1e-114   Eucalyptus grandis [rose gum]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        340   5e-114   Pyrus x bretschneideri [bai li]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      338   7e-114   Vitis vinifera
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             351   1e-113   
gb|ACU17112.1|  unknown                                                 335   1e-112   Glycine max [soybeans]
gb|KJB28382.1|  hypothetical protein B456_005G045000                    335   3e-112   Gossypium raimondii
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    331   1e-110   Volvox carteri f. nagariensis
emb|CDY17474.1|  BnaC03g65890D                                          329   7e-110   Brassica napus [oilseed rape]
gb|KHN21710.1|  40S ribosomal protein S3a                               331   2e-109   Glycine soja [wild soybean]
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    326   1e-108   Chlamydomonas reinhardtii
ref|XP_001774288.1|  predicted protein                                  323   1e-107   
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   323   1e-107   Citrus sinensis [apfelsine]
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    320   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001765908.1|  predicted protein                                  318   6e-106   
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          319   6e-106   
ref|XP_005650618.1|  ribosomal protein S3Ae                             319   8e-106   Coccomyxa subellipsoidea C-169
gb|KHG19561.1|  40S ribosomal S3a                                       315   2e-104   Gossypium arboreum [tree cotton]
gb|AAP80855.1|  cyc07                                                   311   5e-103   Triticum aestivum [Canadian hard winter wheat]
emb|CBX25071.1|  40S ribosomal protein S3a                              310   2e-102   Polytomella sp. Pringsheim 198.80
emb|CEG00819.1|  Ribosomal protein S3Ae                                 306   6e-101   Ostreococcus tauri
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    306   7e-101   Ostreococcus lucimarinus CCE9901
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         305   2e-100   Syntrichia ruralis
ref|XP_002505259.1|  predicted protein                                  302   4e-99    Micromonas commoda
ref|XP_007508881.1|  predicted protein                                  300   3e-98    Bathycoccus prasinos
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    301   4e-98    
ref|XP_003060358.1|  predicted protein                                  293   7e-96    Micromonas pusilla CCMP1545
ref|XP_011395666.1|  40S ribosomal protein S3a                          292   2e-95    Auxenochlorella protothecoides
emb|CBI34197.3|  unnamed protein product                                288   2e-94    Vitis vinifera
ref|XP_003038024.1|  40S ribosomal protein S1                           286   7e-93    Schizophyllum commune H4-8
ref|XP_007862325.1|  40S ribosomal protein S1                           285   1e-92    Gloeophyllum trabeum ATCC 11539
gb|KIY51600.1|  ribosomal protein S3Ae                                  285   1e-92    Fistulina hepatica ATCC 64428
ref|XP_003638197.1|  40S ribosomal protein S3a                          281   2e-92    
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  285   2e-92    
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   284   3e-92    Suillus luteus UH-Slu-Lm8-n1
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   284   5e-92    Gelatoporia subvermispora B
ref|XP_007268611.1|  40S ribosomal protein S1                           283   9e-92    Fomitiporia mediterranea MF3/22
gb|ABI52667.1|  40S ribosomal protein S3a                               283   1e-91    Argas monolakensis
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          281   2e-91    Zea mays [maize]
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             282   2e-91    Serpula lacrymans var. lacrymans S7.9
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           282   2e-91    Punctularia strigosozonata HHB-11173 SS5
ref|XP_007843081.1|  40s ribosomal protein s3ae                         282   2e-91    
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   282   2e-91    Hebeloma cylindrosporum h7
ref|XP_007767741.1|  ribosomal protein S3Ae                             282   3e-91    Coniophora puteana RWD-64-598 SS2
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                  281   4e-91    Hydnomerulius pinastri MD-312
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  281   5e-91    Pisolithus microcarpus 441
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          281   6e-91    Laccaria bicolor S238N-H82
gb|ABW23199.1|  ribosomal protein rps3a                                 281   7e-91    Eurythoe complanata
gb|KIM33406.1|  hypothetical protein M408DRAFT_153936                   281   8e-91    Serendipita vermifera MAFF 305830
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267             280   8e-91    Phanerochaete carnosa HHB-10118-sp
gb|AFU72288.1|  40S ribosomal protein S1                                279   9e-91    Amanita strobiliformis
gb|KIJ20179.1|  hypothetical protein PAXINDRAFT_166304                  280   9e-91    Paxillus involutus ATCC 200175
gb|KJB28384.1|  hypothetical protein B456_005G045000                    279   1e-90    Gossypium raimondii
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   280   1e-90    Gymnopus luxurians FD-317 M1
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    280   1e-90    Lentinula edodes
gb|KJA29982.1|  hypothetical protein HYPSUDRAFT_81601                   280   1e-90    Hypholoma sublateritium FD-334 SS-4
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 280   1e-90    Scleroderma citrinum Foug A
ref|XP_001877091.1|  40S ribosomal protein S1                           280   2e-90    Laccaria bicolor S238N-H82
gb|KDD76342.1|  ribosomal protein S3Ae                                  280   2e-90    Helicosporidium sp. ATCC 50920
gb|KIY73683.1|  putative S-phase-specific ribosomal protein cyc07       280   2e-90    Cylindrobasidium torrendii FP15055 ss-10
gb|KIK06774.1|  hypothetical protein K443DRAFT_674057                   280   2e-90    Laccaria amethystina LaAM-08-1
gb|KCW84167.1|  hypothetical protein EUGRSUZ_B01030                     279   2e-90    Eucalyptus grandis [rose gum]
gb|KIM90711.1|  hypothetical protein PILCRDRAFT_811171                  280   2e-90    Piloderma croceum F 1598
ref|XP_001837102.1|  40S ribosomal protein S1                           280   2e-90    Coprinopsis cinerea okayama7#130
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                280   2e-90    Pediculus humanus corporis [human body lice]
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  280   3e-90    Fomitopsis pinicola FP-58527 SS1
gb|KDQ64848.1|  hypothetical protein JAAARDRAFT_28494                   279   3e-90    Jaapia argillacea MUCL 33604
ref|XP_002475466.1|  40S ribosomal protein S3A                          279   4e-90    
gb|KHG08611.1|  40S ribosomal S3a                                       275   4e-90    Gossypium arboreum [tree cotton]
emb|CDO74072.1|  hypothetical protein BN946_scf185043.g122              279   4e-90    Trametes cinnabarina
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       279   4e-90    Rhizophagus irregularis DAOM 197198w
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   279   4e-90    Botryobasidium botryosum FD-172 SS1
emb|CCM04869.1|  predicted protein                                      278   5e-90    Fibroporia radiculosa
gb|KIP10648.1|  hypothetical protein PHLGIDRAFT_84595                   278   5e-90    Phlebiopsis gigantea 11061_1 CR5-6
gb|KII94785.1|  hypothetical protein PLICRDRAFT_33595                   278   9e-90    Plicaturopsis crispa FD-325 SS-3
ref|XP_005710608.1|  40S ribosomal protein S3A                          278   1e-89    Chondrus crispus [carageen]
ref|XP_008035602.1|  40S ribosomal protein S1                           277   1e-89    Trametes versicolor FP-101664 SS1
ref|XP_007302916.1|  S-phase-specific ribosomal protein cyc07           276   3e-89    Stereum hirsutum FP-91666 SS1
emb|CCA67212.1|  probable ribosomal protein 10, cytosolic               276   3e-89    Serendipita indica DSM 11827
ref|XP_007329524.1|  hypothetical protein AGABI1DRAFT_106559            276   3e-89    Agaricus bisporus var. burnettii JB137-S8
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                   276   4e-89    Pisolithus tinctorius Marx 270
ref|XP_006460029.1|  hypothetical protein AGABI2DRAFT_191800            276   4e-89    Agaricus bisporus var. bisporus H97
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              276   9e-89    Branchiostoma floridae
gb|KDR83823.1|  hypothetical protein GALMADRAFT_676836                  275   9e-89    Galerina marginata CBS 339.88
ref|XP_008619762.1|  40S ribosomal protein S3a-2                        275   9e-89    Saprolegnia diclina VS20
gb|KDO28449.1|  40S ribosomal protein S3a-2                             275   1e-88    Saprolegnia parasitica CBS 223.65
ref|XP_007338149.1|  40S ribosomal protein S1                           275   2e-88    
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              275   3e-88    Aureococcus anophagefferens
gb|KDN43521.1|  40S ribosomal protein S1                                274   3e-88    Rhizoctonia solani AG-8 WAC10335
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               274   5e-88    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007364341.1|  40S ribosomal protein S1                           273   5e-88    Dichomitus squalens LYAD-421 SS1
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         273   6e-88    Periplaneta americana
gb|KDQ29255.1|  hypothetical protein PLEOSDRAFT_1089059                 273   9e-88    Pleurotus ostreatus PC15
gb|EDM00797.1|  rCG62728, isoform CRA_b                                 272   1e-87    Rattus norvegicus [brown rat]
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...    273   1e-87    Rhizoctonia solani AG-1 IB
gb|AAT81418.1|  ribosomal protein S3a                                   271   1e-87    
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         273   1e-87    
gb|KIJ56726.1|  hypothetical protein M422DRAFT_72882                    272   1e-87    
ref|XP_005707378.1|  40S ribosomal protein S3A isoform 2                273   1e-87    
ref|XP_009544052.1|  hypothetical protein HETIRDRAFT_458158             272   1e-87    
gb|KDR16079.1|  40S ribosomal protein S3a                               272   2e-87    
gb|EIT72263.1|  40S ribosomal protein S3A                               272   2e-87    
gb|AGM32131.1|  40S ribosomal protein S3a                               272   2e-87    
ref|XP_001817129.1|  40S ribosomal protein S1                           272   2e-87    
ref|NP_001134789.1|  40S ribosomal protein S3a                          272   2e-87    
gb|ABY28374.1|  ribosomal protein S3a                                   272   2e-87    
gb|EUC65367.1|  40s ribosomal protein s3ae                              271   2e-87    
ref|XP_009994185.1|  PREDICTED: 40S ribosomal protein S3a               271   3e-87    
ref|XP_009935259.1|  PREDICTED: 40S ribosomal protein S3a               270   3e-87    
gb|ELW69964.1|  40S ribosomal protein S3a                               272   3e-87    
ref|XP_009472997.1|  PREDICTED: 40S ribosomal protein S3a               270   3e-87    
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               271   3e-87    
ref|XP_001276080.1|  40S ribosomal protein S1                           271   3e-87    
gb|EDL15382.1|  mCG1128, isoform CRA_a                                  270   3e-87    
gb|KIL70132.1|  hypothetical protein M378DRAFT_605469                   271   3e-87    
dbj|BAF83764.1|  unnamed protein product                                271   4e-87    
gb|KFP00832.1|  40S ribosomal protein S3a                               271   4e-87    
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 271   4e-87    
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               271   4e-87    
ref|XP_754085.1|  40S ribosomal protein S3Ae                            271   4e-87    
sp|A2R9S1.1|RS3A_ASPNC  RecName: Full=40S ribosomal protein S1          271   4e-87    
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               271   5e-87    
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               271   5e-87    
ref|XP_001218106.1|  40S ribosomal protein S1                           271   6e-87    
gb|AAT76631.1|  ribosomal protein S3a                                   270   6e-87    
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    270   6e-87    
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               271   6e-87    
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               270   6e-87    
gb|EFB26537.1|  hypothetical protein PANDA_001716                       270   7e-87    
ref|NP_058849.1|  40S ribosomal protein S3a                             271   7e-87    
gb|KFO84143.1|  40S ribosomal protein S3a                               270   8e-87    
ref|XP_009687533.1|  PREDICTED: 40S ribosomal protein S3a               269   8e-87    
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               270   8e-87    
dbj|BAE88391.1|  unnamed protein product                                271   8e-87    
gb|KFW97162.1|  40S ribosomal protein S3a                               270   8e-87    
ref|XP_010707850.1|  PREDICTED: 40S ribosomal protein S3a isoform X2    269   8e-87    
ref|NP_001291168.1|  ribosomal protein S3A                              270   9e-87    
gb|EMC77645.1|  40S ribosomal protein S3a                               270   9e-87    
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               270   9e-87    
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a               270   9e-87    
gb|KFR12636.1|  40S ribosomal protein S3a                               270   1e-86    
gb|KFM10230.1|  40S ribosomal protein S3a                               270   1e-86    
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         270   1e-86    
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
gb|KFP91786.1|  40S ribosomal protein S3a                               270   1e-86    
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
gb|AAH66926.1|  Ribosomal protein S3A                                   270   1e-86    
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
gb|AAA35682.1|  ribosmal protein small subunit                          270   1e-86    
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    270   1e-86    
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         270   1e-86    
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          270   1e-86    
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
dbj|BAE87927.1|  unnamed protein product                                270   1e-86    
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               270   1e-86    
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   270   2e-86    
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          270   2e-86    
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|NP_001185510.1|  40S ribosomal protein S3a                          270   2e-86    
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|XP_006693334.1|  hypothetical protein CTHT_0028780                  270   2e-86    
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    270   2e-86    
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         270   2e-86    
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
gb|ACQ58827.1|  40S ribosomal protein S3a                               270   2e-86    
gb|EKC30815.1|  40S ribosomal protein S3a                               271   2e-86    
ref|NP_001008075.1|  40S ribosomal protein S3a                          270   2e-86    
ref|XP_008872125.1|  hypothetical protein H310_08228                    270   2e-86    
ref|XP_007927383.1|  hypothetical protein MYCFIDRAFT_87079              269   2e-86    
gb|KJB28383.1|  hypothetical protein B456_005G045000                    268   2e-86    
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         270   2e-86    
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               270   2e-86    
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               269   2e-86    
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    269   2e-86    
gb|KFH70745.1|  40S ribosomal protein S1                                269   2e-86    
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          269   2e-86    
gb|EOB04964.1|  40S ribosomal protein S3a                               268   3e-86    
dbj|BAE30393.1|  unnamed protein product                                269   3e-86    
dbj|BAE32029.1|  unnamed protein product                                269   3e-86    
ref|XP_009520284.1|  hypothetical protein PHYSODRAFT_285013             269   3e-86    
ref|XP_003972468.1|  PREDICTED: 40S ribosomal protein S3a-like is...    268   3e-86    
ref|NP_058655.3|  40S ribosomal protein S3a                             269   3e-86    
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          269   3e-86    
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          269   3e-86    
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          270   3e-86    
ref|XP_009827334.1|  hypothetical protein H257_04494                    269   3e-86    
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               268   3e-86    
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    269   3e-86    
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        269   4e-86    
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               269   4e-86    
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               269   4e-86    
ref|XP_002901276.1|  40S ribosomal protein S3a                          269   4e-86    
ref|XP_008900376.1|  40S ribosomal protein S3a                          269   4e-86    
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               269   4e-86    
ref|NP_001075886.1|  ribosomal protein S3A                              269   4e-86    
emb|CAD91420.1|  ribosomal protein S3a                                  269   4e-86    
ref|XP_001931333.1|  40S ribosomal protein S1                           268   4e-86    
gb|ETE70827.1|  40S ribosomal protein S3a                               269   5e-86    
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               268   5e-86    
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          268   5e-86    
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    268   5e-86    
dbj|BAB22611.1|  unnamed protein product                                268   5e-86    
gb|ABS44871.1|  ribosomal protein S3Ae                                  268   5e-86    
gb|AFM90263.1|  40S ribosomal protein S3a                               268   5e-86    
gb|ACL53942.1|  unknown                                                 265   6e-86    
dbj|BAF75056.1|  40S ribosome protein                                   266   6e-86    
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        268   6e-86    
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               268   6e-86    
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               268   6e-86    
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               268   7e-86    
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               268   7e-86    
gb|KIV90937.1|  40S ribosomal protein S1                                268   7e-86    
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               268   7e-86    
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          268   7e-86    
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    268   7e-86    
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               268   7e-86    
ref|NP_001279332.1|  ribosomal protein S3A                              268   8e-86    
ref|XP_007686274.1|  hypothetical protein COCMIDRAFT_90741              268   8e-86    
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               268   8e-86    
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               268   8e-86    
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          268   8e-86    
ref|NP_001270826.1|  40S ribosomal protein S3a                          268   8e-86    
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          268   8e-86    
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    267   9e-86    
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    268   9e-86    
ref|XP_004337280.1|  40S ribosomal protein S3a, putative                268   1e-85    
ref|XP_005538843.1|  40S ribosomal protein S3A                          268   1e-85    
ref|NP_956353.1|  40S ribosomal protein S3a                             268   1e-85    
gb|ELW50426.1|  40S ribosomal protein S3a                               270   1e-85    
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               268   1e-85    
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          267   2e-85    
emb|CDR40922.1|  RHTO0S05e08922g1_1                                     267   2e-85    
dbj|BAE27060.1|  unnamed protein product                                267   2e-85    
gb|AEM37761.1|  V-Fos transformation effector-like protein              265   2e-85    
ref|XP_007696626.1|  hypothetical protein COCSADRAFT_34493              267   2e-85    
gb|KEQ76235.1|  ribosomal protein S3Ae                                  267   2e-85    
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a-like is...    267   2e-85    
gb|EME43162.1|  hypothetical protein DOTSEDRAFT_72517                   267   2e-85    
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    267   2e-85    
ref|XP_007707649.1|  hypothetical protein COCCADRAFT_83997              266   2e-85    
gb|EMD91948.1|  hypothetical protein COCHEDRAFT_1173335                 266   2e-85    
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          267   2e-85    
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        267   2e-85    
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               269   2e-85    
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               271   2e-85    
gb|KEQ61803.1|  ribosomal protein S3Ae                                  266   2e-85    
ref|XP_008023145.1|  hypothetical protein SETTUDRAFT_176044             266   2e-85    
ref|XP_682139.1|  hypothetical protein AN8870.2                         266   3e-85    
ref|XP_002482424.1|  40S ribosomal protein S1                           266   3e-85    
gb|AFM88910.1|  40S ribosomal protein S3a                               266   3e-85    
gb|AFM85626.1|  40S ribosomal protein S3a                               266   3e-85    
gb|KDE09348.1|  40S ribosomal protein S1                                266   3e-85    
dbj|GAM40150.1|  ribosomal protein 10 of the small 40S subunit          266   3e-85    
gb|EPS27387.1|  hypothetical protein PDE_02330                          266   4e-85    
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               266   4e-85    
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               270   4e-85    
gb|ACD61705.1|  ribosomal protein S3                                    266   4e-85    
ref|XP_006958032.1|  40S ribosomal protein S1                           266   4e-85    
gb|EMF12040.1|  40S ribosomal protein S3aE-A                            266   5e-85    
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    266   5e-85    
emb|CBJ29379.1|  conserved unknown protein                              266   5e-85    
gb|KGO73156.1|  Ribosomal protein S3Ae                                  266   5e-85    
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         266   5e-85    
gb|EYE99542.1|  40S ribosomal protein S3aE                              266   5e-85    
ref|XP_004349214.1|  ribosomal protein S3a                              266   5e-85    
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               272   5e-85    
ref|XP_007874563.1|  hypothetical protein PNEG_02550                    266   5e-85    
ref|XP_002562607.1|  Pc20g00440                                         266   6e-85    
gb|EKV05302.1|  40S ribosomal protein S1                                266   6e-85    
ref|XP_002148168.1|  40S ribosomal protein S1                           265   6e-85    
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               268   6e-85    
ref|NP_001098311.1|  40S ribosomal protein S3a                          266   6e-85    
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         266   7e-85    
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          266   8e-85    
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    266   8e-85    
ref|XP_003883511.1|  hypothetical protein NCLIV_032660                  265   8e-85    
ref|XP_007291650.1|  40S ribosomal protein S3                           265   8e-85    
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          265   8e-85    
gb|ADO29317.1|  40S ribosomal protein s3a                               265   8e-85    
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          265   8e-85    
ref|XP_003850287.1|  40S ribosomal protein S1                           265   9e-85    
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     265   9e-85    
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             265   1e-84    
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    265   1e-84    
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    265   1e-84    
gb|AAT44427.1|  V-Fos transformation effector-like protein              264   1e-84    
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    265   1e-84    
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          265   2e-84    
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          265   2e-84    
emb|CDM28082.1|  40S ribosomal protein S1                               264   2e-84    
ref|XP_003790290.1|  PREDICTED: 40S ribosomal protein S3a-like          263   2e-84    
gb|EIF47090.1|  40s ribosomal protein s3ae                              264   2e-84    
ref|XP_011454655.1|  PREDICTED: 40S ribosomal protein S3a-like          263   2e-84    
gb|EHH24109.1|  hypothetical protein EGK_07706                          263   2e-84    
gb|AFM88988.1|  ribosomal protein S3a                                   264   2e-84    
dbj|GAD95806.1|  40S ribosomal protein S1                               264   3e-84    
ref|XP_007800525.1|  40S ribosomal protein S1                           264   3e-84    
gb|KIM94998.1|  hypothetical protein OIDMADRAFT_21260                   264   3e-84    
ref|XP_008717456.1|  40S ribosomal protein S1                           264   3e-84    
ref|NP_001131091.1|  40S ribosomal protein S3a                          264   3e-84    
ref|XP_008079199.1|  40S ribosomal protein S3                           264   3e-84    
ref|XP_005971156.1|  PREDICTED: 40S ribosomal protein S3a-like          264   3e-84    
gb|AEE62515.1|  unknown                                                 264   3e-84    
emb|CDP25519.1|  Putative cytosolic 40S ribosomal protein Rps3a         263   3e-84    



