BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016E22

Length=845
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792571.1|  PREDICTED: serine/arginine-rich splicing fac...    172   4e-49   Nicotiana sylvestris
ref|XP_003532014.1|  PREDICTED: serine/arginine-rich splicing fac...    169   5e-48   Glycine max [soybeans]
gb|KHN10603.1|  Serine/arginine-rich splicing factor 7                  169   6e-48   Glycine soja [wild soybean]
ref|XP_009606697.1|  PREDICTED: serine/arginine-rich splicing fac...    170   6e-48   Nicotiana tomentosiformis
ref|XP_009606700.1|  PREDICTED: serine/arginine-rich splicing fac...    169   6e-48   Nicotiana tomentosiformis
ref|XP_006601788.1|  PREDICTED: uncharacterized protein LOC100776...    167   1e-47   Glycine max [soybeans]
ref|XP_006601786.1|  PREDICTED: uncharacterized protein LOC100776...    167   2e-47   Glycine max [soybeans]
ref|XP_006601785.1|  PREDICTED: uncharacterized protein LOC100776...    167   2e-47   Glycine max [soybeans]
ref|XP_010271961.1|  PREDICTED: serine/arginine-rich splicing fac...    167   3e-47   Nelumbo nucifera [Indian lotus]
gb|KJB31255.1|  hypothetical protein B456_005G183600                    167   8e-47   Gossypium raimondii
ref|XP_008793863.1|  PREDICTED: serine/arginine-rich splicing fac...    166   8e-47   Phoenix dactylifera
ref|XP_008793865.1|  PREDICTED: serine/arginine-rich splicing fac...    166   1e-46   Phoenix dactylifera
ref|XP_010928600.1|  PREDICTED: serine/arginine-rich splicing fac...    165   2e-46   Elaeis guineensis
ref|XP_010251307.1|  PREDICTED: serine/arginine-rich splicing fac...    165   2e-46   
ref|NP_001242436.1|  uncharacterized protein LOC100776329               164   3e-46   Glycine max [soybeans]
ref|XP_010100489.1|  Serine/arginine-rich splicing factor 7             165   1e-45   
ref|XP_004509838.1|  PREDICTED: serine/arginine-rich splicing fac...    163   1e-45   Cicer arietinum [garbanzo]
ref|XP_011013271.1|  PREDICTED: serine/arginine-rich splicing fac...    163   1e-45   Populus euphratica
gb|KJB31257.1|  hypothetical protein B456_005G183600                    161   2e-45   Gossypium raimondii
gb|KHG11979.1|  Serine/arginine-rich splicing factor 7                  162   2e-45   Gossypium arboreum [tree cotton]
ref|XP_011013270.1|  PREDICTED: serine/arginine-rich splicing fac...    162   2e-45   Populus euphratica
gb|KJB31251.1|  hypothetical protein B456_005G183600                    162   2e-45   Gossypium raimondii
gb|KJB31256.1|  hypothetical protein B456_005G183600                    162   2e-45   Gossypium raimondii
ref|XP_010914080.1|  PREDICTED: serine/arginine-rich splicing fac...    162   2e-45   Elaeis guineensis
ref|XP_010914079.1|  PREDICTED: serine/arginine-rich splicing fac...    162   3e-45   
ref|XP_006438430.1|  hypothetical protein CICLE_v10032693mg             164   3e-45   
emb|CDY59084.1|  BnaA09g54590D                                          160   3e-45   Brassica napus [oilseed rape]
ref|XP_010023818.1|  PREDICTED: serine/arginine-rich splicing fac...    162   3e-45   
ref|XP_008779620.1|  PREDICTED: serine/arginine-rich splicing fac...    162   5e-45   
ref|XP_008794412.1|  PREDICTED: serine/arginine-rich splicing fac...    161   6e-45   Phoenix dactylifera
ref|XP_010551560.1|  PREDICTED: serine/arginine-rich splicing fac...    161   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_010929222.1|  PREDICTED: serine/arginine-rich splicing fac...    161   7e-45   Elaeis guineensis
ref|XP_010551557.1|  PREDICTED: serine/arginine-rich splicing fac...    161   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_008793862.1|  PREDICTED: serine/arginine-rich splicing fac...    161   8e-45   Phoenix dactylifera
ref|XP_006416049.1|  hypothetical protein EUTSA_v10008869mg             161   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_008793864.1|  PREDICTED: serine/arginine-rich splicing fac...    160   1e-44   Phoenix dactylifera
ref|XP_010682582.1|  PREDICTED: serine/arginine-rich splicing fac...    160   1e-44   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY47646.1|  BnaC05g19020D                                          160   1e-44   Brassica napus [oilseed rape]
ref|XP_010929220.1|  PREDICTED: serine/arginine-rich splicing fac...    161   1e-44   Elaeis guineensis
ref|XP_008446226.1|  PREDICTED: serine/arginine-rich splicing fac...    160   2e-44   Cucumis melo [Oriental melon]
ref|XP_009115493.1|  PREDICTED: serine/arginine-rich splicing fac...    160   2e-44   Brassica rapa
ref|XP_009115492.1|  PREDICTED: serine/arginine-rich splicing fac...    160   2e-44   Brassica rapa
ref|XP_007044557.1|  RS-containing zinc finger protein 21 isoform 1     160   2e-44   
ref|XP_006438427.1|  hypothetical protein CICLE_v10032693mg             160   2e-44   
ref|XP_004155352.1|  PREDICTED: serine/arginine-rich splicing fac...    160   2e-44   
ref|XP_006438428.1|  hypothetical protein CICLE_v10032693mg             160   2e-44   Citrus clementina [clementine]
gb|AFK40774.1|  unknown                                                 159   4e-44   Lotus japonicus
ref|XP_008340015.1|  PREDICTED: serine/arginine-rich splicing fac...    159   5e-44   Malus domestica [apple tree]
ref|XP_008340014.1|  PREDICTED: serine/arginine-rich splicing fac...    159   5e-44   Malus domestica [apple tree]
ref|XP_002534324.1|  arginine/serine-rich splicing factor, putative     158   9e-44   Ricinus communis
ref|XP_002264105.1|  PREDICTED: serine/arginine-rich splicing fac...    158   9e-44   Vitis vinifera
emb|CDP00182.1|  unnamed protein product                                159   1e-43   Coffea canephora [robusta coffee]
ref|XP_010653311.1|  PREDICTED: serine/arginine-rich splicing fac...    158   1e-43   Vitis vinifera
ref|XP_011082043.1|  PREDICTED: serine/arginine-rich splicing fac...    157   2e-43   Sesamum indicum [beniseed]
ref|XP_006845500.1|  hypothetical protein AMTR_s00019p00154210          160   2e-43   
ref|XP_011077513.1|  PREDICTED: serine/arginine-rich splicing fac...    157   2e-43   
ref|XP_011077592.1|  PREDICTED: serine/arginine-rich splicing fac...    157   2e-43   
gb|KJB15225.1|  hypothetical protein B456_002G165700                    158   3e-43   Gossypium raimondii
ref|XP_010648839.1|  PREDICTED: serine/arginine-rich splicing fac...    157   3e-43   Vitis vinifera
gb|KDP26562.1|  hypothetical protein JCGZ_17720                         157   3e-43   Jatropha curcas
ref|XP_002272657.2|  PREDICTED: serine/arginine-rich splicing fac...    156   4e-43   Vitis vinifera
emb|CDP12463.1|  unnamed protein product                                156   4e-43   Coffea canephora [robusta coffee]
ref|XP_010278048.1|  PREDICTED: serine/arginine-rich splicing fac...    156   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009363525.1|  PREDICTED: serine/arginine-rich splicing fac...    156   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_009363527.1|  PREDICTED: serine/arginine-rich splicing fac...    156   7e-43   Pyrus x bretschneideri [bai li]
ref|XP_006655864.1|  PREDICTED: serine/arginine-rich splicing fac...    156   8e-43   
ref|XP_009765884.1|  PREDICTED: serine/arginine-rich splicing fac...    157   1e-42   Nicotiana sylvestris
ref|XP_004297645.1|  PREDICTED: serine/arginine-rich splicing fac...    155   1e-42   Fragaria vesca subsp. vesca
ref|NP_001057018.1|  Os06g0187900                                       155   1e-42   
ref|XP_011463379.1|  PREDICTED: serine/arginine-rich splicing fac...    155   1e-42   Fragaria vesca subsp. vesca
gb|EEC80152.1|  hypothetical protein OsI_21961                          157   3e-42   Oryza sativa Indica Group [Indian rice]
gb|EEE65232.1|  hypothetical protein OsJ_20394                          157   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008221783.1|  PREDICTED: serine/arginine-rich splicing fac...    154   3e-42   Prunus mume [ume]
ref|XP_009415507.1|  PREDICTED: serine/arginine-rich splicing fac...    154   3e-42   
ref|XP_009395828.1|  PREDICTED: serine/arginine-rich splicing fac...    154   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221782.1|  PREDICTED: serine/arginine-rich splicing fac...    154   4e-42   Prunus mume [ume]
ref|XP_006357055.1|  PREDICTED: serine/arginine-rich splicing fac...    154   4e-42   Solanum tuberosum [potatoes]
ref|XP_003544651.1|  PREDICTED: serine/arginine-rich splicing fac...    154   4e-42   Glycine max [soybeans]
ref|XP_006596163.1|  PREDICTED: serine/arginine-rich splicing fac...    154   4e-42   Glycine max [soybeans]
ref|XP_006596162.1|  PREDICTED: serine/arginine-rich splicing fac...    154   4e-42   Glycine max [soybeans]
ref|XP_006600176.1|  PREDICTED: uncharacterized protein LOC100790...    154   4e-42   Glycine max [soybeans]
gb|AGE46162.1|  arginine/serine-rich splicing factor RSZ23 transc...    152   5e-42   Physcomitrella patens
ref|NP_001241113.1|  uncharacterized protein LOC100790689               154   5e-42   Glycine max [soybeans]
gb|ABK24519.1|  unknown                                                 153   5e-42   Picea sitchensis
gb|KJB53760.1|  hypothetical protein B456_009G066600                    152   5e-42   Gossypium raimondii
ref|XP_010942196.1|  PREDICTED: serine/arginine-rich splicing fac...    155   5e-42   Elaeis guineensis
ref|XP_002893311.1|  hypothetical protein ARALYDRAFT_472646             153   6e-42   
ref|XP_010942204.1|  PREDICTED: serine/arginine-rich splicing fac...    154   6e-42   Elaeis guineensis