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   404 bits (1038),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/210 (93%), Positives = 202/210 (96%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRVNQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LMEV
Sbjct  172  MVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG KLDRP A+EP AE TE VGA
Sbjct  232  HGDYSEDVGVKLDRP-AEEPAAEPTEVVGA  260



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   404 bits (1037),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/210 (92%), Positives = 204/210 (97%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNY+LR+FCIGFTKKR+NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYSLRLFCIGFTKKRLNQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLVLKFIPE IGREIEKATSSIYPLQNVFIRK KILKAPKFDLGKLMEV
Sbjct  172  MVNQAQSCDLKDLVLKFIPELIGREIEKATSSIYPLQNVFIRKAKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRP A+EP+AEATE VGA
Sbjct  232  HGDYSEDVGVKVDRP-AEEPVAEATEVVGA  260



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   396 bits (1018),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 200/210 (95%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRPNQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LMEV
Sbjct  172  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA D    E TE VGA
Sbjct  232  HGDYSEDVGVKVDRPAEDVA-TEPTEVVGA  260



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   395 bits (1014),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/211 (90%), Positives = 202/211 (96%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTE-DVGTKLDRPAADEPIAEATEPVGA  122
            HGDY E D+GTKLDRP A+E +AE TE +GA
Sbjct  232  HGDYNEDDIGTKLDRP-AEEAVAEPTEVIGA  261



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   394 bits (1013),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 201/211 (95%), Gaps = 3/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRPNQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDL LKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG+LMEV
Sbjct  172  MVNQAQSCDLKDLALKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGRLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+EDVG K+DRPA D  IA E TE VGA
Sbjct  232  HGDYSEDVGVKVDRPAED--IATEPTEVVGA  260



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   389 bits (1000),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRSNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVGTK+DRPA +  +  ATE VGA
Sbjct  232  HGDYSEDVGTKVDRPADETVVEGATEVVGA  261



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   389 bits (1000),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 199/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTKKRVNQ K+TCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQNKKTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M N A SCDLK+LV KFIPESIGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MTNMATSCDLKELVKKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVGTKL+RP ADEP+AE  TE +GA
Sbjct  232  HGDYSEDVGTKLERP-ADEPVAEGVTEVIGA  261



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   388 bits (997),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 200/211 (95%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR+EDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRSEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  232  HGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  261



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   387 bits (995),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLRAEDVQG+N+LTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLRAEDVQGKNLLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQATSCDLKDLVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            HGDY+EDVGTK++RP ADE + E T E VGA
Sbjct  232  HGDYSEDVGTKVERP-ADETMVEGTPEIVGA  261



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   387 bits (994),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/194 (95%), Positives = 190/194 (98%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRVNQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDR  170
            HGDY+EDVG KLDR
Sbjct  232  HGDYSEDVGVKLDR  245



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   387 bits (994),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+EDVG K++RP ADEP+A E TE +GA
Sbjct  232  HGDYSEDVGVKVERP-ADEPMAEEPTEVIGA  261



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   386 bits (992),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  33   QGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  92

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMREI
Sbjct  93   SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMREI  152

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  153  MVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA +    EATE VGA
Sbjct  213  HGDYSEDVGAKVDRPADETLAEEATEVVGA  242



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   387 bits (994),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 198/210 (94%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLRAEDVQG++VLTNFWGMDFTTDKLR
Sbjct  58   QGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLRAEDVQGKSVLTNFWGMDFTTDKLR  117

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  118  SLVRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMREI  177

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQAQS DLKDLV KFIPESIG+EIEKATS IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  178  MINQAQSSDLKDLVQKFIPESIGKEIEKATSGIYPLQNVFIRKVKILKAPKFDLGKLMEV  237

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVGTKL+RP A+E  AE  E  GA
Sbjct  238  HGDYSEDVGTKLERP-AEESTAEPVEVPGA  266



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   387 bits (993),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA +    EATE VGA
Sbjct  232  HGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   386 bits (991),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEV LADLQND+D ++RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+ED+G K+DRPA D P+   TE +GA
Sbjct  232  HGDYSEDIGVKVDRPAEDAPVEGETEVIGA  261



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   386 bits (991),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA +    EATE VGA
Sbjct  232  HGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   385 bits (990),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D P+    E VGA
Sbjct  232  HGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   385 bits (990),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D P+    E VGA
Sbjct  232  HGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   385 bits (989),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 199/212 (94%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASSCDLKELVAKFIPEMIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+ +D+G KLDRP ADE IAEA TE VGA
Sbjct  232  HGDYSADDIGVKLDRP-ADETIAEAETEVVGA  262



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   385 bits (988),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 200/211 (95%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLRAEDVQG+NVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLRAEDVQGKNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY++D+GTK+DRP ADE IA E TE VGA
Sbjct  232  HGDYSDDIGTKVDRP-ADETIAEETTEVVGA  261