ref|XP_010942203.1|  PREDICTED: serine/arginine-rich splicing fac...    154   6e-42   
ref|XP_010942202.1|  PREDICTED: serine/arginine-rich splicing fac...    155   6e-42   Elaeis guineensis
ref|XP_001776556.1|  predicted protein                                  153   6e-42   
ref|XP_007161329.1|  hypothetical protein PHAVU_001G060500g             153   6e-42   Phaseolus vulgaris [French bean]
gb|EPS72339.1|  hypothetical protein M569_02421                         153   6e-42   Genlisea aurea
ref|XP_007161330.1|  hypothetical protein PHAVU_001G060500g             153   7e-42   Phaseolus vulgaris [French bean]
gb|AGE46161.1|  arginine/serine-rich splicing factor RSZ23 transc...    154   7e-42   Physcomitrella patens
ref|XP_010942211.1|  PREDICTED: serine/arginine-rich splicing fac...    154   7e-42   Elaeis guineensis
ref|XP_004244489.1|  PREDICTED: serine/arginine-rich splicing fac...    153   7e-42   Solanum lycopersicum
ref|XP_010942200.1|  PREDICTED: serine/arginine-rich splicing fac...    155   8e-42   Elaeis guineensis
ref|XP_010942207.1|  PREDICTED: serine/arginine-rich splicing fac...    154   8e-42   Elaeis guineensis
ref|XP_010942194.1|  PREDICTED: serine/arginine-rich splicing fac...    155   8e-42   Elaeis guineensis
gb|AGE46163.1|  arginine/serine-rich splicing factor RSZ23 transc...    154   8e-42   Physcomitrella patens
ref|XP_010942201.1|  PREDICTED: serine/arginine-rich splicing fac...    155   8e-42   Elaeis guineensis
ref|XP_002436620.1|  hypothetical protein SORBIDRAFT_10g005960          153   9e-42   Sorghum bicolor [broomcorn]
ref|XP_007223543.1|  hypothetical protein PRUPE_ppa012111mg             153   9e-42   
gb|KJB53756.1|  hypothetical protein B456_009G066600                    153   9e-42   Gossypium raimondii
ref|XP_010692998.1|  PREDICTED: serine/arginine-rich splicing fac...    153   9e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB53759.1|  hypothetical protein B456_009G066600                    153   9e-42   Gossypium raimondii
ref|XP_010942209.1|  PREDICTED: serine/arginine-rich splicing fac...    154   9e-42   Elaeis guineensis
ref|XP_008389624.1|  PREDICTED: serine/arginine-rich splicing fac...    153   9e-42   Malus domestica [apple tree]
ref|XP_010942198.1|  PREDICTED: serine/arginine-rich splicing fac...    155   1e-41   Elaeis guineensis
ref|XP_010942208.1|  PREDICTED: serine/arginine-rich splicing fac...    154   1e-41   Elaeis guineensis
ref|XP_010942199.1|  PREDICTED: serine/arginine-rich splicing fac...    155   1e-41   Elaeis guineensis
ref|XP_008389623.1|  PREDICTED: serine/arginine-rich splicing fac...    153   1e-41   Malus domestica [apple tree]
ref|XP_010942206.1|  PREDICTED: serine/arginine-rich splicing fac...    153   1e-41   Elaeis guineensis
ref|XP_010942205.1|  PREDICTED: serine/arginine-rich splicing fac...    154   1e-41   Elaeis guineensis
ref|XP_010942197.1|  PREDICTED: serine/arginine-rich splicing fac...    154   1e-41   Elaeis guineensis
gb|KJB53763.1|  hypothetical protein B456_009G066600                    152   1e-41   Gossypium raimondii
gb|AFW85524.1|  hypothetical protein ZEAMMB73_327204                    151   1e-41   
ref|XP_009614737.1|  PREDICTED: serine/arginine-rich splicing fac...    152   1e-41   Nicotiana tomentosiformis
ref|XP_004964637.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   
ref|NP_001149338.1|  LOC100282961                                       152   2e-41   
ref|XP_009614738.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   Nicotiana tomentosiformis
ref|XP_009614739.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   Nicotiana tomentosiformis
gb|ACG35084.1|  splicing factor, arginine/serine-rich 7                 152   2e-41   Zea mays [maize]
ref|XP_010325195.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   Solanum lycopersicum
ref|XP_006305671.1|  hypothetical protein CARUB_v10010388mg             152   2e-41   Capsella rubella
ref|XP_004964636.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   
ref|XP_004245307.1|  PREDICTED: serine/arginine-rich splicing fac...    152   2e-41   Solanum lycopersicum
ref|XP_004964635.1|  PREDICTED: serine/arginine-rich splicing fac...    153   2e-41   
ref|XP_001782492.1|  predicted protein                                  153   2e-41   
ref|XP_006355194.1|  PREDICTED: serine/arginine-rich splicing fac...    151   4e-41   Solanum tuberosum [potatoes]
ref|XP_006647490.1|  PREDICTED: serine/arginine-rich splicing fac...    152   4e-41   Oryza brachyantha
gb|KJB68434.1|  hypothetical protein B456_010G245400                    153   4e-41   Gossypium raimondii
ref|XP_006647491.1|  PREDICTED: serine/arginine-rich splicing fac...    152   5e-41   Oryza brachyantha
ref|XP_006355197.1|  PREDICTED: serine/arginine-rich splicing fac...    151   5e-41   Solanum tuberosum [potatoes]
ref|XP_009386654.1|  PREDICTED: serine/arginine-rich splicing fac...    152   6e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009630985.1|  PREDICTED: serine/arginine-rich splicing fac...    151   6e-41   
ref|XP_009630986.1|  PREDICTED: serine/arginine-rich splicing fac...    151   6e-41   Nicotiana tomentosiformis
ref|XP_010526263.1|  PREDICTED: serine/arginine-rich splicing fac...    150   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010438021.1|  PREDICTED: serine/arginine-rich splicing fac...    151   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010432845.1|  PREDICTED: serine/arginine-rich splicing fac...    151   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010447518.1|  PREDICTED: serine/arginine-rich splicing fac...    151   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009779999.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   Nicotiana sylvestris
ref|NP_001047400.1|  Os02g0610600                                       150   1e-40   
gb|KDO67328.1|  hypothetical protein CISIN_1g046599mg                   149   1e-40   Citrus sinensis [apfelsine]
gb|ACX54788.2|  putative arginine/serine-rich splicing factor           150   1e-40   Arachis diogoi
ref|XP_004498562.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   Cicer arietinum [garbanzo]
gb|EEE57352.1|  hypothetical protein OsJ_07486                          150   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010498894.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   
ref|XP_009780000.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   Nicotiana sylvestris
ref|XP_008466294.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-40   Cucumis melo [Oriental melon]
gb|KDP33463.1|  hypothetical protein JCGZ_07034                         150   2e-40   Jatropha curcas
ref|XP_010498892.1|  PREDICTED: serine/arginine-rich splicing fac...    150   2e-40   
ref|XP_003564174.1|  PREDICTED: serine/arginine-rich splicing fac...    150   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_006412579.1|  hypothetical protein EUTSA_v10026315mg             150   2e-40   Eutrema salsugineum [saltwater cress]
gb|KJB68433.1|  hypothetical protein B456_010G245400                    150   2e-40   Gossypium raimondii
ref|XP_004136307.1|  PREDICTED: serine/arginine-rich splicing fac...    150   2e-40   Cucumis sativus [cucumbers]
emb|CDY68847.1|  BnaAnng28560D                                          150   2e-40   Brassica napus [oilseed rape]
gb|EMS45589.1|  Serine/arginine-rich splicing factor 7                  150   2e-40   Triticum urartu
gb|KHG09265.1|  Serine/arginine-rich splicing factor 7                  149   3e-40   Gossypium arboreum [tree cotton]
ref|NP_001117342.1|  serine/arginine-rich splicing factor RSZ21         149   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450201.1|  hypothetical protein CICLE_v10009655mg             149   4e-40   
gb|EYU29179.1|  hypothetical protein MIMGU_mgv1a014305mg                149   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_010268362.1|  PREDICTED: serine/arginine-rich splicing fac...    152   4e-40   
gb|EMT27182.1|  Splicing factor, arginine/serine-rich 7                 149   4e-40   
gb|EPS60072.1|  hypothetical protein M569_14729                         149   4e-40   Genlisea aurea
ref|XP_009140565.1|  PREDICTED: serine/arginine-rich splicing fac...    149   4e-40   Brassica rapa
ref|XP_003588649.1|  RNA-binding protein Rsf1                           149   5e-40   
ref|XP_009138024.1|  PREDICTED: serine/arginine-rich splicing fac...    149   5e-40   Brassica rapa
ref|XP_010477689.1|  PREDICTED: serine/arginine-rich splicing fac...    148   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009396254.1|  PREDICTED: serine/arginine-rich splicing fac...    149   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010477687.1|  PREDICTED: serine/arginine-rich splicing fac...    148   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007011623.1|  Serine/arginine-rich 22 isoform 1                  148   6e-40   
ref|XP_006284575.1|  hypothetical protein CARUB_v10005800mg             149   6e-40   Capsella rubella
ref|NP_001185074.1|  serine/arginine-rich splicing factor RSZ21         148   7e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05351.1|  RSZp21 protein                                         148   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396262.1|  PREDICTED: serine/arginine-rich splicing fac...    149   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_564208.1|  serine/arginine-rich splicing factor RSZ21            148   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140388.1|  uncharacterized protein LOC100272442               147   7e-40   