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   385 bits (988),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  232  HGDYSEDVGVKVERPADEAAVEGATEVVGA  261



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   384 bits (987),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR EDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLRCEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+ED+G KLDRP ADE +AEA TE +GA
Sbjct  232  HGDYSEDIGVKLDRP-ADETVAEAPTEVIGA  261



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004166384.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   384 bits (987),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  232  HGDYSEDVGVKVERPADETAVEGATEVVGA  261



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVGTK++RPA +  +  ATE VGA
Sbjct  232  HGDYSEDVGTKVERPAEETVVEGATEVVGA  261



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FT++R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTRRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLKDLV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQATSCDLKDLVNKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPI--AEATEPVGA  122
            HGDY+EDVG K+DRP ADE I   E TE VGA
Sbjct  232  HGDYSEDVGVKVDRP-ADETIVEGEVTEVVGA  262



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKDLVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D  +    E VGA
Sbjct  232  HGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   384 bits (986),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 197/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  232  HGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   383 bits (984),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 197/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  232  HGDYSQDIGVKIDRP-ADETMAEGETEVVGA  261



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   383 bits (983),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIE+HVDVKTTDNY+LR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIESHVDVKTTDNYSLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVAKFIPEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG KL+RP ADE  AE  TE VGA
Sbjct  232  HGDYSEDVGVKLERP-ADETTAEGETEVVGA  261



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K++RPA +    E TE +GA
Sbjct  232  HGDYSEDVGVKVERPADESMAEEPTEVIGA  261



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MTNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  232  HGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_004145387.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  232  HGDYSEDVGVKVDRP-AEEAVEGATEVVGA  260



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 197/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  56   QGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKLR  115

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  116  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  175

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  176  MVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLMEV  235

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  236  HGDYSQDIGVKIDRP-ADETVAEGETEVVGA  265



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   382 bits (982),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  232  HGDYSEDVGVKVDRP-AEEAVEGATEIVGA  260



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   382 bits (982),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG TK+R NQ KRTCYAQSSQ+RQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGLTKRRSNQVKRTCYAQSSQVRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA +    EATE VGA
Sbjct  232  HGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   382 bits (980),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 197/210 (94%), Gaps = 2/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMHEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QAQSCDLK+LV KFIPESIG+EIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MVAQAQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYTE+VG K++R  A+E  AE TE VGA
Sbjct  232  HGDYTEEVGVKVER--AEETAAEPTEVVGA  259



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   382 bits (981),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  232  HGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   381 bits (979),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K++RPA +    E TE +GA
Sbjct  232  HGDYSEDVGVKVERPADETMAEEPTEVIGA  261



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   381 bits (979),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLRAEDVQG+NVLTNF+GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLRAEDVQGKNVLTNFYGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILK+PKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKSPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            HGDY+EDVGTK++ P ADE + E T E VGA
Sbjct  232  HGDYSEDVGTKVESP-ADETVVEGTPEIVGA  261



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   381 bits (978),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEV LADLQND+D ++RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DRPA D  +   TE VGA
Sbjct  232  HGDYSEDVGVKVDRPADDTQMEGETEIVGA  261



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 195/207 (94%), Gaps = 2/207 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEP  131
            HGDY+EDVG KLDRP ADE +AEA EP
Sbjct  232  HGDYSEDVGVKLDRP-ADETVAEA-EP  256



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 195/207 (94%), Gaps = 2/207 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEP  131
            HGDY+EDVG KLDRP ADE +AEA EP
Sbjct  232  HGDYSEDVGVKLDRP-ADETVAEA-EP  256



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRCPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  232  HGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K++RPA D+     TE VGA
Sbjct  232  HGDYSEDVGVKMERPADDQIAEGETEVVGA  261



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 193/204 (95%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGDY+EDVG KLDRP A+E +AEA
Sbjct  232  HGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   379 bits (974),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 193/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQSLIEAHVDVKT+D YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQSLIEAHVDVKTSDGYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IG+EIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGKEIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPAEETVAEEPTEIIGA  262



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 197/211 (93%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  232  HGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +VNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  VVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K++RPA D P+    E VGA
Sbjct  232  HGDYKEDVGVKIERPADDVPMEGEPEVVGA  261



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   379 bits (972),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFD GKLMEV
Sbjct  172  MVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDXGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D  +    E VGA
Sbjct  232  HGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   379 bits (972),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 2/207 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEP  131
            HGDY+EDVG KLDRP  DE +AEA EP
Sbjct  232  HGDYSEDVGVKLDRP-TDETVAEA-EP  256



>ref|XP_006848758.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE  LADLQNDED A++KIRLRAED+QGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLRAEDIQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMRE+
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREV  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IG+EIEK T SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQATSCDLKELVQKFIPEVIGKEIEKVTMSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY++DVG K+DRPA D P+   TE VGA
Sbjct  232  HGDYSDDVGVKVDRPAEDVPLEGVTEVVGA  261



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 194/204 (95%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQI QIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTCYAQSSQIGQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQAASCDLKELVRKFIPETIGKEIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGDY+EDVG KL+RP ADEP+AEA
Sbjct  232  HGDYSEDVGVKLERP-ADEPMAEA  254



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 194/207 (94%), Gaps = 2/207 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEP  131
            HGDY+EDVG KLDRP  DE +AEA EP
Sbjct  232  HGDYSEDVGVKLDRP-VDETVAEA-EP  256



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAH+DVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHIDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTNQASSCDLKELVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY ED G KLDRP  D P+    E VGA
Sbjct  232  HGDYKEDFGVKLDRPGEDVPVEGEAEVVGA  261



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   378 bits (971),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 194/210 (92%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGM+FT DKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTNDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG KL+RP ADEPIAEA     A
Sbjct  232  HGDYSEDVGVKLERP-ADEPIAEAPAETAA  260



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   378 bits (971),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 193/208 (93%), Gaps = 1/208 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPV  128
            HGDY+EDVG KLDRP ADE +AEA   V
Sbjct  232  HGDYSEDVGVKLDRP-ADETVAEAEAEV  258



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  232  HGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFT DKLR
Sbjct  52   QGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTNDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IG+EIEKATSS+YPLQNVFIRKVKILKAPKFDLGKLME+
Sbjct  172  MINQATSCDLKELVRKFIPEMIGKEIEKATSSVYPLQNVFIRKVKILKAPKFDLGKLMEI  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+ED+GTK++RP  +  +  ATE VGA
Sbjct  232  HGDYSEDIGTKVERPVDETMVEGATEVVGA  261



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   378 bits (970),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+ED+G K++RP A+E +AE  TE VGA
Sbjct  232  HGDYSEDIGIKMERP-AEETMAEGETEVVGA  261



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   377 bits (969),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FT DKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGDY+EDVG KLDRP A+E +AEA
Sbjct  232  HGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   377 bits (969),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 192/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLRAEDVQGRNVLTNFWGM+FT DKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGDY+EDVG KL+RP  DEPIAEA
Sbjct  232  HGDYSEDVGVKLERP-VDEPIAEA  254



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   377 bits (967),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  36   QGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  95

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  96   RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  155

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  156  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215

Query  214  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            VHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  216  VHGDYGEDVGVKLERP-ADETMAEATTEVVGA  246



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD YTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETMVEEPTEIIGA  262



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 200/212 (94%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            ++NQA SCDLK+LVLKFIPESIGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  LINQAASCDLKELVLKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+ +D+G KL+RP ADE +AE  TE VGA
Sbjct  232  HGDYSADDIGVKLERP-ADELMAEGETEVVGA  262



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 196/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  232  HGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/212 (88%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKL
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            VHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  232  VHGDYGEDVGVKLERP-ADETMAEATTEVVGA  262



>ref|XP_004168031.1| PREDICTED: 40S ribosomal protein S3a-like, partial [Cucumis sativus]
Length=208

 Score =   375 bits (963),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 1/207 (0%)
 Frame = -3

Query  742  KIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLV  563
            +IASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLRSLV
Sbjct  3    QIASEGLKHRVFEVSLADLQEDEEHAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLRSLV  62

Query  562  KKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVN  383
            +KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREIMVN
Sbjct  63   RKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREIMVN  122

Query  382  QAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD  203
            QA SCDLK+LV KFIPESIG++IEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD
Sbjct  123  QATSCDLKELVRKFIPESIGKDIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGD  182

Query  202  YTEDVGTKLDRPAADEPIAEATEPVGA  122
            Y+EDVG K+DRP A+E +  ATE VGA
Sbjct  183  YSEDVGVKVDRP-AEEAVEGATEVVGA  208



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 193/210 (92%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG KLDRP ADE +    E  GA
Sbjct  232  HGDYSEDVGVKLDRP-ADETVEAEPEIPGA  260



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT +IYPLQNVFIRKVKILK+PKFDLGKLMEV
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKILKSPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKLR
Sbjct  35   QGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKLR  94

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  95   SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVEI  154

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  155  MINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  214

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVGTK++RPA +    E TE VGA
Sbjct  215  HGDYNEDVGTKVERPADEMVTEEPTEIVGA  244



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKLR
Sbjct  52   QGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVGTK++RPA +    E TE VGA
Sbjct  232  HGDYNEDVGTKVERPADEMVTEEPTEIVGA  261



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 194/211 (92%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+ EDVG K++RPA +    E TE VGA
Sbjct  232  HGDYSAEDVGVKVERPADETMAEEPTEIVGA  262



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   376 bits (965),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 195/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD +T R+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGFTFRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  232  HGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   376 bits (965),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQG+NVLTNF+GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGKNVLTNFYGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG KL+RP  +  +   TE VGA
Sbjct  232  HGDYSEDVGVKLERPIEETMVEGETEVVGA  261



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   375 bits (963),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLRAEDVQG+NVLTNFWGMD TTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLRAEDVQGKNVLTNFWGMDVTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQSLIEAHVDVKTTDN+TLRMFCIGFTKKR NQ KRTCYAQSSQI+QIRRKMREI
Sbjct  112  SLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRANQVKRTCYAQSSQIKQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QAQ+CDLK+LV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct  172  MVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYTEDVGTKLDR  170
            HGDY+EDVG KLDR
Sbjct  232  HGDYSEDVGVKLDR  245



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   375 bits (963),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM+FTTDK+R
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLRAEDVQGKNVLTNFWGMNFTTDKVR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTKKR NQ+KRTCYAQSSQIRQIR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKKRANQRKRTCYAQSSQIRQIRKKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV K IPESIGREIEK+T+SI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKIIPESIGREIEKSTTSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG KLDRP A+E +AE  TE VG+
Sbjct  232  HGDYSEDVGVKLDRP-AEETVAEGETEVVGS  261



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   375 bits (962),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MSNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVGTK+DRP  +    E TE VGA
Sbjct  232  HGDYSEDVGTKVDRPVEETTAEEPTEIVGA  261



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/212 (87%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            VHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  232  VHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   374 bits (961),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 195/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAH+DVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQTLIEAHIDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MAKEASSCDLKELVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDY+ EDVG K+DRP  DE +A E TE +GA
Sbjct  232  HGDYSAEDVGVKVDRP-TDEIMADEPTEVIGA  262



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLRAEDVQGRNVLTNF+GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLRAEDVQGRNVLTNFYGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDN+TLRMFCI FTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNFTLRMFCIAFTKRRPNQVKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPESIG+EIEKAT  IYPLQNV+IRKVKILK+PKFDLGKLMEV
Sbjct  172  MVNQASSCDLKDLVAKFIPESIGKEIEKATMGIYPLQNVYIRKVKILKSPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA--TEPVGA  122
            HGDY+EDVG KLDRP A+E +AE   TE VGA
Sbjct  232  HGDYSEDVGVKLDRP-AEETMAEGETTEVVGA  262



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A RKIRLRAEDVQG+NVLTNFWGMD TTDK+R
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRAEDVQGKNVLTNFWGMDLTTDKVR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
             LV+KWQ+LIEAHVDVKTTDNYTLR+FC GFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  YLVRKWQTLIEAHVDVKTTDNYTLRLFCFGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLVLKFIPE IG+EIEKAT+SI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKDLVLKFIPEVIGKEIEKATASIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K++RPA D  +    E VGA
Sbjct  232  HGDYKEDVGVKMERPAEDVQMEGEAEVVGA  261



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 200/210 (95%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  440  QGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  499

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  500  SLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMMEI  559

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV Q+QSCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  560  MVAQSQSCDLKELVQKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  619

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYTE+VG KLDR AA+E +AE TE VGA
Sbjct  620  HGDYTEEVGVKLDR-AAEEAVAEPTELVGA  648



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            VHGDY+EDVG K++RP ADE +AEA  E +GA
Sbjct  232  VHGDYSEDVGVKIERP-ADETMAEAAPEVIGA  262



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   373 bits (958),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPI  149
            HGDY EDVGTKL+RPA DE +
Sbjct  232  HGDYKEDVGTKLERPAEDEVV  252



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   373 bits (958),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLM++
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMDI  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMR+I
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+V
Sbjct  172  MIKEASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADEMAVEEPTEIIGA  262



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 198/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            VHGDY+EDVG KL+RP ADE +AE+T E VGA
Sbjct  232  VHGDYSEDVGVKLERP-ADETMAESTPEVVGA  262



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   373 bits (957),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNV+IRKVKILKAPKFDLGKLM+V
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVYIRKVKILKAPKFDLGKLMDV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   373 bits (957),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 192/207 (93%), Gaps = 4/207 (2%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLTNFWGM+FT DKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTNFWGMNFTNDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRT YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTTYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME-  215
            M  QA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME 
Sbjct  172  MTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEA  231

Query  214  --VHGDYTEDVGTKLDRPAADEPIAEA  140
              VHGDY+EDVG KLDRP A+E +AEA
Sbjct  232  SIVHGDYSEDVGVKLDRP-AEETMAEA  257



>gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   372 bits (955),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVF++SLADLQ DED AFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQIKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNV++RKVKILKAPKFDLGKLMEV
Sbjct  172  MTAQATSCDLKELVRKFIPEIIGKEIEKATSSIYPLQNVYVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA  164
            HGDY+EDVGTKL+RPA
Sbjct  232  HGDYSEDVGTKLERPA  247



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   372 bits (954),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 197/212 (93%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            VHGDY+EDVG K++RP ADE +AE T E +GA
Sbjct  232  VHGDYSEDVGVKIERP-ADETMAEPTPEVIGA  262



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   372 bits (954),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   371 bits (953),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMR+I
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+V
Sbjct  172  MVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+ EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYSAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   371 bits (953),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 190/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   371 bits (953),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY +RMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMIRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLMEV
Sbjct  172  MINQAASCDLKELVAKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDY-TEDVGTKLDRPA-ADEPIAEATE  134
            HGDY  EDVG KLDRPA  DE I  A E
Sbjct  232  HGDYGKEDVGVKLDRPAEGDEAIPGAEE  259



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   371 bits (953),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQ+VF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQSVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA  DE I    E V A
Sbjct  232  HGDYKEDVGMKVDRPAEGDEAIIPGAEDVAA  262



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLRAEDVQGRNVLT FWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLRAEDVQGRNVLTQFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP ADE   E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRP-ADETAEEPTEIIGA  261



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   371 bits (952),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA  146
            HGDYT EDVG KL+RPA DE +A
Sbjct  232  HGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   370 bits (951),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA  146
            HGDYT EDVG KL+RPA DE +A
Sbjct  232  HGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   370 bits (951),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA  146
            HGDYT EDVG KL+RPA DE +A
Sbjct  232  HGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   370 bits (951),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 192/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDAYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLKDLV KFIPE+IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLM++
Sbjct  172  MVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPLQNVFIRKVKILKAPKFDLGKLMDI  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRP-AEEVVEEPTEIIGA  261



>ref|XP_006838990.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
 gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   370 bits (951),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE +LADLQ DED ++RKIRLRAED+QGRNVLTNFWGMDFTTDKLR
Sbjct  57   QGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLRAEDIQGRNVLTNFWGMDFTTDKLR  116

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  117  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQTSQIRQIRRKMREI  176

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  177  MVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  236

Query  211  HGDYTEDVGTKLDRPAADEPIAEATE  134
            HGDY++DVG K++RPA D  +   TE
Sbjct  237  HGDYSDDVGVKVERPAEDVAMDGETE  262



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   370 bits (950),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   369 bits (948),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTED  191
            HGDY ED
Sbjct  232  HGDYNED  238



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   370 bits (949),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG KLDRP
Sbjct  232  HGDYSEDVGVKLDRP  246



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   370 bits (949),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 195/211 (92%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLRAEDVQGRNVLT FWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLRAEDVQGRNVLTQFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG ++DRP ADE   E TE +GA
Sbjct  232  HGDYTAEDVGVRVDRP-ADETAEEPTEIIGA  261



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   369 bits (948),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG KLDRP
Sbjct  232  HGDYSEDVGVKLDRP  246



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   369 bits (948),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 194/211 (92%), Gaps = 3/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLPKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HG   EDVG K+DR +A+E + E  TE VGA
Sbjct  232  HGG-KEDVGVKVDR-SAEETVPEGETEVVGA  260



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   369 bits (948),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR+EDVQG+NVLTNFWGMD TTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRSEDVQGKNVLTNFWGMDLTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
             +V++WQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  HIVRRWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D  +   +E  GA
Sbjct  232  HGDYKEDVGVKVDRPAEDVQMEGESEVAGA  261



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   369 bits (948),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR NQ K+T YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQNQNKKTSYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG K++RP
Sbjct  232  HGDYSEDVGVKMERP  246



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A RKIRLRAEDVQG+NVLTNFWGMD TTDK+R
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLRAEDVQGKNVLTNFWGMDLTTDKVR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
             +V+KW +LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  YIVRKWLTLIEAHVDVKTTDNYTLRMFCIAFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PLQNV+IRKVKILK+PKFDLGKLMEV
Sbjct  172  MVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPLQNVYIRKVKILKSPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D P+      VGA
Sbjct  232  HGDYKEDVGVKVDRPAEDVPMEGEEVVVGA  261



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG KLDRP
Sbjct  232  HGDYSEDVGVKLDRP  246



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPESIGR+IEKA  SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT ED G K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDGGVKVDRPADEATAEEPTEIIGA  262



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   369 bits (946),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTD+L
Sbjct  52   QGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDRL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            VHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  232  VHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   369 bits (946),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 194/211 (92%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVL  FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQ+RQIRRKMR+I
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQVRQIRRKMRDI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRKVKILKAPKFDLGKLM+V
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMDV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRP-AEETVEEPTEIIGA  261



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   368 bits (945),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD Y LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA  146
            HGDY  ED+GTKLDRPA DE +A
Sbjct  232  HGDYAKEDIGTKLDRPAEDEAMA  254



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   368 bits (945),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  52   QGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  172  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG KLDRP
Sbjct  232  HGDYSEDVGVKLDRP  246



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   368 bits (945),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETAAEEPTEIIGA  262



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   368 bits (945),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 190/203 (94%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+E+EKATSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MTNQASTCDLKELVSKFIPEVIGKEVEKATSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIA  146
            HGDY EDVGTK++RPA ADE + 
Sbjct  232  HGDYKEDVGTKVERPAEADEAMG  254



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   368 bits (945),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  261



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   367 bits (943),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  36   QGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKLR  95

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  96   SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTEI  155

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  156  MIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  215

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DR   + P     E VGA
Sbjct  216  HGDYSEDVGVKVDRTTEEAPAEAEAELVGA  245



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   368 bits (944),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG++IEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKDIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPI  149
            HGDY +D+GTK++RPA DE +
Sbjct  232  HGDYKDDIGTKVERPAEDEAM  252



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   369 bits (948),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 191/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  93   QGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  152

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  153  SLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  212

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  213  MIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  272

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  273  HGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  302



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   367 bits (943),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNF GMDFTTDKLR
Sbjct  51   QGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLRAEDVQGRNVLTNFHGMDFTTDKLR  110

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR NQQKRTCYAQSSQIRQIRRKM EI
Sbjct  111  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEI  170

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPESIGREIEKATSSI+PLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct  171  MRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDLGKLMEV  230

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG KLDRP
Sbjct  231  HGDYSEDVGVKLDRP  245



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   367 bits (943),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 191/211 (91%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIESHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A S DLK+LV KFIPESIG+EI+KAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSSDLKELVAKFIPESIGKEIDKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   367 bits (942),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 187/202 (93%), Gaps = 1/202 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLMEV
Sbjct  172  MANQATSCDLKELVQKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPI  149
            HGDY EDVG K+DRPA  DE +
Sbjct  232  HGDYKEDVGMKVDRPADGDEAV  253



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   366 bits (940),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLRAED+QG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR NQQKRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLKDLV KFIPESIGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQAPSCDLKDLVQKFIPESIGREIEKATPSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTED  191
            HGDY ED
Sbjct  232  HGDYNED  238



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   367 bits (941),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 4/212 (2%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPESIGR+IEKAT +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVKEASSCDLKELVAKFIPESIGRDIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  122
            HGDYT EDVG K+DRP  DE +A E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRP--DETVAEEPTEIIGA  261



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   366 bits (940),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 187/197 (95%), Gaps = 1/197 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPA  164
            VHGDY+EDVG KL+RPA
Sbjct  232  VHGDYSEDVGVKLERPA  248



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   366 bits (940),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 199/217 (92%), Gaps = 8/217 (4%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR+EDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLRSEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDN+TLR+FCIGFT++R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNFTLRLFCIGFTRRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME-  215
            MVNQA SCDLK+LV KFIPE IG+EIEK T SI+PLQNVFIRKVKILKAPKFDLGKLME 
Sbjct  172  MVNQATSCDLKELVQKFIPEMIGKEIEKTTKSIFPLQNVFIRKVKILKAPKFDLGKLMEA  231

Query  214  -----VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
                 VHGDY+ED+G K++RP ADE IAEA TE +GA
Sbjct  232  SFLYPVHGDYSEDIGAKVERP-ADETIAEATTEVIGA  267



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   366 bits (940),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ++QIRRKM EI
Sbjct  112  SLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVKQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME+
Sbjct  172  MVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEI  231

Query  211  HGDYTEDVGTKLDRPAADEPIAE-ATEPVGA  122
            HGDY+EDVG K+DRP  DE + E ATE VGA
Sbjct  232  HGDYSEDVGVKVDRP-VDETMPEGATEVVGA  261



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   366 bits (940),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 190/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIR+IR KMREI
Sbjct  112  SLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIREIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   366 bits (939),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 189/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG KL+RPA  E      E   A
Sbjct  232  HGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  262



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   366 bits (939),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 190/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+D PA +    E TE +GA
Sbjct  232  HGDYTAEDVGVKVDSPADETAAEEPTEIIGA  262



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   365 bits (938),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 189/211 (90%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A S DLK+LV KFIPESIG+EIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRPA +  + E  E +GA
Sbjct  232  HGDYTAEDVGVKVDRPADETVVEEPAEIIGA  262



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   365 bits (938),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA  164
            HGDY EDVG KLDRPA
Sbjct  232  HGDYKEDVGMKLDRPA  247



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   365 bits (937),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 193/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG K++RP ADEPI EA TE +GA
Sbjct  232  HGDYSEDVGVKMERP-ADEPIPEAPTEVIGA  261



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   365 bits (936),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQIRQIRLKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLKDLV KFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MINQAASCDLKDLVAKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLPKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVG  125
            HG   EDVG K+DR A +      TE VG
Sbjct  232  HGG-KEDVGVKVDRSAEETAPEGETEVVG  259



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   365 bits (936),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 186/211 (88%), Gaps = 1/211 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRTNQVKRTCYAQSSQVRQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK LV KFIPESIGREIEK T +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSCDLKQLVAKFIPESIGREIEKVTQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            H DYT EDVG K+DRP  +    E  E +GA
Sbjct  232  HSDYTAEDVGVKVDRPEDETVAEEPAEIIGA  262



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIA  146
            HGDY EDVG KLDRPA  DE +A
Sbjct  232  HGDYKEDVGMKLDRPAETDEAVA  254



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   363 bits (931),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  23   QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  82

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  83   SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  142

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  143  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  202

Query  211  HGDYTEDVGTKLDRPA-ADEPIAE  143
            HGDY EDVG KL+RP   DE + E
Sbjct  203  HGDYKEDVGVKLERPVEGDEAVQE  226



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 193/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  32   QGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  91

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  92   SLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREI  151

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  152  MVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  211

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG K+DRP ADEPI EA TE +GA
Sbjct  212  HGDYSEDVGVKVDRP-ADEPIPEAPTEVIGA  241



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIR+KMREI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRKKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +AQSCDLKDLV KFIPE IG+EIEK T+ IYPLQN +IRKVKILKAPKFDLGKLMEV
Sbjct  172  MVREAQSCDLKDLVAKFIPEVIGKEIEKVTAGIYPLQNTYIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAAD  158
            HGDY+ED G K++RP  D
Sbjct  232  HGDYSEDTGVKVERPVGD  249



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   363 bits (933),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEV LADLQNDED A RKIRLRAEDVQG+NVL NFWGMD TTDK+R
Sbjct  52   QGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLRAEDVQGKNVLANFWGMDLTTDKVR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
             +V+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  YVVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG K+DRPA D  + E  E  GA
Sbjct  232  HGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  260



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   362 bits (930),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 194/211 (92%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKLR
Sbjct  32   QGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLR  91

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  92   SLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREI  151

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  152  MVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  211

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  212  HGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  241



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 194/211 (92%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QA SCDLK LV KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  232  HGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  261



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLRAEDVQG+N+LTNFWGM+FTTDKLR
Sbjct  52   QGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLRAEDVQGKNLLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA SCDLK LV KFIPE IG+EIE ATSSIYPLQNVFIRKVKILKAPKF L KLMEV
Sbjct  172  MINQASSCDLKGLVHKFIPEMIGKEIENATSSIYPLQNVFIRKVKILKAPKFHLEKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVGTK++ PA +    E TE VGA
Sbjct  232  HGDYSEDVGTKVESPADEMVTEEPTEIVGA  261