gb|AAF87159.1|AC002423_24  T23E23.2                                     148   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031384.1|  PREDICTED: serine/arginine-rich splicing fac...    148   8e-40   Populus euphratica
ref|XP_006382133.1|  splicing factor RSZp22 family protein              148   8e-40   Populus trichocarpa [western balsam poplar]
gb|AAY84872.1|  pre-mRNA processing factor                              147   9e-40   Triticum aestivum [Canadian hard winter wheat]
gb|KJB65745.1|  hypothetical protein B456_010G121100                    148   1e-39   Gossypium raimondii
gb|KJB65740.1|  hypothetical protein B456_010G121100                    147   1e-39   Gossypium raimondii
dbj|BAJ94659.1|  predicted protein                                      147   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB65743.1|  hypothetical protein B456_010G121100                    147   1e-39   Gossypium raimondii
ref|XP_003603553.1|  Splicing factor arginine/serine-rich               147   2e-39   
ref|XP_010112118.1|  Serine/arginine-rich splicing factor 7             147   2e-39   Morus notabilis
ref|XP_011044978.1|  PREDICTED: serine/arginine-rich splicing fac...    147   2e-39   Populus euphratica
ref|XP_002454683.1|  hypothetical protein SORBIDRAFT_04g035540          146   3e-39   Sorghum bicolor [broomcorn]
gb|AGC79943.1|  arginine/serine-rich splicing factor RSZ28VI            147   3e-39   Zea mays [maize]
ref|XP_004954180.1|  PREDICTED: serine/arginine-rich splicing fac...    146   3e-39   Setaria italica
ref|XP_006295037.1|  hypothetical protein CARUB_v10024105mg             145   3e-39   
ref|XP_010460162.1|  PREDICTED: serine/arginine-rich splicing fac...    146   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009117114.1|  PREDICTED: serine/arginine-rich splicing fac...    147   4e-39   
ref|XP_010460161.1|  PREDICTED: serine/arginine-rich splicing fac...    146   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007225929.1|  hypothetical protein PRUPE_ppa012147mg             146   5e-39   Prunus persica
ref|XP_008681365.1|  PREDICTED: uncharacterized protein LOC100272...    147   5e-39   Zea mays [maize]
ref|XP_002878770.1|  hypothetical protein ARALYDRAFT_481315             146   5e-39   
ref|XP_010429442.1|  PREDICTED: serine/arginine-rich splicing fac...    146   5e-39   Camelina sativa [gold-of-pleasure]
gb|EMS62939.1|  Serine/arginine-rich splicing factor 7                  148   6e-39   Triticum urartu
ref|XP_010417215.1|  PREDICTED: serine/arginine-rich splicing fac...    146   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006404997.1|  hypothetical protein EUTSA_v10000328mg             146   6e-39   
ref|NP_001132794.1|  hypothetical protein                               145   6e-39   
ref|XP_004953059.1|  PREDICTED: serine/arginine-rich splicing fac...    147   8e-39   Setaria italica
ref|XP_008681364.1|  PREDICTED: uncharacterized protein LOC100272...    147   8e-39   
ref|XP_008681360.1|  PREDICTED: uncharacterized protein LOC100272...    147   9e-39   
ref|XP_003575333.1|  PREDICTED: serine/arginine-rich splicing fac...    147   9e-39   Brachypodium distachyon [annual false brome]
gb|EMT10866.1|  Splicing factor, arginine/serine-rich 7                 147   9e-39   
ref|XP_006295038.1|  hypothetical protein CARUB_v10024105mg             145   9e-39   
gb|ACG44253.1|  splicing factor, arginine/serine-rich 7                 147   9e-39   Zea mays [maize]
ref|XP_010235684.1|  PREDICTED: serine/arginine-rich splicing fac...    147   9e-39   Brachypodium distachyon [annual false brome]
emb|CDX72313.1|  BnaC07g43350D                                          145   1e-38   
ref|XP_009363631.1|  PREDICTED: serine/arginine-rich splicing fac...    144   2e-38   Pyrus x bretschneideri [bai li]
gb|AGE46101.1|  arginine/serine-rich splicing factor RSZ28 transc...    145   3e-38   Sorghum bicolor [broomcorn]
ref|NP_001141411.1|  uncharacterized protein LOC100273521               145   4e-38   
ref|NP_001048352.1|  Os02g0789400                                       144   4e-38   
emb|CDX76804.1|  BnaC08g33900D                                          153   5e-38   
ref|XP_006648032.1|  PREDICTED: serine/arginine-rich splicing fac...    143   5e-38   Oryza brachyantha
ref|XP_008676820.1|  PREDICTED: uncharacterized protein LOC100273...    146   5e-38   
gb|AGE46109.1|  arginine/serine-rich splicing factor RSZ19 transc...    142   5e-38   Sorghum bicolor [broomcorn]
ref|NP_194886.1|  protein serine/arginine-rich 22                       144   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648031.1|  PREDICTED: serine/arginine-rich splicing fac...    143   5e-38   Oryza brachyantha
ref|XP_002869320.1|  hypothetical protein ARALYDRAFT_491582             143   7e-38   
ref|NP_180035.1|  serine/arginine-rich splicing factor RSZ22A           143   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147002.1|  LOC100280612                                       142   9e-38   Zea mays [maize]
ref|XP_011459026.1|  PREDICTED: serine/arginine-rich splicing fac...    142   1e-37   Fragaria vesca subsp. vesca
ref|XP_009353338.1|  PREDICTED: serine/arginine-rich splicing fac...    142   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_009353337.1|  PREDICTED: serine/arginine-rich splicing fac...    142   1e-37   Pyrus x bretschneideri [bai li]
gb|KJB53757.1|  hypothetical protein B456_009G066600                    142   1e-37   Gossypium raimondii
ref|XP_004291288.1|  PREDICTED: serine/arginine-rich splicing fac...    142   1e-37   Fragaria vesca subsp. vesca
ref|XP_009353309.1|  PREDICTED: serine/arginine-rich splicing fac...    142   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_002324943.1|  splicing factor RSZp22 family protein              142   3e-37   
emb|CAA05352.1|  RSZp22 protein                                         142   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357431.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    140   7e-37   
emb|CDY13444.1|  BnaA03g51620D                                          140   9e-37   Brassica napus [oilseed rape]
ref|XP_002963848.1|  hypothetical protein SELMODRAFT_68846              139   2e-36   
ref|XP_010235900.1|  PREDICTED: serine/arginine-rich splicing fac...    139   3e-36   
gb|EMT04120.1|  Splicing factor, arginine/serine-rich 7                 139   4e-36   
ref|XP_004135236.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    137   4e-36   
ref|XP_002971799.1|  hypothetical protein SELMODRAFT_172361             139   4e-36   
dbj|BAJ98217.1|  predicted protein                                      138   9e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAY84871.1|  pre-mRNA processing factor                              137   1e-35   Triticum aestivum [Canadian hard winter wheat]
gb|EMS58509.1|  Serine/arginine-rich splicing factor 7                  141   2e-35   Triticum urartu
gb|KGN51817.1|  hypothetical protein Csa_5G602160                       137   1e-34   Cucumis sativus [cucumbers]
ref|XP_002515364.1|  arginine/serine-rich splicing factor, putative     133   3e-34   
ref|XP_006371787.1|  hypothetical protein POPTR_0018s03390g             127   2e-32   
ref|XP_011044979.1|  PREDICTED: serine/arginine-rich splicing fac...    127   2e-32   Populus euphratica
gb|ABK96398.1|  unknown                                                 125   3e-31   Populus trichocarpa x Populus deltoides
gb|AGE46106.1|  arginine/serine-rich splicing factor RSZ21 transc...    122   4e-31   Sorghum bicolor [broomcorn]
ref|XP_009606699.1|  PREDICTED: serine/arginine-rich splicing fac...    119   9e-29   Nicotiana tomentosiformis
ref|XP_009606695.1|  PREDICTED: serine/arginine-rich splicing fac...    118   3e-28   Nicotiana tomentosiformis
ref|XP_011013272.1|  PREDICTED: serine/arginine-rich splicing fac...    114   3e-27   Populus euphratica
ref|XP_006371254.1|  hypothetical protein POPTR_0019s07730g             114   6e-27   
ref|XP_006371251.1|  hypothetical protein POPTR_0019s07730g             112   6e-27   
ref|XP_006371252.1|  hypothetical protein POPTR_0019s07730g             112   1e-26   
ref|XP_006371253.1|  hypothetical protein POPTR_0019s07730g             112   1e-26   
gb|AGE46164.1|  arginine/serine-rich splicing factor RSZ23 transc...    107   1e-25   Physcomitrella patens
gb|KHG29731.1|  Rbp1                                                    107   3e-25   Gossypium arboreum [tree cotton]
emb|CAN74578.1|  hypothetical protein VITISV_009111                     111   7e-25   Vitis vinifera
gb|AFW72286.1|  hypothetical protein ZEAMMB73_339392                    106   1e-24   
gb|KHG29730.1|  Rbp1                                                    107   3e-24   Gossypium arboreum [tree cotton]
gb|KFM73334.1|  Serine/arginine-rich splicing factor 7                  103   4e-23   Stegodyphus mimosarum
ref|XP_001623405.1|  predicted protein                                  102   4e-23   Nematostella vectensis
ref|XP_002954355.1|  hypothetical protein VOLCADRAFT_121301             104   1e-22   Volvox carteri f. nagariensis
gb|AGE46108.1|  arginine/serine-rich splicing factor RSZ21 transc...    100   1e-22   Sorghum bicolor [broomcorn]