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   362 bits (930),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 189/209 (90%), Gaps = 2/209 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFD+GKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPA-ADEPIAEATEP  131
            HGDY  EDVG KL+RPA ADE   E   P
Sbjct  232  HGDYNKEDVGVKLERPAEADEAGVEVAAP  260



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   362 bits (929),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLRAEDVQG++VLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLRAEDVQGKDVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IGREIEKATSSIYPLQ+VFIRK KILKAPKFDLGKLMEV
Sbjct  172  MINQASACDLKELVQKFIPEMIGREIEKATSSIYPLQHVFIRKAKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            H +  EDVG K+DRP A+E + E T  VGA
Sbjct  232  H-EKKEDVGVKIDRP-AEEIVPEETTIVGA  259



>gb|ABE66401.1| S phase protein [Striga asiatica]
Length=190

 Score =   359 bits (922),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = -3

Query  745  TKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSL  566
            TKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRSL
Sbjct  1    TKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSL  60

Query  565  VKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  386
            V+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV
Sbjct  61   VRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  120

Query  385  NQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHG  206
            NQAQSCDLKDLV KF+PESIG+EIEKAT SIYPLQNV+IRKVKILKAPKFDL +LMEVHG
Sbjct  121  NQAQSCDLKDLVQKFVPESIGKEIEKATQSIYPLQNVYIRKVKILKAPKFDLSRLMEVHG  180

Query  205  DYTEDVGTKLD  173
            D+ E++G KL+
Sbjct  181  DH-EEIGVKLE  190



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   362 bits (928),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIAEAT  137
            HGDY EDVG KL+RP   DE + E  
Sbjct  232  HGDYKEDVGVKLERPVEGDEAVQEVA  257



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 4/211 (2%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLRAEDVQGR VLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLRAEDVQGRTVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV+QA SCDLKDLV KFI ESIG+EIEK T+SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MVSQASSCDLKDLVRKFIAESIGKEIEKQTTSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            HGD  EDVGTK+DRP A+E + EA  E VGA
Sbjct  232  HGD--EDVGTKVDRP-AEEAVPEAPVEIVGA  259



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 188/211 (89%), Gaps = 2/211 (1%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIEAHVDVKTTDNY +RMFCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIEAHVDVKTTDNYQIRMFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
            V +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  173  VREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  232

Query  208  GDYTEDVGTKLDRPAAD--EPIAEATEPVGA  122
            GDY+E+VG K++RP  D  EP+AEA    GA
Sbjct  233  GDYSEEVGAKIERPVGDEAEPVAEAAPVPGA  263



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   361 bits (926),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LRAEDVQGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLRAEDVQGRNVLTNFWGMDFTTDKLR  110

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKM EI
Sbjct  111  SLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMTEI  170

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  171  MIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  230

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY+EDVG K+DR   + P     E VGA
Sbjct  231  HGDYSEDVGVKVDRTTEEAPAEAEAELVGA  260



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   361 bits (926),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 2/211 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLRAEDVQG+NVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGKNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE HVDVKTTD+YTLRMFCI FTK+R NQ KRTCYAQSSQ+RQIRRKMR+I
Sbjct  112  SLVKKWQTLIECHVDVKTTDSYTLRMFCIAFTKRRANQVKRTCYAQSSQVRQIRRKMRDI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ +A S DLK+LV KFIPE+IG+EIEK+T +IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIKEASSVDLKELVKKFIPEAIGKEIEKSTQNIYPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGD T EDVG K+DRP  DE + E  E +GA
Sbjct  232  HGDLTAEDVGVKVDRP-EDEAVEEPAEIIGA  261



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   360 bits (925),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct  172  MSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPA-ADEPIA  146
            HGDY  EDVG K+DRPA  DE + 
Sbjct  232  HGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   360 bits (925),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 187/204 (92%), Gaps = 2/204 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct  172  MSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLMEV  231

Query  211  HGDYT-EDVGTKLDRPA-ADEPIA  146
            HGDY  EDVG K+DRPA  DE + 
Sbjct  232  HGDYAKEDVGVKMDRPAEGDEAMG  255



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   360 bits (925),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG KL+RP   +   EA + V A
Sbjct  232  HGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   360 bits (924),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 190/212 (90%), Gaps = 3/212 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADL  DED A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R NQ KRTCYAQSSQIRQIR KMREI
Sbjct  112  SLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRSKMREI  171

Query  391  MV-NQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            M+  +A SCDLK+LV KFIPESIG++IEKAT  IYPLQNVFIRKVKILKAPKFDL KLME
Sbjct  172  MIKEEASSCDLKELVAKFIPESIGKDIEKATQGIYPLQNVFIRKVKILKAPKFDLRKLME  231

Query  214  VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            VHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  232  VHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  262



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   362 bits (930),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  122  QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  181

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  182  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  241

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  242  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  301

Query  211  HGDYTEDVGTKLDRPA-ADEPIAE  143
            HGDY EDVG KL+RP   DE + E
Sbjct  302  HGDYKEDVGVKLERPVEGDEAVQE  325



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   362 bits (930),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  124  QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  183

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  184  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  243

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  244  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  303

Query  211  HGDYTEDVGTKLDRPA-ADEPIAE  143
            HGDY EDVG KL+RP   DE + E
Sbjct  304  HGDYKEDVGVKLERPVEGDEAVQE  327



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   360 bits (923),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  173  TREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  232

Query  208  GDYTEDVGTKLDRPAADEPIAEA  140
            GDY+E+VG K++RP  DEP AEA
Sbjct  233  GDYSEEVGAKIERPVGDEPAAEA  255



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   359 bits (922),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIAEAT  137
            HGDY EDVG KL+RP   DE + E  
Sbjct  232  HGDYKEDVGVKLERPVEGDEAMQEVA  257



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   358 bits (918),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HGDY EDVG KL+RP   +   EA + V A
Sbjct  232  HGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +AQSCDLK+LV KFIPE+IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  173  TKEAQSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  232

Query  208  GDYTEDVGTKLDRPAADEPIAEA-TEPV  128
            GDY+E+VG K++RP  D+   EA TEPV
Sbjct  233  GDYSEEVGAKIERPVGDDAETEAVTEPV  260



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTT NY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTXNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIAEAT  137
            HGDY EDVG KL+RP   DE + E  
Sbjct  232  HGDYKEDVGVKLERPVEGDEAMQEVA  257



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLRAEDVQ RNVLTNFWGM+FTTDKLR
Sbjct  52   QGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQDRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA-ADEPIAEAT  137
            HGDY EDVG KL+RP   DE + E  
Sbjct  232  HGDYKEDVGVKLERPVEGDEAMQEVA  257



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   355 bits (912),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 192/212 (91%), Gaps = 7/212 (3%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTD+L
Sbjct  52   QGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDRL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQ    MRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQ----MRE  167

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct  168  IMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  227

Query  214  VHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  122
            VHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  228  VHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  258



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   355 bits (911),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  730  EGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ  551
            EGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG NVLTNFWGMDFTTDKLRSLV+KWQ
Sbjct  53   EGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGMNVLTNFWGMDFTTDKLRSLVRKWQ  112

Query  550  SLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQS  371
            +LIEAHVDVKTTDNY LRMF IGFTK+R NQ KRTCYAQ+SQIRQIRRKM EIMVNQA S
Sbjct  113  TLIEAHVDVKTTDNYMLRMFTIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMVNQAAS  172

Query  370  CDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTED  191
            CDLK+LV KFIPE IG+EIEKATSSI+PLQNV++RKVKILKAPKFDLGKLMEVHGDY ED
Sbjct  173  CDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPKFDLGKLMEVHGDYKED  232

Query  190  VGTKLDRPAADEPIAEATEPVGA  122
            VG KLDRPA  + +    E V A
Sbjct  233  VGVKLDRPADGDEVIPGAEEVAA  255



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   371 bits (953),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 199/221 (90%), Gaps = 6/221 (3%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADE--PIAEATEPVGA*N*VLI*FW  95
            HGDY EDVGTKL+RPA DE  P  ++T+ +     VL+ +W
Sbjct  232  HGDYKEDVGTKLERPAEDEVVPWDKSTDVLH----VLLNYW  268



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   372 bits (956),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct  172  MVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVG  125
            HGDY EDVGTKL+RPA DE +   +  +G
Sbjct  232  HGDYKEDVGTKLERPAEDEVVERDSSIIG  260



>gb|EYU30365.1| hypothetical protein MIMGU_mgv1a021183mg, partial [Erythranthe 
guttata]
Length=206

 Score =   352 bits (903),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 187/209 (89%), Gaps = 8/209 (4%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
             TKIASEGLKHRVFEVSLADLQ+DED AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRS
Sbjct  6    NTKIASEGLKHRVFEVSLADLQSDEDLAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRS  65

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQIRQIRRKM EIM
Sbjct  66   LVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQIRQIRRKMMEIM  125

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
            V Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGKLMEVH
Sbjct  126  VAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGKLMEVH  185

Query  208  GDYTEDVGTKLDRPAADEPIAEATEPVGA  122
                   G KLDR +A+E +AE TE VGA
Sbjct  186  -------GVKLDR-SAEEAVAEPTELVGA  206



>gb|EYU26004.1| hypothetical protein MIMGU_mgv1a019927mg, partial [Erythranthe 
guttata]
Length=209

 Score =   351 bits (901),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 187/209 (89%), Gaps = 8/209 (4%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
             TKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRS
Sbjct  9    NTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRS  68

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQI QIRRKM EIM
Sbjct  69   LVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQILQIRRKMMEIM  128

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
            V Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGKLMEVH
Sbjct  129  VAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGKLMEVH  188

Query  208  GDYTEDVGTKLDRPAADEPIAEATEPVGA  122
                   G KLDR +A+E +AE TE VGA
Sbjct  189  -------GVKLDR-SAEEAVAEPTELVGA  209



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   353 bits (905),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HG   EDVG K++RPA +       E VGA
Sbjct  232  HGG-NEDVGQKVERPAEEAVTEPPPEIVGA  260



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   352 bits (902),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 1/189 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDV  188
            VHGDY+EDV
Sbjct  232  VHGDYSEDV  240



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   350 bits (898),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 179/195 (92%), Gaps = 2/195 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRV  +SLADLQNDED A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  30   QGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  89

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+   Q  +T YAQSSQIRQIRRKMREI
Sbjct  90   SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRSTRQ--KTSYAQSSQIRQIRRKMREI  147

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  148  MTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  207

Query  211  HGDYTEDVGTKLDRP  167
            HGDY+EDVG K++RP
Sbjct  208  HGDYSEDVGVKMERP  222



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   351 bits (900),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/238 (74%), Positives = 189/238 (79%), Gaps = 28/238 (12%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLRAED+QGRNVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLRAEDIQGRNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME-  215
            M NQA +CDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLME 
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  214  --------------------------VHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
                                      VHGDYT EDVG KL+RPA  E      E   A
Sbjct  232  IPSDRAIMFFPAFLWPVILTLNIASQVHGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  289



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   349 bits (896),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLRAEDVQGRNVLTNFWGM FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLRAEDVQGRNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ ++  + RRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQVARSGRSRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKFDLGKLMEV  231

Query  211  HGDYTEDVGTKLDRPA  164
            HGDY EDVG KLDRPA
Sbjct  232  HGDYKEDVGMKLDRPA  247



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   348 bits (893),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  173  TREAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  232

Query  208  GDYTEDVGTKLDRPAA  161
            GDY+E+VG K+DRP  
Sbjct  233  GDYSEEVGAKIDRPVG  248



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  173  TKEAQTCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  232

Query  208  GDYTEDVGTKLDRPAA  161
            GDY+E+VG K++RP  
Sbjct  233  GDYSEEVGAKIERPVG  248



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   346 bits (887),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 190/212 (90%), Gaps = 10/212 (5%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLME  231

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            +        G K++RP ADE +AE T E +GA
Sbjct  232  MF-------GVKIERP-ADETMAEPTPELIGA  255



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  739  IASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVK  560
            IAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRSLV+
Sbjct  62   IASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRSLVR  121

Query  559  KWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQ  380
            KWQSLIEAHVDVKTTDNY +RMFCI FTKKR NQ K+TCYAQ+SQIRQIRRKMREIMV +
Sbjct  122  KWQSLIEAHVDVKTTDNYMIRMFCIAFTKKRPNQIKKTCYAQTSQIRQIRRKMREIMVRE  181

Query  379  AQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY  200
            AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVHGDY
Sbjct  182  AQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVHGDY  241

Query  199  TEDVGTKLDRPAAD  158
            +E+VG K++RP  D
Sbjct  242  SEEVGAKIERPVGD  255



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 184/210 (88%), Gaps = 2/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MIAQATSSDLKGLVSKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            +G   EDVG K++RPA +       E VGA
Sbjct  232  YGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   341 bits (875),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 184/210 (88%), Gaps = 2/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            +G   EDVG K++RPA +       E VGA
Sbjct  232  YGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   340 bits (873),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR EDVQGRNVLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLRCEDVQGRNVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGK ME+
Sbjct  172  MVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKFMEI  231