ref|XP_006647492.1|  PREDICTED: serine/arginine-rich splicing fac...    102   1e-22   
gb|EFN84192.1|  Splicing factor, arginine/serine-rich 7                 100   2e-22   Harpegnathos saltator
ref|XP_011345274.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    4e-22   Ooceraea biroi
ref|XP_011256516.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    4e-22   Camponotus floridanus
ref|XP_011345273.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    4e-22   
gb|AFW64196.1|  hypothetical protein ZEAMMB73_035767                  99.8    4e-22   
gb|EFN68328.1|  Splicing factor, arginine/serine-rich 7                 100   4e-22   Camponotus floridanus
gb|AFW64191.1|  hypothetical protein ZEAMMB73_035767                    100   6e-22   
ref|XP_011345270.1|  PREDICTED: serine/arginine-rich splicing fac...    100   6e-22   
ref|XP_011139799.1|  PREDICTED: serine/arginine-rich splicing fac...    100   7e-22   Harpegnathos saltator
ref|XP_011139797.1|  PREDICTED: serine/arginine-rich splicing fac...    101   7e-22   
gb|ENN79141.1|  hypothetical protein YQE_04326                          100   1e-21   Dendroctonus ponderosae
ref|XP_011256515.1|  PREDICTED: serine/arginine-rich splicing fac...    100   1e-21   
ref|XP_011314544.1|  PREDICTED: serine/arginine-rich splicing fac...    100   1e-21   
ref|XP_008199911.1|  PREDICTED: serine/arginine-rich splicing fac...    100   1e-21   
emb|CAQ34906.1|  SR family splicing factor 9G8                          100   2e-21   
ref|XP_011065218.1|  PREDICTED: serine/arginine-rich splicing fac...  99.8    2e-21   
gb|AFW64195.1|  hypothetical protein ZEAMMB73_035767                  98.6    3e-21   
gb|ACY66497.1|  splicing factor arginine/serine-rich 7                96.3    4e-21   
ref|XP_004501230.1|  PREDICTED: serine/arginine-rich splicing fac...  98.2    5e-21   
gb|ACI34086.1|  Splicing factor, arginine/serine-rich 7               96.7    5e-21   
emb|CDQ61352.1|  unnamed protein product                              97.4    5e-21   
emb|CDQ57584.1|  unnamed protein product                              98.6    7e-21   
gb|EFZ13615.1|  hypothetical protein SINV_15244                       95.9    8e-21   
ref|XP_011314543.1|  PREDICTED: serine/arginine-rich splicing fac...  97.8    9e-21   
ref|XP_011166842.1|  PREDICTED: serine/arginine-rich splicing fac...  95.9    9e-21   
ref|XP_011314540.1|  PREDICTED: serine/arginine-rich splicing fac...  97.8    1e-20   
ref|XP_001696769.1|  SR protein factor                                97.8    1e-20   
ref|XP_001952396.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    1e-20   
ref|XP_789638.1|  PREDICTED: serine/arginine-rich splicing factor...  97.8    1e-20   
gb|EDL38508.1|  mCG17902, isoform CRA_g                               96.7    1e-20   
ref|XP_008299855.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    2e-20   
ref|XP_003690755.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    2e-20   
ref|XP_011314541.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    2e-20   
ref|XP_002426207.1|  transformer-2 sex-determining protein, putative  96.3    2e-20   
dbj|BAM18099.1|  hypothetical protein                                 95.5    2e-20   
ref|XP_011166841.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    2e-20   
ref|XP_010896865.1|  PREDICTED: serine/arginine-rich splicing fac...  97.1    2e-20   
ref|XP_003701038.1|  PREDICTED: serine/arginine-rich splicing fac...  96.7    2e-20   
ref|XP_008299854.1|  PREDICTED: serine/arginine-rich splicing fac...  96.7    3e-20   
ref|XP_008299853.1|  PREDICTED: serine/arginine-rich splicing fac...  96.7    3e-20   
gb|EFB26062.1|  hypothetical protein PANDA_013342                     94.4    3e-20   
ref|XP_007521053.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-20   
ref|XP_005264543.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-20   
dbj|BAC28058.1|  unnamed protein product                              95.1    3e-20   
gb|AAH27391.1|  Sfrs7 protein                                         95.1    3e-20   
gb|AAH99175.1|  Splicing factor, arginine/serine-rich 7               95.1    4e-20   
dbj|BAG57113.1|  unnamed protein product                              95.1    4e-20   
gb|EAX00364.1|  splicing factor, arginine/serine-rich 7, 35kDa, i...  94.4    4e-20   
gb|KFM74863.1|  Serine/arginine-rich splicing factor 7                95.5    4e-20   
gb|EDL38512.1|  mCG17902, isoform CRA_k                               95.1    4e-20   
ref|XP_001506905.2|  PREDICTED: serine/arginine-rich splicing fac...  97.4    4e-20   
ref|NP_001091768.1|  arginine/serine-rich splicing factor 7           95.1    5e-20   
ref|XP_011498851.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    5e-20   
ref|XP_002799297.1|  PREDICTED: splicing factor, arginine/serine-...  94.7    5e-20   
ref|XP_007543744.1|  PREDICTED: serine/arginine-rich splicing fac...  95.9    6e-20   
sp|Q8BL97.1|SRSF7_MOUSE  RecName: Full=Serine/arginine-rich splic...  96.7    6e-20   
gb|EDL38504.1|  mCG17902, isoform CRA_c                               96.7    7e-20   
ref|XP_004616150.1|  PREDICTED: serine/arginine-rich splicing fac...  96.3    7e-20   
ref|XP_009697947.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    7e-20   
ref|XP_003758396.1|  PREDICTED: uncharacterized protein LOC100934570  95.9    7e-20   
ref|XP_007543742.1|  PREDICTED: serine/arginine-rich splicing fac...  95.9    7e-20   
ref|XP_007543743.1|  PREDICTED: serine/arginine-rich splicing fac...  95.5    7e-20   
ref|XP_006007835.1|  PREDICTED: serine/arginine-rich splicing fac...  95.9    7e-20   
ref|XP_005643958.1|  hypothetical protein COCSUDRAFT_58700            94.4    7e-20   
ref|XP_007261039.1|  PREDICTED: serine/arginine-rich splicing fac...  96.3    7e-20   
gb|KFP58154.1|  Serine/arginine-rich splicing factor 7                93.2    8e-20   
gb|EHJ66310.1|  arginine/serine-rich splicing factor 7                94.4    8e-20   
ref|XP_007261040.1|  PREDICTED: serine/arginine-rich splicing fac...  95.9    8e-20   
ref|XP_002435756.1|  RSZp22 protein, putative                         95.1    8e-20   
ref|XP_008478365.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    8e-20   
ref|XP_009576594.1|  PREDICTED: serine/arginine-rich splicing fac...  92.8    9e-20   
ref|XP_008418934.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    9e-20   
tpg|DAA34137.1|  TPA: alternative splicing factor SRp20/9G8           94.7    9e-20   
gb|AGM32477.1|  serine/arginine-rich splicing factor 7-like protein   95.9    9e-20   
ref|XP_007059045.1|  PREDICTED: serine/arginine-rich splicing fac...  96.3    9e-20   
ref|NP_001007487.1|  serine/arginine-rich splicing factor 7           95.5    9e-20   
ref|XP_011498850.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    1e-19   
ref|XP_008418926.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    1e-19   
ref|XP_007231851.1|  PREDICTED: serine/arginine-rich splicing fac...  95.5    1e-19   
ref|XP_011498849.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    1e-19   
ref|XP_007431750.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  95.5    1e-19   
ref|XP_002799299.1|  PREDICTED: splicing factor, arginine/serine-...  94.7    1e-19   
ref|XP_004322276.1|  PREDICTED: serine/arginine-rich splicing fac...  95.5    1e-19   
ref|XP_007231852.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    1e-19   
ref|XP_004322277.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    1e-19   
ref|XP_008160447.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    1e-19   
ref|XP_006024998.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    1e-19   
ref|XP_005390947.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    1e-19   
gb|EEC73573.1|  hypothetical protein OsI_08026                        95.1    1e-19   
ref|XP_006638601.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    1e-19   
ref|XP_006239708.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    1e-19   
ref|XP_006083501.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_005264542.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003473085.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_006024996.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_005073677.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003795722.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
gb|AAP36622.1|  Homo sapiens splicing factor, arginine/serine-ric...  95.1    2e-19   
ref|XP_004207769.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    2e-19   
ref|XP_005073679.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_008160446.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_008100901.1|  PREDICTED: serine/arginine-rich splicing fac...  95.5    2e-19   
ref|XP_001362853.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|NP_001086618.1|  MGC78845 protein                                 94.7    2e-19   
ref|XP_008555267.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    2e-19   
ref|XP_008252733.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    2e-19   
ref|XP_006083500.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004369601.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|NP_001182375.1|  serine/arginine-rich splicing factor 7 isofo...  94.7    2e-19   
ref|XP_006083499.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_004711175.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_004369600.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|NP_001026854.1|  serine/arginine-rich splicing factor 7 isofo...  95.1    2e-19   
ref|XP_007477078.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003216148.2|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
gb|ABR68245.1|  arginine/serine-rich 7 splicing factor                94.4    2e-19   
gb|EDL38503.1|  mCG17902, isoform CRA_b                               94.4    2e-19   
ref|XP_004711176.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_005073678.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003473086.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_008165291.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_005073675.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003795721.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003416134.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004466068.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
gb|EDL38513.1|  mCG17902, isoform CRA_l                               95.1    2e-19   
ref|XP_006083502.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_005212641.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
gb|EDL38510.1|  mCG17902, isoform CRA_i                               94.4    2e-19   
ref|XP_010594178.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_005073676.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003473084.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004466067.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_006909723.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004686338.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_003125259.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_008555276.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    2e-19   
ref|NP_001182416.1|  serine/arginine-rich splicing factor 7 isofo...  94.7    2e-19   
ref|XP_003216147.2|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|NP_001182415.1|  serine/arginine-rich splicing factor 7 isofo...  94.7    2e-19   
ref|NP_001086749.1|  serine/arginine-rich splicing factor 7           94.7    2e-19   
ref|XP_005264541.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|NP_666195.1|  serine/arginine-rich splicing factor 7 isoform 1    94.7    2e-19   
ref|XP_006024995.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    2e-19   
ref|XP_006266228.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|NP_001182517.1|  splicing factor, arginine/serine-rich 7          94.7    2e-19   
ref|XP_006909721.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004686337.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_004466066.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_006909724.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    2e-19   
ref|XP_004765571.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    2e-19   
ref|NP_001029449.1|  serine/arginine-rich splicing factor 7           94.7    2e-19   
ref|XP_006909722.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_002426878.1|  arginine/serine-rich splicing factor, putative   94.0    2e-19   
ref|NP_001182414.1|  serine/arginine-rich splicing factor 7 isofo...  94.7    2e-19   
ref|XP_009697946.1|  PREDICTED: serine/arginine-rich splicing fac...  92.8    2e-19   
ref|XP_006239706.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    2e-19   
ref|XP_010149335.1|  PREDICTED: serine/arginine-rich splicing fac...  92.4    2e-19   
gb|EDM02777.1|  rCG61762, isoform CRA_f                               94.0    2e-19   
ref|XP_005525415.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_010139387.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    2e-19   
ref|XP_006139716.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  94.4    2e-19   
ref|XP_010704946.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    3e-19   
ref|XP_001367778.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    3e-19   
gb|AAH14857.1|  Sfrs7 protein                                         94.0    3e-19   
gb|KFO92806.1|  Serine/arginine-rich splicing factor 7                94.4    3e-19   
ref|XP_007969081.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
ref|XP_005576132.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
ref|XP_005436813.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-19   
ref|XP_005576133.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
gb|EGV93510.1|  Splicing factor, arginine/serine-rich 7               94.0    3e-19   
ref|XP_002166471.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    3e-19   
gb|EPY83868.1|  splicing factor, arginine/serine-rich 7               92.0    3e-19   
ref|XP_005576134.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
ref|XP_005576135.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
ref|XP_003768907.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    3e-19   
ref|XP_006151423.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-19   
ref|XP_006151426.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-19   
ref|XP_007969082.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    3e-19   
gb|EMC83651.1|  Splicing factor, arginine/serine-rich 7               94.0    3e-19   
ref|XP_006151425.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-19   
ref|XP_005232393.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    3e-19   
ref|XP_006151424.1|  PREDICTED: serine/arginine-rich splicing fac...  94.7    3e-19   
ref|XP_005436812.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    3e-19   
gb|ACO09302.1|  Splicing factor, arginine/serine-rich 7               93.6    3e-19   
ref|XP_009890788.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    4e-19   
ref|XP_005019190.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_005843790.1|  hypothetical protein CHLNCDRAFT_139931           92.8    4e-19   
ref|XP_005489408.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009474081.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    4e-19   
ref|XP_005019189.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009685242.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_005019191.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    4e-19   
ref|XP_317163.4|  AGAP008303-PA                                       93.6    4e-19   
ref|XP_010409393.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
gb|KFV61724.1|  Serine/arginine-rich splicing factor 7                93.6    4e-19   
ref|XP_005155255.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  94.0    4e-19   
ref|XP_005042904.1|  PREDICTED: serine/arginine-rich splicing fac...  95.1    4e-19   
ref|XP_005525416.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009944004.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009890787.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    4e-19   
ref|XP_009919178.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009643084.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_009331994.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_008931337.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
gb|KFW75578.1|  Serine/arginine-rich splicing factor 7                93.6    4e-19   
ref|XP_009554837.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    4e-19   
ref|XP_008503195.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    4e-19   
ref|XP_010006960.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    5e-19   
ref|XP_005489407.1|  PREDICTED: serine/arginine-rich splicing fac...  94.0    5e-19   
ref|XP_010010929.1|  PREDICTED: serine/arginine-rich splicing fac...  91.3    5e-19   
ref|XP_008503194.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
ref|XP_009983999.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...  94.0    5e-19   
ref|XP_006756032.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    5e-19   
ref|XP_010179249.1|  PREDICTED: serine/arginine-rich splicing fac...  90.9    5e-19   
ref|XP_004935327.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
ref|XP_009818171.1|  PREDICTED: serine/arginine-rich splicing fac...  90.9    5e-19   
ref|XP_004935328.1|  PREDICTED: serine/arginine-rich splicing fac...  93.2    5e-19   
dbj|BAC03661.1|  unnamed protein product                              91.3    5e-19   
ref|XP_008503193.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
ref|XP_009876042.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
gb|KFU83702.1|  Serine/arginine-rich splicing factor 7                93.6    5e-19   
gb|KFQ05617.1|  Serine/arginine-rich splicing factor 7                93.6    5e-19   
gb|KFP08902.1|  Serine/arginine-rich splicing factor 7                93.6    5e-19   
ref|XP_009094420.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
ref|XP_005508804.1|  PREDICTED: serine/arginine-rich splicing fac...  94.4    5e-19   
ref|XP_003640982.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    5e-19   
gb|KFO96956.1|  Serine/arginine-rich splicing factor 7                93.6    5e-19   
ref|XP_010725078.1|  PREDICTED: serine/arginine-rich splicing fac...  90.9    6e-19   
gb|KFQ98515.1|  Serine/arginine-rich splicing factor 7                93.6    6e-19   
ref|XP_009071113.1|  PREDICTED: serine/arginine-rich splicing fac...  90.5    6e-19   
ref|XP_010182626.1|  PREDICTED: serine/arginine-rich splicing fac...  93.6    6e-19   