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   340 bits (871),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 183/210 (87%), Gaps = 2/210 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQG+ VLTNFWGM+FTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGKTVLTNFWGMNFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ QA S DLK LV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  172  MIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            +G   EDVG K++RP  +       E VGA
Sbjct  232  YGG--EDVGVKVERPTEEAAPEVQQEIVGA  259



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   338 bits (868),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR NQ K+T YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQNQNKKTSYAQSSQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME 
Sbjct  172  MTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEA  231



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 187/210 (89%), Gaps = 1/210 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  421  QGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLRAEDVQGRNVLTNFWGMNFTTDKLR  480

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREI
Sbjct  481  SLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREI  540

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV QA S DLKDLV KFI ESIG+EIEKAT SIYPLQNVFIRKVKILKAPKFDL KLMEV
Sbjct  541  MVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPLQNVFIRKVKILKAPKFDLTKLMEV  600

Query  211  HGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            HG   EDVG K++RPA +       E VGA
Sbjct  601  HGG-NEDVGQKVERPAEEAVTEPPPEIVGA  629



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   335 bits (860),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLG  227
            MVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLG
Sbjct  172  MVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLG  226



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   335 bits (859),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  171

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLME
Sbjct  172  IMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLME  231

Query  214  V  212
            V
Sbjct  232  V  232



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   331 bits (848),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR EDVQGRN LTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLRVEDVQGRNCLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR  Q KRTCYAQS+QIRQIR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  +A SCDLKDLV KFIPE+IG++IEK+   IYPLQN FIRKVK+LKAPKFD+ KLMEV
Sbjct  172  ITREATSCDLKDLVAKFIPEAIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLMEV  231

Query  211  HGDYTEDVGTKLDR  170
            HGDY+E+VGTKLDR
Sbjct  232  HGDYSEEVGTKLDR  245



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   329 bits (843),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 178/211 (84%), Gaps = 18/211 (9%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLRAEDVQGRNVLT FWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R NQ KRTCYAQSSQ+RQIRRKM EI
Sbjct  112  SLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRANQVKRTCYAQSSQVRQIRRKMSEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPLQNVFIRK                V
Sbjct  172  MVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRK----------------V  215

Query  211  HGDYT-EDVGTKLDRPAADEPIAEATEPVGA  122
            HGDYT EDVG K+DRP  DE   E TE +GA
Sbjct  216  HGDYTAEDVGVKVDRP-DDETAEEPTEIIGA  245



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLRAEDVQG+NVLTNFWGM FTTDKLR
Sbjct  52   QGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLRAEDVQGKNVLTNFWGMSFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQ++QIRRKM EI
Sbjct  112  SLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQVKQIRRKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MVNQ  SCDLK++V K IPE IG+EIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME+
Sbjct  172  MVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEL  231

Query  211  HGDY  200
            H  +
Sbjct  232  HSIF  235



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR EDVQGRN LTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLRVEDVQGRNCLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR  Q KRTCYAQS+QIRQIR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQGQIKRTCYAQSAQIRQIRKKMMEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  +A SCDLK+LV KFIPESIG++IEK+   IYPLQN FIRKVK+LKAPKFD+ KLMEV
Sbjct  172  ITREATSCDLKELVAKFIPESIGKDIEKSCQGIYPLQNTFIRKVKVLKAPKFDITKLMEV  231

Query  211  HGDYTEDVGTKLDR  170
            HGDY+E+VG K++R
Sbjct  232  HGDYSEEVGAKIER  245



>ref|XP_001774288.1| predicted protein [Physcomitrella patens]
 gb|EDQ60924.1| predicted protein [Physcomitrella patens]
Length=254

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 175/209 (84%), Gaps = 12/209 (6%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GL+ RVFE          D AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLRGRVFE----------DQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  102

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIEAHVDVKTTDNY LR+FCI  TKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  103  LVRKWQSLIEAHVDVKTTDNYQLRIFCIASTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  162

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +AQ+CDLKDLV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLMEVH
Sbjct  163  TREAQTCDLKDLVSKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLMEVH  222

Query  208  GDYTEDVGTKLDRPAAD--EPIAEATEPV  128
            GDY+E+VG+K++RP  D  E  A A EPV
Sbjct  223  GDYSEEVGSKIERPVGDVAETDAGAAEPV  251



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   323 bits (827),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREI
Sbjct  112  SLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLPNQVKRTCYAQASQIRQIRRKMREI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+ QA SCDLK LV KFI E IGREIEKAT SIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct  172  MIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPLQNVFIRKVKILKAPKFDLGKLMEV  231



>ref|XP_009406018.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=241

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = -3

Query  685  QNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNY  506
            +NDED A RKIRLRAEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNY
Sbjct  55   KNDEDQAHRKIRLRAEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNY  114

Query  505  TLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESI  326
            TLRMFCIGFTK+R NQ KRTCYAQSSQIRQIRRKMREIMVNQA + DLKDLV KFIPE I
Sbjct  115  TLRMFCIGFTKRRPNQVKRTCYAQSSQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVI  174

Query  325  GREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA  146
            G+EIEKAT+SIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  + 
Sbjct  175  GKEIEKATTSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-  233

Query  145  EATEPVGA  122
            E  E  GA
Sbjct  234  EGEEVTGA  241



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   318 bits (816),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR NQ K+TCYAQSSQIRQIRRKMREIM
Sbjct  113  LVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRPNQIKKTCYAQSSQIRQIRRKMREIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
              +AQSCDLK+LV KFIPE IG+EIEKAT  IYPLQN FIRKVKILKAPKFDL KLME
Sbjct  173  TREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPLQNTFIRKVKILKAPKFDLMKLME  230



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   319 bits (817),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 171/206 (83%), Gaps = 17/206 (8%)
 Frame = -3

Query  739  IASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVK  560
            IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVK
Sbjct  63   IASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVK  122

Query  559  KWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQ  380
            KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R N              QIRRKM +IMVNQ
Sbjct  123  KWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPN--------------QIRRKMVDIMVNQ  168

Query  379  AQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDY  200
            A SCDLK+LV KFIPE IG+EIEKATSSI+PLQNVFIRKVKILKAPKFDLGKLMEVHGDY
Sbjct  169  ASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFIRKVKILKAPKFDLGKLMEVHGDY  228

Query  199  TEDVGTKLDRPAADEPIAEATEPVGA  122
             EDVG KL+RP   +   EA + V A
Sbjct  229  KEDVGVKLERPVEGD---EAGQEVAA  251



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   319 bits (817),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR EDVQGRN LTNFWGMD+TTDKLR
Sbjct  52   QGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLRVEDVQGRNCLTNFWGMDYTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEA VDVKTTD Y LRMF I FTKKR  Q K+T YAQSSQIRQIR+KM EI
Sbjct  112  SLVRKWQTLIEAQVDVKTTDGYLLRMFAIAFTKKRTGQVKKTAYAQSSQIRQIRKKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KFIPE+IG+EIEKAT  IYPLQN  IRKVKIL+APKFDL KL+EV
Sbjct  172  MTREASSCDLKELVGKFIPEAIGKEIEKATQGIYPLQNTAIRKVKILRAPKFDLTKLLEV  231

Query  211  HGDYTEDVGTKL-DRPAADEPIAEATE  134
            HGDY+E+ G K+ ++PA + P A   E
Sbjct  232  HGDYSEEAGAKIAEKPAEEIPGAATAE  258



>gb|KHG19561.1| 40S ribosomal S3a [Gossypium arboreum]
Length=245

 Score =   315 bits (807),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 177/212 (83%), Gaps = 20/212 (9%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKI                 GM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKI-----------------GMNFTTDKL  94

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIRQI RKMRE
Sbjct  95   RSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRPNQVKRTCYAQSSQIRQICRKMRE  154

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLM 
Sbjct  155  IMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYPLQNVFIREVKILKAPKFDLGKLMA  214

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            VHGDY+EDV  K++RP ADE +AE T E +GA
Sbjct  215  VHGDYSEDVRVKIERP-ADETMAEPTPELIGA  245



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   311 bits (797),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRAEDVQG NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGMNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDNYMLRMFAIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFD-LGKLME  215
            MVNQA SCDL +LV KFIPE IG+EIE ATS I PLQNV++RKVKI + P+    G   E
Sbjct  172  MVNQAASCDLXELVNKFIPEVIGKEIEXATSGIXPLQNVYVRKVKIPEGPQVSTWGSFXE  231

Query  214  VHGDY  200
            VHGDY
Sbjct  232  VHGDY  236



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR EDVQGRN LTNF+GMDFTTDKLR
Sbjct  52   QGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLRVEDVQGRNCLTNFYGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
             L++KWQSLIEAHVDVKTTD Y+LRMFCI FTKKR  Q KRTCYAQ+ QIR IR+KM EI
Sbjct  112  FLIRKWQSLIEAHVDVKTTDGYSLRMFCIAFTKKRQGQIKRTCYAQTGQIRSIRKKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SC++K+LV K IPE+IG++IEKA   I+P+ NVF+RKVK+LK PKFD  KLMEV
Sbjct  172  MAREASSCEVKELVAKLIPEAIGKDIEKACQGIFPITNVFVRKVKVLKTPKFDHAKLMEV  231

Query  211  HGDYTEDVGTKLDRPAADE  155
            HGDYT +VGTK++R   +E
Sbjct  232  HGDYTAEVGTKVERVLIEE  250



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   306 bits (785),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLK R+FE+SLADL NDED +FRK++L+ EDVQG+NVLTNF GMDFTTDK+R
Sbjct  52   QGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLKCEDVQGKNVLTNFAGMDFTTDKIR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW SLIE  VDVKTTD Y+LR+FCIGFTK+R++Q KRTCYAQS+QIR+IR KM EI
Sbjct  112  SLVRKWFSLIECFVDVKTTDGYSLRVFCIGFTKRRIDQAKRTCYAQSAQIRRIRAKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  +  +CDLK+LVLKFIPE IG+EIEK+ S IYPLQNV+IRKVK+LKAPKFDL KLMEV
Sbjct  172  ITRECTTCDLKELVLKFIPEVIGKEIEKSCSGIYPLQNVYIRKVKVLKAPKFDLTKLMEV  231

Query  211  HGDYT-EDVGTKLDRP  167
            HGDY+ E VG  ++RP
Sbjct  232  HGDYSNEAVGQPVERP  247



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   306 bits (784),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLK R+FE+SLADL NDED +FRK++L+ EDVQG+NVLTNF GMDFTTDK+R
Sbjct  52   QGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLKCEDVQGKNVLTNFAGMDFTTDKIR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R++Q KRTCYAQS+QIR+IR KM EI
Sbjct  112  SLVRKWFSLIECFVDVKTTDGYTLRVFCIGFTKRRMDQAKRTCYAQSAQIRKIRAKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  +  +CDLK+LVLKFIPE IG+EIEK+ + IYPLQNV+IRKVKILKAPKFDL KLMEV
Sbjct  172  ITRECTTCDLKELVLKFIPEVIGKEIEKSCAGIYPLQNVYIRKVKILKAPKFDLTKLMEV  231

Query  211  HGDYT-EDVGTKLDRP  167
            HGDY+ E VG  + RP
Sbjct  232  HGDYSGEAVGEAVARP  247



>sp|Q9XEG7.3|RS3A_TORRU RecName: Full=40S ribosomal protein S3a [Syntrichia ruralis]
 gb|AAD23952.1|AF093109_1 ribosomal protein S3 [Syntrichia ruralis]
Length=248

 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 168/192 (88%), Gaps = 3/192 (2%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GL  RVFEVSLADLQNDED AFRKI+LRAEDVQG+NVLTNFWGMDFTTDKLRS
Sbjct  52   GTKIASDGLNFRVFEVSLADLQNDEDQAFRKIKLRAEDVQGKNVLTNFWGMDFTTDKLRS  111

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQSLI+AHVDVKTTDNY +R+FCI FTKKR N   R  YAQSSQI  IRRKMREIM
Sbjct  112  LVRKWQSLIQAHVDVKTTDNYQIRIFCIAFTKKRPNHT-RNFYAQSSQI-AIRRKMREIM  169

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATS-SIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            V +AQ+CDLK+LV KFIPE IG+EI++  S  IYPLQ+ FIRKVKILKAPKFDL KLMEV
Sbjct  170  VKEAQTCDLKELVAKFIPEVIGKEIDEWRSQGIYPLQSTFIRKVKILKAPKFDLMKLMEV  229

Query  211  HGDYTEDVGTKL  176
            HGDY E+VG K+
Sbjct  230  HGDYNEEVGAKI  241



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score =   302 bits (773),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 171/211 (81%), Gaps = 2/211 (1%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK R+FE SLADLQ DED AFRK+ L+ EDVQG NVLT F GMDFTTDKLRS
Sbjct  53   GTKIASDGLKGRIFECSLADLQQDEDQAFRKMLLKCEDVQGTNVLTQFAGMDFTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R++Q KRTCYAQS QIRQIR+KM EI+
Sbjct  113  LVRKWFSLIETFVDVKTTDQYTLRVFCIGFTKRRMDQTKRTCYAQSGQIRQIRKKMNEII  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +  SCDLK+ VLKFIPE IG+EIEK  + IYPLQNV+IRKVKILK PKFD+ KLMEVH
Sbjct  173  NREISSCDLKESVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKILKRPKFDVTKLMEVH  232

Query  208  GDYT-EDVGTKLDRPA-ADEPIAEATEPVGA  122
            GDY  ED G K+DRP    E + +  E VGA
Sbjct  233  GDYAGEDAGAKVDRPKDLIEKVEKRDEVVGA  263



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIAS+GLK R+FE SLADL  DED AFRK+ L+ EDVQG+NVLTNF+GMDFTTDK+R
Sbjct  60   QGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLKCEDVQGKNVLTNFYGMDFTTDKIR  119

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KW SLIE  VDVKTTD YT+R+FCIGFTK+RV+Q KRTCYAQS+QIR+IR KM EI
Sbjct  120  SLVRKWFSLIECFVDVKTTDGYTMRVFCIGFTKRRVDQTKRTCYAQSAQIRKIRAKMVEI  179

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  + +SCDLK+LVLKFIPE IG+EIEK+ S IYPLQNV++RKVK+LK PKFD+ KLMEV
Sbjct  180  IKRECESCDLKELVLKFIPEVIGKEIEKSCSGIYPLQNVYLRKVKMLKTPKFDVTKLMEV  239

Query  211  HGDYT-EDVGTKLDR  170
            HGDY+ E+VG ++ R
Sbjct  240  HGDYSGEEVGQQIPR  254



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 161/182 (88%), Gaps = 3/182 (2%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM+FTTDKLR
Sbjct  122  QGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGMNFTTDKLR  181

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQIRRKM EI
Sbjct  182  SLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEI  241

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRK +  + P+    +  E 
Sbjct  242  MINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKGEDTQGPQV---RSWET  298

Query  211  HG  206
            HG
Sbjct  299  HG  300



>ref|XP_003060358.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55127.1| predicted protein [Micromonas pusilla CCMP1545]
Length=257

 Score =   293 bits (751),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK R+FEVSLADL  DED AFRK+ L+ EDVQG NVLT F GMDFTTDK+RS
Sbjct  53   GTKIASDGLKGRIFEVSLADLNQDEDQAFRKMLLKCEDVQGTNVLTQFHGMDFTTDKIRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KW SLIE + DVKTTD Y LR+FCIGFTK+R++Q KRTCYAQS QIRQIR+KM EI+
Sbjct  113  LVRKWFSLIECYADVKTTDGYRLRVFCIGFTKRRMDQTKRTCYAQSGQIRQIRKKMVEII  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +  +CDLK+ VLKFIPE IG+EIEK  + IYPLQNV+IRKVKIL APKFD+ KLMEVH
Sbjct  173  SRETTTCDLKECVLKFIPEVIGKEIEKVCAGIYPLQNVYIRKVKILGAPKFDVTKLMEVH  232

Query  208  GDYT-EDVGTKLDR  170
            GDYT E+VG K++R
Sbjct  233  GDYTSEEVGAKVER  246



>ref|XP_011395666.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
 gb|KFM22801.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
Length=260

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 167/208 (80%), Gaps = 5/208 (2%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK RV  V+LADLQ ++ +A+R I+LR EDVQGR+ LTNF GMD TTDKLRS
Sbjct  53   GTKIASDGLKGRVITVNLADLQKNDADAYRNIKLRVEDVQGRHCLTNFHGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVKTTD YTLR+F I FTKKR  Q K+T YAQSSQIR IRR+M +IM
Sbjct  113  LVRKWQTLIEAHVDVKTTDGYTLRLFAIAFTKKRAGQVKKTAYAQSSQIRAIRRRMVDIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +A S DLKDLV KFIPE+IG+EIEKA   IYPLQN F+RKVK+L++PKFD+GKLMEVH
Sbjct  173  TREATSVDLKDLVAKFIPEAIGKEIEKACQGIYPLQNTFVRKVKVLRSPKFDVGKLMEVH  232

Query  208  GDYTEDVGTKLDRPA----ADEPIAEAT  137
            GD   +V T +DRPA     D P  EAT
Sbjct  233  GDLPTEVSTAVDRPAEGVVGDAP-EEAT  259



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 152/180 (84%), Gaps = 19/180 (11%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLRAEDVQG+NVLTNFWGMDFTTDKLR
Sbjct  52   QGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVD                   R NQ K+T YAQSSQIRQIRRKMREI
Sbjct  112  SLVRKWQTLIEAHVD-------------------RQNQNKKTSYAQSSQIRQIRRKMREI  152

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA SCDLK+LV KFIPE IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME 
Sbjct  153  MTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEA  212



>ref|XP_003038024.1| 40S ribosomal protein S1 [Schizophyllum commune H4-8]
 gb|EFJ03122.1| hypothetical protein SCHCODRAFT_72059 [Schizophyllum commune 
H4-8]
Length=256

 Score =   286 bits (731),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIVEVSLADLNKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GTK+ +   +  I E+
Sbjct  232  HGESTDETGTKIAKDFKEPEILES  255



>ref|XP_007862325.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59292.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
Length=256

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            G K A++ LK R+ EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKLRS
Sbjct  53   GLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q K+T YAQSSQIR+IR+KM EIM
Sbjct  113  LVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRQSQVKKTTYAQSSQIREIRKKMFEIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +A SCDLK+LV KFIPE+IGREIEKAT SIYPLQNV++RK KILKAPKFD+ KL+E+H
Sbjct  173  TREATSCDLKELVQKFIPEAIGREIEKATRSIYPLQNVYVRKAKILKAPKFDVSKLLELH  232

Query  208  GDYTEDVGTKLDRPAADEPIAEA  140
            G+ T++ GT++ +   +  I E+
Sbjct  233  GESTDETGTRVVKDFKEPEILES  255



>gb|KIY51600.1| ribosomal protein S3Ae [Fistulina hepatica ATCC 64428]
Length=256

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            G K A++ LK RV EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKLRS
Sbjct  53   GLKNANDSLKGRVVEVSLADLNKDEEQAFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IRRKM EIM
Sbjct  113  LVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRRKMFEIM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV++RK KILKAPKFD+ KLME+H
Sbjct  173  TREATSCDLKELVQKFVPEAIGREIEKAARGIYPLQNVYVRKAKILKAPKFDMSKLMELH  232

Query  208  GDYTEDVGTKLDRPAADEPIAEA  140
            G+ T++ GTK+ +   +  I +A
Sbjct  233  GESTDETGTKVAKDFQEPEILDA  255



>ref|XP_003638197.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=159

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  598  MDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIR  419
            M+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R NQ KRTCYAQSSQIR
Sbjct  1    MNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRANQVKRTCYAQSSQIR  60

Query  418  QIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPK  239
            QIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPLQNVFIRKVKILKAPK
Sbjct  61   QIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKAPK  120

Query  238  FDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  122
            FDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  121  FDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  159



>gb|ERZ98268.1| hypothetical protein GLOINDRAFT_339726, partial [Rhizophagus 
irregularis DAOM 181602]
Length=253

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK RVFEVSLADL  DE+ AFRKI+LR ++VQG+N+LTNF GMDFT+DKLR
Sbjct  48   QGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLRVDEVQGKNLLTNFHGMDFTSDKLR  107

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQSLIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQSSQIRQIR+KM +I
Sbjct  108  SLVKKWQSLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQSSQIRQIRKKMFDI  167

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  QA +CDLK+LVLKF+PESIGREIEKA   IYPLQ V+IRKVKILK+PKFD+ KLME+
Sbjct  168  MTQQAATCDLKELVLKFVPESIGREIEKACQGIYPLQFVYIRKVKILKSPKFDVQKLMEL  227

Query  211  HGDYTEDVGTKL  176
            HGD   D G+K+
Sbjct  228  HGDNI-DTGSKM  238



>gb|KIK48635.1| hypothetical protein CY34DRAFT_797777 [Suillus luteus UH-Slu-Lm8-n1]
Length=256

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNASDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQ+SQIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRPNQVRKTTYAQTSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKDFKEPEILES  255



>gb|EMD41078.1| hypothetical protein CERSUDRAFT_80722 [Ceriporiopsis subvermispora 
B]
Length=256

 Score =   284 bits (726),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ E+SLADL NDE+ AFRKI+LR +++QG+N LTNF GM FT+DKLR
Sbjct  52   QGLKNANDSLKGRIVEISLADLNNDEEQAFRKIKLRVDEIQGKNCLTNFHGMAFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R  Q ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLIRLFAIGFTKRRPQQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+I K KILKAPKFDL KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIHKAKILKAPKFDLSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKEFKEPEILES  255



>ref|XP_007268611.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
 gb|EJD01334.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
Length=256

 Score =   283 bits (724),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ L+ R+ EVSLADL  DE+ AFRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLRGRIVEVSLADLAKDEEQAFRKIKLRIDEIQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R  Q K+T YAQ++QIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPTQVKKTTYAQTAQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LVLKFIPE+IGREIEKAT  IYPLQNV++RK KI+KAPKFD+ KLME+
Sbjct  172  MTREASSCDLKELVLKFIPEAIGREIEKATRKIYPLQNVYVRKAKIIKAPKFDVSKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKEFKEPEIQES  255



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 165/212 (78%), Gaps = 13/212 (6%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLK RVFEVS ADLQN ED AFRK RL AE+VQGRNVLTNF GMD TTDKLR
Sbjct  39   QGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLIAEEVQGRNVLTNFHGMDLTTDKLR  97

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            S+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  NQ K+TCYAQ +Q+RQIR+KM E+
Sbjct  98   SMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCSNQVKKTCYAQHTQVRQIRKKMTEM  157

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            MV +  + DLKD+V K IPESIG++IEKA   IYPL +V IRKVK+LK PKF+LGKL+E+
Sbjct  158  MVREVSTSDLKDVVNKLIPESIGKDIEKACQRIYPLHDVLIRKVKVLKKPKFELGKLLEL  217

Query  211  HGDYTE------------DVGTKLDRPAADEP  152
            HG+ T             + G K+DRP   EP
Sbjct  218  HGEGTSKGGAAPATTPTGEEGIKVDRPEGYEP  249



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLKHRVFEVSL DL +DED  + KIRL AEDVQG NV+TNFWGM FTTDKL 
Sbjct  52   QGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLCAEDVQGGNVITNFWGMSFTTDKLH  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLVKKWQ LIEAHV++KTTDNY LR+FCIGFTK+R N+ KRT YAQ+SQIR I  KM EI
Sbjct  112  SLVKKWQRLIEAHVNIKTTDNYMLRLFCIGFTKRRPNRVKRTSYAQASQIRHILWKMTEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M NQ  +CDLK+LV  FIPE IG+EIE ATS+I+PLQNVFIRKV  L +PKFD+GKLMEV
Sbjct  172  MSNQTSTCDLKELVSNFIPEVIGKEIENATSTIFPLQNVFIRKVNTL-SPKFDIGKLMEV  230



>ref|XP_007315533.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01811.1| hypothetical protein SERLA73DRAFT_120459 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27442.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
Length=256

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ ++RKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIVEVSLADLNKDEEQSYRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQ+SQIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRPNQVRKTTYAQTSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRIVKDFKEPEILES  255



>ref|XP_007382215.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10703.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=256

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ E+SL DL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIELSLGDLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q K+T YAQS+QIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYILRLFAIGFTKRRPTQVKKTTYAQSAQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKAT SIYPLQNV+IRK KI+KAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKATRSIYPLQNVYIRKAKIIKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGETTDETGTRIIKDFKEPEILES  255



>ref|XP_007843081.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
 gb|ESK97646.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
Length=256

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG + A++ LK RV EVSL DL  DED +FRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  52   QGLRNANDSLKGRVIEVSLGDLNKDEDQSFRKIKLRVDEIQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME+
Sbjct  172  MTREASNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  + E+
Sbjct  232  HGETTDETGTRVAKDFKEPEVLES  255



>gb|KIM46265.1| hypothetical protein M413DRAFT_441346 [Hebeloma cylindrosporum 
h7]
Length=256

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K  ++ LK R+ E+SLADL  DE+ +FRKI+LR +++QGRN LTNF GMDFT+DKLR
Sbjct  52   QGLKNPNDSLKGRIIEISLADLNKDEEQSFRKIKLRIDEIQGRNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKEFKEPEILES  255



>ref|XP_007767741.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
 gb|EIW82383.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
Length=256

 Score =   282 bits (721),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD Y +R+F I FTK+R NQ ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYLIRLFAIAFTKRRPNQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV+IRK KILKAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKNTRNIYPLQNVYIRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVVKDFKEPEILES  255



>gb|KIJ70171.1| hypothetical protein HYDPIDRAFT_104846 [Hydnomerulius pinastri 
MD-312]
Length=256

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNASDSLKGRIVEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK + +IYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKHSRNIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKDFKEPEILES  255



>gb|KIK30608.1| hypothetical protein PISMIDRAFT_670675 [Pisolithus microcarpus 
441]
Length=256

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADLQ DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLADLQKDEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQ+SQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQTSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKL  176
            HG+ T++ GT++
Sbjct  232  HGETTDETGTRV  243



>sp|B0CY45.2|RS3A_LACBS RecName: Full=40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
Length=256