>ref|XP_009792571.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nicotiana 
sylvestris]
Length=200

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRIYGVLRSVWVAR+PPGYAFIEFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIYGVLRSVWVARQPPGYAFIEFDDRRDALDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSG  GGR   GGDD+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGRGGGRGGRGGDDTKCYECGEPGHFAREC  102



>ref|XP_003532014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Glycine max]
 ref|XP_006585955.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Glycine max]
Length=176

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>gb|KHN10603.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=186

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_009606697.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009606698.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Nicotiana tomentosiformis]
Length=200

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN++PR TER+LEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDA+  LDG
Sbjct  1    MSRVYVGNLNPRVTERDLEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAIHELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  102



>ref|XP_009606700.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Nicotiana tomentosiformis]
Length=172

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN++PR TER+LEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDA+  LDG
Sbjct  1    MSRVYVGNLNPRVTERDLEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAIHELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSG  GGR   GGDD+KCY+CGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGRGGGRGGRGGDDTKCYQCGEPGHFAREC  102



>ref|XP_006601788.1| PREDICTED: uncharacterized protein LOC100776329 isoform X4 [Glycine 
max]
Length=161

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFRIYGVL SVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRIYGVLMSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_006601786.1| PREDICTED: uncharacterized protein LOC100776329 isoform X2 [Glycine 
max]
 ref|XP_006601787.1| PREDICTED: uncharacterized protein LOC100776329 isoform X3 [Glycine 
max]
Length=173

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFRIYGVL SVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRIYGVLMSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_006601785.1| PREDICTED: uncharacterized protein LOC100776329 isoform X1 [Glycine 
max]
Length=177

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFRIYGVL SVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRIYGVLMSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_010271961.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Nelumbo 
nucifera]
Length=184

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGVLRSVWVAR+PPGYAF+EFDDRRDALDA+RGLDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVLRSVWVARKPPGYAFVEFDDRRDALDAIRGLDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS     G  GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGRGGGRGRGGGEDLKCYECGEPGHFAREC  106



>gb|KJB31255.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=209

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_008793863.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Phoenix dactylifera]
Length=179

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER++EDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDALDA+RGLDG
Sbjct  1    MSRVYVGNLDPRVSERDIEDEFRVYGVLRSVWVARRPPGYAFVEFDDRRDALDAIRGLDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            +NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  61   RNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  104



>ref|XP_008793865.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X4 [Phoenix dactylifera]
Length=176

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER++EDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDALDA+RGLDG
Sbjct  1    MSRVYVGNLDPRVSERDIEDEFRVYGVLRSVWVARRPPGYAFVEFDDRRDALDAIRGLDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            +NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  61   RNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  104



>ref|XP_010928600.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Elaeis 
guineensis]
Length=182

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER++EDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDALDA+RGLDG
Sbjct  1    MSRVYVGNLDPRVSERDIEDEFRVYGVLRSVWVARRPPGYAFVEFDDRRDALDAIRGLDG  60

Query  653  KNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS      GG  G  RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGGGGRGGRRGGGDDMKCYECGEPGHFAREC  107



>ref|XP_010251307.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
 ref|XP_010251308.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Nelumbo 
nucifera]
Length=184

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 95/107 (89%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGVLRSVWVAR+PPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVLRSVWVARKPPGYAFVEFDDRRDALDAIRALDG  60

Query  653  KNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS       G GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGRGGGGRGRGGGEDLKCYECGEPGHFAREC  107



>ref|NP_001242436.1| uncharacterized protein LOC100776329 [Glycine max]
 gb|ACU20711.1| unknown [Glycine max]
Length=177

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR  ER+LEDEFRIYGVL SVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLHPRVNERDLEDEFRIYGVLMSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG  G    GG+D+KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGRGGRGRGGEDTKCYECGEPGHFAREC  102



>ref|XP_010100489.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXB82623.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=244

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDALDA++ LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRMYGVLRSVWVARRPPGYAFLEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS      G GGR RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGGRGRGGGDDLKCYECGEPGHFAREC  106



>ref|XP_004509838.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Cicer arietinum]
Length=181

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVY+GN+DPR TERELEDEFR+YGVLRSVWVARRPPGYAFIEFDDRRDALDA+  LDG
Sbjct  1    MARVYIGNLDPRVTERELEDEFRLYGVLRSVWVARRPPGYAFIEFDDRRDALDAIHALDG  60

Query  653  KNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS    G  GGR   G  D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKDGGGRGGGRGGRGSSDLKCYECGEPGHFAREC  105



>ref|XP_011013271.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Populus euphratica]
Length=176

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRMYGVLRSVWVARRPPGYAFVEFDDRRDAIDAIRALDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFAREC  106



>gb|KJB31257.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=137

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>gb|KHG11979.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=177

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_011013270.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Populus euphratica]
Length=180

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRMYGVLRSVWVARRPPGYAFVEFDDRRDAIDAIRALDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS         G  RGGG+DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPGHFAREC  106



>gb|KJB31251.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31252.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31253.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
 gb|KJB31254.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=175

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>gb|KJB31256.1| hypothetical protein B456_005G183600 [Gossypium raimondii]
Length=172

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_010914080.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X2 [Elaeis guineensis]
Length=183

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_010914079.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Elaeis guineensis]
Length=197

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  842  QDTMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRG  663
            +  M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R 
Sbjct  12   ESGMARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRE  71

Query  662  LDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            LDGKNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  72   LDGKNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  116



>ref|XP_006438430.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51670.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|KDO82501.1| hypothetical protein CISIN_1g041602mg [Citrus sinensis]
Length=223

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>emb|CDY59084.1| BnaA09g54590D [Brassica napus]
Length=130

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_010023818.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023819.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 ref|XP_010023820.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Eucalyptus 
grandis]
 gb|KCW60183.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60184.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60185.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
 gb|KCW60186.1| hypothetical protein EUGRSUZ_H02907 [Eucalyptus grandis]
Length=188

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR +GVLRSVWVARRPPGYAFIEFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRTFGVLRSVWVARRPPGYAFIEFDDRRDALDAIRSLDG  60

Query  653  KNGWRVELSHNs-----sggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE+SHN       GGRGGR  GGG+DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVEVSHNKGGGGRGGGRGGRGFGGGEDSKCYECGEPGHFAREC  107



>ref|XP_008779620.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Phoenix 
dactylifera]
Length=183

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_008794412.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Phoenix 
dactylifera]
Length=183

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGGSRGRDRHGGSDMKCYECGEPGHFAREC  102



>ref|XP_010551560.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Tarenaya hassleriana]
Length=183

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TER+LEDEF+I+GVLRSVWVARRPPGYAF+EFDD RDA+DA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERDLEDEFKIFGVLRSVWVARRPPGYAFLEFDDERDAMDAIRALDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN+  G  GG  RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNNKGGRGGGGRRGGGDDMKCYECGEPGHFAREC  103



>ref|XP_010929222.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=183

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_010551557.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551558.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010551559.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Tarenaya hassleriana]
Length=184

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TER+LEDEF+I+GVLRSVWVARRPPGYAF+EFDD RDA+DA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERDLEDEFKIFGVLRSVWVARRPPGYAFLEFDDERDAMDAIRALDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN+  G  GG  RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNNKGGRGGGGRRGGGDDMKCYECGEPGHFAREC  103



>ref|XP_008793862.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A isoform 
X1 [Phoenix dactylifera]
Length=182

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLR---SVWVARRPPGYAFIEFDDRRDALDAVRG  663
            MSRVYVGN+DPR +ER++EDEFR+YGVLR   SVWVARRPPGYAF+EFDDRRDALDA+RG
Sbjct  1    MSRVYVGNLDPRVSERDIEDEFRVYGVLRRKASVWVARRPPGYAFVEFDDRRDALDAIRG  60

Query  662  LDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            LDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  61   LDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  107



>ref|XP_006416049.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 ref|XP_006416050.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34402.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
 gb|ESQ34403.1| hypothetical protein EUTSA_v10008869mg [Eutrema salsugineum]
Length=187

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G  G   RGG +DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGVGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_008793864.1| PREDICTED: serine/arginine-rich splicing factor RSZ23 isoform 
X3 [Phoenix dactylifera]
Length=179

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLR---SVWVARRPPGYAFIEFDDRRDALDAVRG  663
            MSRVYVGN+DPR +ER++EDEFR+YGVLR   SVWVARRPPGYAF+EFDDRRDALDA+RG
Sbjct  1    MSRVYVGNLDPRVSERDIEDEFRVYGVLRRKASVWVARRPPGYAFVEFDDRRDALDAIRG  60

Query  662  LDGKNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            LDG+NGWRVELSHNS   GG  G  R GGDD KCYECGEPGHFAREC
Sbjct  61   LDGRNGWRVELSHNSKGGGGGRGGRRSGGDDMKCYECGEPGHFAREC  107



>ref|XP_010682582.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682583.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682584.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DP  TERELEDEFR+YGVLRSVWVARRPPGYAFIEFDD+RDALDA+  LDG
Sbjct  1    MARVYVGNLDPHVTERELEDEFRVYGVLRSVWVARRPPGYAFIEFDDKRDALDAIHALDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            +NGWRVELSHN+  GG  G    GG+D KCYECGEPGHFAREC
Sbjct  61   RNGWRVELSHNAKGGGGRGGRGRGGEDMKCYECGEPGHFAREC  103



>emb|CDY47646.1| BnaC05g19020D [Brassica napus]
Length=185

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_010929220.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010929221.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=202

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNSSGG  GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSSGGSRGRDRYGGSDMKCYECGEPGHFAREC  102



>ref|XP_008446226.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
 ref|XP_008446227.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 [Cucumis 
melo]
Length=187

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 92/111 (83%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVY+GN+DPR TER+LEDEFR++GVLRSVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MTRVYIGNLDPRVTERDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNss---------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS          G   G   GGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGGGRRGRGAGGGGGGGDDLKCYECGEPGHFAREC  111



>ref|XP_009115493.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Brassica rapa]
Length=185

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_009115492.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Brassica rapa]
Length=186

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LDG
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G  GG  RGG +DSKCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGRRGGIEDSKCYECGEPGHFAREC  103



>ref|XP_007044557.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 ref|XP_007044558.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00389.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
 gb|EOY00390.1| RS-containing zinc finger protein 21 isoform 1 [Theobroma cacao]
Length=177

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFRI+GVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRIFGVLRSVWVARRPPGYAFVEFDDRRDAIDAIRELDG  60

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS  GG  G  RGGG+D KCYECGEPGHFAREC
Sbjct  61   KSGWRVELSHNSKGGGGRGGRRGGGEDLKCYECGEPGHFAREC  103



>ref|XP_006438427.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483824.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Citrus sinensis]
 gb|ESR51667.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=176

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>ref|XP_004155352.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
Length=188

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 93/112 (83%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVY+GN+DPR TER+LEDEFR++GVLRSVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MTRVYIGNLDPRVTERDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNss----------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS            G GG   GGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGGGRRGRGGGGGGGGGGDDLKCYECGEPGHFAREC  112



>ref|XP_006438428.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006438429.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 ref|XP_006483823.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Citrus sinensis]
 gb|ESR51668.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
 gb|ESR51669.1| hypothetical protein CICLE_v10032693mg [Citrus clementina]
Length=180

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRMFGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS   GGRGGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGRGRGGGEDLKCYECGEPGHFAREC  104



>gb|AFK40774.1| unknown [Lotus japonicus]
Length=181

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDD+RDALDA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRLYGVLRSVWVARRPPGYAFLEFDDKRDALDAIHALDG  60

Query  653  KNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS    GGRGG    GG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGRGGGRGRGGEDLKCYECGEPGHFAREC  105



>ref|XP_008340015.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=181

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ LDG
Sbjct  1    MTRVYVGNLDPRVNERDLEDEFRLFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALDG  60

Query  653  KNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS    G  GGR RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGSGGRGGGRGRGGGDDLKCYECGEPGHFAREC  105



>ref|XP_008340014.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=182

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ LDG
Sbjct  1    MTRVYVGNLDPRVNERDLEDEFRLFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALDG  60

Query  653  KNGWRVELSHNss---ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS    G  GGR RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGSGGRGGGRGRGGGDDLKCYECGEPGHFAREC  105



>ref|XP_002534324.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
 gb|EEF28060.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
Length=184

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 92/109 (84%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR +ER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MARVYVGNLDPRVSERDLEDEFRMYGVLRSVWVARRPPGYAFVEFDDRRDAVDAIRALDG  60

Query  653  KNGWRVELSHNss-------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS        G  GG    GG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGSGGGGRGRGGEDMKCYECGEPGHFAREC  109



>ref|XP_002264105.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Vitis vinifera]
 emb|CBI32129.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR+YGV+RSVWVARRPPGYAF+EF DRRDA+DA+RGLDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRVYGVIRSVWVARRPPGYAFVEFADRRDAVDAIRGLDG  60

Query  653  KNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS         GG   R RGGG+D KCYECGEPGHFAREC
Sbjct  61   KSGWRVELSHNSKGGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHFAREC  110



>emb|CDP00182.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR YGVLRSVWVARRPPGYAF+EFDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDQRVTERDLEDEFRFYGVLRSVWVARRPPGYAFVEFDDRRDAEDAIRALDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS   GG  G    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGRGGRGRGGDDLKCYECGEPGHFAREC  104



>ref|XP_010653311.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Vitis vinifera]
Length=179

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR+YGV+RSVWVARRPPGYAF+EF DRRDA+DA+RGLDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRVYGVIRSVWVARRPPGYAFVEFADRRDAVDAIRGLDG  60

Query  653  KNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS         GG   R RGGG+D KCYECGEPGHFAREC
Sbjct  61   KSGWRVELSHNSKGGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHFAREC  110



>ref|XP_011082043.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Sesamum 
indicum]
Length=181

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      GGRGG     G D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFAREC  106



>ref|XP_006845500.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
 gb|ERN07175.1| hypothetical protein AMTR_s00019p00154210 [Amborella trichopoda]
Length=262

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 90/110 (82%), Gaps = 7/110 (6%)
 Frame = -1

Query  836  TMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD  657
            TMSRVYVGN+DPR +ERELEDEFR +GVLRSVWVAR+PPGYAF+EFDDRRDA+DA+R LD
Sbjct  59   TMSRVYVGNLDPRVSERELEDEFRAFGVLRSVWVARKPPGYAFVEFDDRRDAIDAIRELD  118

Query  656  GKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            GKNGWRVELSHN         GG G    G G D KCYECGEPGHFAREC
Sbjct  119  GKNGWRVELSHNSRGGGGGRGGGGGRSRSGSGSDMKCYECGEPGHFAREC  168



>ref|XP_011077513.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Sesamum indicum]
Length=180

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      GGRGG     G D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFAREC  106



>ref|XP_011077592.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Sesamum indicum]
Length=177

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      GGRGG     G D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGSDLKCYECGEPGHFAREC  106



>gb|KJB15225.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
 gb|KJB15226.1| hypothetical protein B456_002G165700 [Gossypium raimondii]
Length=204

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFRI+GVLRSVWVARRPPGYAFIEFDDRRDA+DA+R LDG
Sbjct  28   MARVYVGNLDPRVMERDLEDEFRIFGVLRSVWVARRPPGYAFIEFDDRRDAMDAIRELDG  87

Query  653  KNGWRVELSHNss-ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS   G  G  RGGG+D KCYECGEPGHF REC
Sbjct  88   KNGWRVELSHNSKGVGGRGGRRGGGEDLKCYECGEPGHFVREC  130



>ref|XP_010648839.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
 ref|XP_010648840.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Vitis vinifera]
Length=182

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  107



>gb|KDP26562.1| hypothetical protein JCGZ_17720 [Jatropha curcas]
Length=184

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN++PR +ER+LEDEFR+YGVLRSVWVARRPPGYAF+EFDDRRDA+DA+R LDG
Sbjct  1    MARVYVGNLEPRVSERDLEDEFRMYGVLRSVWVARRPPGYAFVEFDDRRDAMDAIRALDG  60

Query  653  KNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS         GG GG    GG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGGGGGGGRGRGGEDLKCYECGEPGHFAREC  110



>ref|XP_002272657.2| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 ref|XP_010648841.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Vitis vinifera]
 emb|CBI24003.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  107



>emb|CDP12463.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  107



>ref|XP_010278048.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278049.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
 ref|XP_010278050.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Nelumbo 
nucifera]
Length=182

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GVLRSVWVAR+PPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVLRSVWVARKPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDS----KCYECGEPGHFAREC  528
            KNGWRVELSHNS G  GGR    G       KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGGRGGDRGRSGGSDLKCYECGEPGHFAREC  106



>ref|XP_009363525.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009363526.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Pyrus x bretschneideri]
Length=183

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ L+G
Sbjct  1    MTRVYVGNLDPRVNERDLEDEFRMFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALNG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS+     G GGR  GGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSTGSGGRGGGGRGHGGGEDLKCYECGEPGHFAREC  106



>ref|XP_009363527.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Pyrus x bretschneideri]
Length=182

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ L+G
Sbjct  1    MTRVYVGNLDPRVNERDLEDEFRMFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALNG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS+     G GGR  GGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSTGSGGRGGGGRGHGGGEDLKCYECGEPGHFAREC  106



>ref|XP_006655864.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Oryza 
brachyantha]
Length=185

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA D++R LDG
Sbjct  1    MARVYVGNLDPRVTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDSIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRYGGSESKCYECGETGHFAREC  102



>ref|XP_009765884.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Nicotiana 
sylvestris]
Length=229

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = -1

Query  839  DTMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGL  660
              MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD+RDA DA+R L
Sbjct  48   SKMSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIREL  107

Query  659  DGKNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            DGKNGWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  108  DGKNGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFAREC  155



>ref|XP_004297645.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR ++R+LEDEFR++GVLRSVWVARRPPGYAFIEFDD RDALDA++ LDG
Sbjct  1    MTRVYVGNLDPRVSDRDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDHRDALDAIQRLDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS     GG G   RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGGGGRGGRGGGDDLKCYECGEPGHFAREC  106



>ref|NP_001057018.1| Os06g0187900 [Oryza sativa Japonica Group]
 sp|Q69KL9.1|RZ21A_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21A; AltName: 
Full=RS-containing zinc finger protein 21A; Short=Os-RSZ21a; 
Short=Os-RSZp21a [Oryza sativa Japonica Group]
 dbj|BAD36521.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD72462.1| putative splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF18932.1| Os06g0187900 [Oryza sativa Japonica Group]
 dbj|BAG88899.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92681.1| unnamed protein product [Oryza sativa Japonica Group]
Length=185

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R +DG
Sbjct  1    MARVYVGNLDPRVTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  102



>ref|XP_011463379.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=186

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 93/106 (88%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR ++R+LEDEFR++GVLRSVWVARRPPGYAFIEFDD RDALDA++ LDG
Sbjct  1    MTRVYVGNLDPRVSDRDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDHRDALDAIQRLDG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS     GG G   RGGGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGGGGGRGGRGGGDDLKCYECGEPGHFAREC  106