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E+
Sbjct  172  MTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGD T++ GT++ +   +  I E+
Sbjct  232  HGDSTDETGTRIAKDFKEPEILES  255



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   281 bits (719),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 166/206 (81%), Gaps = 7/206 (3%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QGTKIASEGLK RVFEVSLADLQNDE  AFRK +L AE+VQGRNVLTNF GM+ TTDKLR
Sbjct  53   QGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLVAEEVQGRNVLTNFHGMNLTTDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            S+VKKWQ+LIEA+VDV+TTD + LR+FCIGFTKKR NQ K+TCYAQ +Q+R I +KM EI
Sbjct  112  SMVKKWQTLIEANVDVRTTDAFLLRLFCIGFTKKRQNQIKKTCYAQHTQVRAIXKKMVEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +  S DLK++V K IP+SIG++IEKA   IYPL +V+IRKVKILK PKFDLGKLME+
Sbjct  172  MSREVSSNDLKEVVNKLIPDSIGKDIEKACQGIYPLHDVYIRKVKILKKPKFDLGKLMEL  231

Query  211  HGD------YTEDVGTKLDRPAADEP  152
            HG+       T + G K+DRP   EP
Sbjct  232  HGEGGTTKTVTTEGGEKVDRPEGYEP  257



>gb|KIM33406.1| hypothetical protein M408DRAFT_153936 [Serendipita vermifera 
MAFF 305830]
Length=256

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K AS+ LK R+ EVSLADL  DED  FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNASDSLKGRIVEVSLADLVKDEDQTFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQSLIEAHVDVKTTD Y +R+F I FTK+R NQ ++T YAQS+QIR+IR+KM EI
Sbjct  112  SLVRKWQSLIEAHVDVKTTDGYIIRLFAIAFTKRRANQVRKTTYAQSAQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKA   I+P+Q+VFIRK KI+KAPKFD+ KLME+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKAARGIFPIQSVFIRKAKIVKAPKFDINKLMEM  231

Query  211  HGDYTEDVGTKLDRPAADEPIAE  143
            HG+ T++ GTK+ +   +  + E
Sbjct  232  HGEITDETGTKVAKDFKEPEVME  254



>ref|XP_007392195.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59637.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
Length=256

 Score =   280 bits (717),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ AFRKI+LR ++VQG+N LTNF GM FT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLRVDEVQGKNCLTNFHGMSFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R NQ ++T YAQSSQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLIRLFTIGFTKRRPNQVRKTTYAQSSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++ K KILKAP+FDL KL+E+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVHKAKILKAPRFDLSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVVKDFKEPEILES  255



>gb|AFU72288.1| 40S ribosomal protein S1, partial [Amanita strobiliformis]
Length=219

 Score =   279 bits (714),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            G K A++ LK R+ E+SLADL  DE+ AFRKI+LR ++VQG+N LTNF GMDFT+DKLRS
Sbjct  16   GMKNANDSLKGRIIEISLADLNKDEEQAFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLRS  75

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM EI+
Sbjct  76   LVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFEII  135

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +A SCDLK+LV KF+PE+IGREIEKA   IYPLQNV+IRK KILKAPKFD+ KL+E+H
Sbjct  136  TREATSCDLKELVQKFVPEAIGREIEKACRGIYPLQNVYIRKAKILKAPKFDVSKLLELH  195

Query  208  GDYTEDVGTKLDRPAADEPIAEA  140
            G+ T++ GTK+ +   +  I E+
Sbjct  196  GESTDETGTKVAKDFQEPEILES  218



>gb|KIJ20179.1| hypothetical protein PAXINDRAFT_166304 [Paxillus involutus ATCC 
200175]
 gb|KIK98754.1| hypothetical protein PAXRUDRAFT_823536 [Paxillus rubicundulus 
Ve08.2h10]
Length=256

 Score =   280 bits (717),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK RV EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRVVEVSLADLNGDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R NQ ++T YAQ+SQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPNQVRKTTYAQTSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKDFKEPEILES  255



>gb|KJB28384.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=230

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 164/212 (77%), Gaps = 35/212 (17%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKL  575
            QGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRLRAEDVQG+NVLTNFWGM+FTTDKL
Sbjct  52   QGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKL  111

Query  574  RSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMRE  395
            R                         MFCI FTK+R NQ KRTCYAQSSQIRQIRRKMRE
Sbjct  112  R-------------------------MFCIRFTKRRPNQVKRTCYAQSSQIRQIRRKMRE  146

Query  394  IMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME  215
            IM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPLQNVFIR+VKILKAPKFDLGKLME
Sbjct  147  IMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYPLQNVFIRQVKILKAPKFDLGKLME  206

Query  214  VHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  122
            +        G K++RP ADE +AE T E +GA
Sbjct  207  MF-------GVKIERP-ADETMAEPTPELIGA  230



>gb|KIK65348.1| hypothetical protein GYMLUDRAFT_38796 [Gymnopus luxurians FD-317 
M1]
Length=256

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  ++ +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV+IRK KILKAPKFD+ KLME+
Sbjct  172  MTRESTNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYIRKAKILKAPKFDVSKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GTK+ +   +  I E+
Sbjct  232  HGESTDETGTKIAKDFKEPEILES  255



>sp|Q764D2.1|RS3A_LENED RecName: Full=40S ribosomal protein S1; AltName: Full=Protein 
cyc07 [Lentinula edodes]
 dbj|BAD11816.1| putative S-phase specific ribosomal protein cyc07 [Lentinula 
edodes]
Length=256

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQSSQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPTQVRKTTYAQSSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME+
Sbjct  172  MTREATNCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GTK+ +   +  + E+
Sbjct  232  HGESTDETGTKIAKDFKEPEVLES  255



>gb|KJA29982.1| hypothetical protein HYPSUDRAFT_81601 [Hypholoma sublateritium 
FD-334 SS-4]
Length=256

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ E+SLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIELSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQ+SQIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQTSQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATTCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVAKEFKEPEILES  255



>gb|KIM68608.1| hypothetical protein SCLCIDRAFT_1208801 [Scleroderma citrinum 
Foug A]
Length=256

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADLQ DE+ +FRKIRLR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIVEVSLADLQKDEEQSFRKIRLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R +Q ++T YAQ+SQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRPSQVRKTTYAQTSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEK T +IYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKHTRNIYPLQNVYVRKAKILKAPKFDMSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  232  HGESTDETGTRVVKDFKEPEILES  255



>ref|XP_001877091.1| 40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
 gb|EDR12827.1| predicted protein [Laccaria bicolor S238N-H82]
Length=273

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  69   QGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKLR  128

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM EI
Sbjct  129  SLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFEI  188

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E+
Sbjct  189  MTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLEL  248

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGD T++ GT++ +   +  I E+
Sbjct  249  HGDSTDETGTRIAKDFKEPEILES  272



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -3

Query  748  GTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRS  569
            GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR EDVQGRN LT+F GMD TTDKLRS
Sbjct  53   GTKIASDGLKGRIINVSLADLQSNEADAYRNIKLRIEDVQGRNCLTHFHGMDLTTDKLRS  112

Query  568  LVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIM  389
            LV+KWQ+LIEAHVDV+T D YTLRMFCI FTKK   Q K+TCYAQS+QIR IRRKM ++M
Sbjct  113  LVRKWQTLIEAHVDVRTADGYTLRMFCISFTKKGAGQIKKTCYAQSAQIRAIRRKMVDVM  172

Query  388  VNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVH  209
              +A SCDLKDLV KFIPE+IG++IEKA   I+PLQN FIRKVK+L+ PKFD  KL+EVH
Sbjct  173  TREATSCDLKDLVGKFIPEAIGKDIEKACLGIFPLQNTFIRKVKVLRTPKFDASKLLEVH  232

Query  208  GDYTEDVGTKLDR  170
             +Y  D G  ++R
Sbjct  233  ENYDVDAGEVVER  245



>gb|KIY73683.1| putative S-phase-specific ribosomal protein cyc07 [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=256

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSL DL  DE+ +FRK+RLR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLGDLNKDEEQSFRKMRLRVDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQS+Q+R+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSAQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A + DLKDLV KFIPE+IGREIEKA+ SIYPLQNV++RK KILKAPKFD+ KLME+
Sbjct  172  MTREATTVDLKDLVQKFIPEAIGREIEKASRSIYPLQNVYVRKAKILKAPKFDINKLMEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  + E+
Sbjct  232  HGESTDETGTRIAKDFKEPEVLES  255



>gb|KIK06774.1| hypothetical protein K443DRAFT_674057 [Laccaria amethystina LaAM-08-1]
Length=256

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR +++QG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLRIDEIQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQ+R+IR+KM EI
Sbjct  112  SLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQVREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A +CDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILK+PKFD+ KL+E+
Sbjct  172  MTREATNCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKSPKFDMSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGD T++ GT++ +   +  I E+
Sbjct  232  HGDSTDETGTRIAKDFKEPEILES  255



>gb|KCW84167.1| hypothetical protein EUGRSUZ_B01030 [Eucalyptus grandis]
Length=244

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 149/175 (85%), Gaps = 18/175 (10%)
 Frame = -3

Query  643  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  464
            +EDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  87   SEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  146

Query  463  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  284
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  147  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPL  206

Query  283  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAE-ATEPVGA  122
            QNVFIRK                VHGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  207  QNVFIRK----------------VHGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  244



>gb|KIM90711.1| hypothetical protein PILCRDRAFT_811171 [Piloderma croceum F 1598]
Length=256

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR ++VQG+N LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLRIDEVQGKNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R  Q ++T YAQS+QIR+IR+KM EI
Sbjct  112  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRQTQVRKTTYAQSAQIREIRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KF+PE+IGREIEKA  SIYPLQNV++RK KILKAPKFD+ KL+E+
Sbjct  172  MTREATSCDLKELVQKFVPEAIGREIEKAARSIYPLQNVYVRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  + E+
Sbjct  232  HGESTDETGTRVVKDFKEPEVLES  255



>ref|XP_001837102.1| 40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 sp|A8NX92.1|RS3A_COPC7 RecName: Full=40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 gb|EAU84719.1| 40s ribosomal protein s3ae-a [Coprinopsis cinerea okayama7#130]
Length=256

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR +++QGRN LTNF GMDFT+DKLR
Sbjct  52   QGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLRVDEIQGRNCLTNFHGMDFTSDKLR  111

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R  Q K+T YAQ++Q+R++R+KM EI
Sbjct  112  SLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRPTQVKKTTYAQTAQVRELRKKMFEI  171

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            +  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPLQNV+IRK KILKAPKFD+ KL+E+
Sbjct  172  ITREATSCDLKELVQKFVPEAIGREIEKASRSIYPLQNVYIRKAKILKAPKFDVSKLLEL  231

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HGD T++ GT++ +   +  + E+
Sbjct  232  HGDSTDESGTRVTKDFKEPEVLES  255



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIRLRAEDVQGRNVLTNFWGMDFTTDK  578
            QGTKIASEGLK+RVFEVSLADLQND D   +FRK RL AEDVQGRNVLTNF GMD TTDK
Sbjct  53   QGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFRLIAEDVQGRNVLTNFHGMDLTTDK  112

Query  577  LRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMR  398
            LRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIGFT K    QK+TCYAQ +Q+R IR+KM 
Sbjct  113  LRSMVKKWQTLIEAHVDVKTTDGYLLRVFCIGFTNKDQMSQKKTCYAQHTQVRAIRKKMT  172

Query  397  EIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLM  218
            EI+  +    DLKD+V K +P+SI +EIEK    IYPL +V+IRKVK+LK P+FDL KL+
Sbjct  173  EIITKEVTDSDLKDVVQKLLPDSIAKEIEKYCQKIYPLHDVYIRKVKVLKKPRFDLSKLL  232

Query  217  EVHGD---YTEDVGTKLDRPAADEP  152
            E+HGD    +++ G K+DRP   EP
Sbjct  233  ELHGDSKAASDEPGAKVDRPKGYEP  257



>gb|EPS95373.1| hypothetical protein FOMPIDRAFT_157719 [Fomitopsis pinicola FP-58527 
SS1]
Length=266

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  751  QGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLR  572
            QG K A++ LK R+ EVSLADL NDE+ AFRKI+LR ++VQG++ LTNF GM F++DKLR
Sbjct  62   QGLKNANDSLKGRIVEVSLADLNNDEEQAFRKIKLRIDEVQGKHCLTNFHGMSFSSDKLR  121

Query  571  SLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREI  392
            SLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R +Q ++T YAQSSQIR+IRRKM EI
Sbjct  122  SLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRPSQVRKTTYAQSSQIREIRRKMFEI  181

Query  391  MVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV  212
            M  +A SCDLK+LV KFIPE+IGREIEKA  SIYP+QNV++ K KILKAPKFD+ KL+E+
Sbjct  182  MTREATSCDLKELVQKFIPEAIGREIEKAARSIYPVQNVYVHKAKILKAPKFDMSKLLEL  241

Query  211  HGDYTEDVGTKLDRPAADEPIAEA  140
            HG+ T++ GT++ +   +  I E+
Sbjct  242  HGESTDETGTRVAKDFKEPEILES  265



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050