>gb|EEC80152.1| hypothetical protein OsI_21961 [Oryza sativa Indica Group]
Length=264

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  842  QDTMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRG  663
            Q  M+RVYVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R 
Sbjct  77   QVAMARVYVGNLDPRVTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRD  136

Query  662  LDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            +DGKNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  137  IDGKNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  181



>gb|EEE65232.1| hypothetical protein OsJ_20394 [Oryza sativa Japonica Group]
Length=264

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  842  QDTMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRG  663
            Q  M+RVYVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R 
Sbjct  77   QVAMARVYVGNLDPRVTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRD  136

Query  662  LDGKNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            +DGKNGWRVELS N+S GRGGR R G  +SKCYECGE GHFAREC
Sbjct  137  IDGKNGWRVELSRNASSGRGGRDRYGSSESKCYECGETGHFAREC  181



>ref|XP_008221783.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Prunus mume]
Length=183

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (88%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR VWVARRPPGYAFIEFDDRRDALDA++ +DG
Sbjct  1    MARVYVGNLDPRVNERDLEDEFRMFGVLRGVWVARRPPGYAFIEFDDRRDALDAIQAVDG  60

Query  653  KNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS      GG GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLKCYECGEPGHFAREC  107



>ref|XP_009415507.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=182

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARLYVGNLDPRTTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNSS  RG    GG  D KCYECGEPGHFAREC
Sbjct  61   KHGWRVELSHNSSSSRGRDRHGGS-DMKCYECGEPGHFAREC  101



>ref|XP_009395828.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395829.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395830.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395831.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=180

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARLYVGNLDPRTTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHN S    GR R GG D KCYECGEPGHFAREC
Sbjct  61   KHGWRVELSHN-SSSSRGRDRHGGSDMKCYECGEPGHFAREC  101



>ref|XP_008221782.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Prunus mume]
Length=184

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (88%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR VWVARRPPGYAFIEFDDRRDALDA++ +DG
Sbjct  1    MARVYVGNLDPRVNERDLEDEFRMFGVLRGVWVARRPPGYAFIEFDDRRDALDAIQAVDG  60

Query  653  KNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS      GG GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLKCYECGEPGHFAREC  107



>ref|XP_006357055.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Solanum tuberosum]
Length=183

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGERGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_003544651.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Glycine max]
 gb|KHN14571.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_006596163.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Glycine max]
Length=175

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_006596162.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Glycine max]
Length=177

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>ref|XP_006600176.1| PREDICTED: uncharacterized protein LOC100790689 isoform X1 [Glycine 
max]
Length=175

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>gb|AGE46162.1| arginine/serine-rich splicing factor RSZ23 transcript II [Physcomitrella 
patens]
Length=137

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPRATERELEDEFR+YGVLRSVWV R+PPG+AFIEF+DRRDA DA+R L+G
Sbjct  1    MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS + SGG GG    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSRS-SGGGGGPRGRGGDDMKCYECGEPGHFAREC  101



>ref|NP_001241113.1| uncharacterized protein LOC100790689 [Glycine max]
 gb|ACU13222.1| unknown [Glycine max]
 gb|ACU18210.1| unknown [Glycine max]
 gb|KHN30783.1| Serine/arginine-rich splicing factor 7 [Glycine soja]
Length=178

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN   GG G   R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGSDLKCYECGEPGHFAREC  103



>gb|ABK24519.1| unknown [Picea sitchensis]
Length=169

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGVLRSVWVAR+PPG+AFIEF+DRRDA DAVR L+G
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVLRSVWVARKPPGFAFIEFEDRRDAGDAVRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELS NS GG  G    GGDD  CY+CGE GHFAREC
Sbjct  61   KNDWRVELSRNSGGGGRGGRGRGGDDMSCYKCGESGHFAREC  102



>gb|KJB53760.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=131

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+F+DRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFEDRRDAEDAIRELDG  60

Query  653  KNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>ref|XP_010942196.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Elaeis guineensis]
Length=247

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_002893311.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69570.1| hypothetical protein ARALYDRAFT_472646 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFRI+GVLR+VWVARRPPGYAF+EFDD RDALDA+R LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFRIFGVLRNVWVARRPPGYAFLEFDDERDALDAIRALDR  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_010942204.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X10 [Elaeis guineensis]
Length=208

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942203.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X9 [Elaeis guineensis]
Length=211

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942202.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X8 [Elaeis guineensis]
Length=235

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_001776556.1| predicted protein [Physcomitrella patens]
 gb|EDQ58689.1| predicted protein [Physcomitrella patens]
Length=174

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPRATERELEDEFR+YGVLRSVWV R+PPG+AFIEF+DRRDA DA+R L+G
Sbjct  1    MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS + SGG GG    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSRS-SGGGGGPRGRGGDDMKCYECGEPGHFAREC  101



>ref|XP_007161329.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33323.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=176

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN--ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN    GG  G   GGG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGGSDLKCYECGEPGHFAREC  104



>gb|EPS72339.1| hypothetical protein M569_02421, partial [Genlisea aurea]
Length=181

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 86/103 (83%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSR+YVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRIYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            + GWRVELSH  S  G G      G D KCYECGEPGHFAREC
Sbjct  61   RRGWRVELSHGGSGRGGGRGGGRSGSDLKCYECGEPGHFAREC  103



>ref|XP_007161330.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
 gb|ESW33324.1| hypothetical protein PHAVU_001G060500g [Phaseolus vulgaris]
Length=179

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN--ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN    GG  G   GGG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGRSGGGSDLKCYECGEPGHFAREC  104



>gb|AGE46161.1| arginine/serine-rich splicing factor RSZ23 transcript I [Physcomitrella 
patens]
Length=210

 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPRATERELEDEFR+YGVLRSVWV R+PPG+AFIEF+DRRDA DA+R L+G
Sbjct  1    MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS + SGG GG    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSRS-SGGGGGPRGRGGDDMKCYECGEPGHFAREC  101



>ref|XP_010942211.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X16 [Elaeis guineensis]
Length=196

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_004244489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Solanum 
lycopersicum]
Length=183

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGERGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_010942200.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X6 [Elaeis guineensis]
Length=239

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942207.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X13 [Elaeis guineensis]
Length=202

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942194.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Elaeis guineensis]
Length=250

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>gb|AGE46163.1| arginine/serine-rich splicing factor RSZ23 transcript III [Physcomitrella 
patens]
Length=209

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPRATERELEDEFR+YGVLRSVWV R+PPG+AFIEF+DRRDA DA+R L+G
Sbjct  1    MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS + SGG GG    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSRS-SGGGGGPRGRGGDDMKCYECGEPGHFAREC  101



>ref|XP_010942201.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X7 [Elaeis guineensis]
Length=238

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_002436620.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|EER87987.1| hypothetical protein SORBIDRAFT_10g005960 [Sorghum bicolor]
 gb|AGE46105.1| arginine/serine-rich splicing factor RSZ21 transcript I [Sorghum 
bicolor]
 gb|AGE46107.1| arginine/serine-rich splicing factor RSZ21 transcript III [Sorghum 
bicolor]
Length=186

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRYGGSESKCYECGETGHFAREC  102



>ref|XP_007223543.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
 gb|EMJ24742.1| hypothetical protein PRUPE_ppa012111mg [Prunus persica]
Length=183

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR  ER+LEDEFR++GVLR VWVARRPPGYAFIEFDDRRDALDA++ +DG
Sbjct  1    MARVYVGNLDPRVNERDLEDEFRMFGVLRGVWVARRPPGYAFIEFDDRRDALDAIQAVDG  60

Query  653  KNGWRVELSHNss-----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS      GG GGR RGGG+D +CYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKGGGGRGGGGGRGRGGGEDLRCYECGEPGHFAREC  107



>gb|KJB53756.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53758.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53761.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
 gb|KJB53762.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=180

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+F+DRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFEDRRDAEDAIRELDG  60

Query  653  KNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>ref|XP_010692998.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Beta 
vulgaris subsp. vulgaris]
Length=192

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDTRDAKDAIHALDG  60

Query  653  KNGWRVELSHNs--------sggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS         GG GG    GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGGGGGGRGRGGSDLKCYECGEPGHFAREC  110



>gb|KJB53759.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=177

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+F+DRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFEDRRDAEDAIRELDG  60

Query  653  KNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>ref|XP_010942209.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X15 [Elaeis guineensis]
Length=199

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_008389624.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Malus domestica]
Length=182

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ L+G
Sbjct  1    MTRVYVGNLDTRVNERDLEDEFRMFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALNG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS+     G GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSTGSGGRGGGGRGRGGGEDLKCYECGEPGHFAREC  106



>ref|XP_010942198.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X4 [Elaeis guineensis]
Length=242

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942208.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X14 [Elaeis guineensis]
Length=200

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942199.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X5 [Elaeis guineensis]
Length=241

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_008389623.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Malus domestica]
Length=183

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R  ER+LEDEFR++GVLR+VWVARRPPGYAFIEFDDRRDALDAV+ L+G
Sbjct  1    MTRVYVGNLDTRVNERDLEDEFRMFGVLRNVWVARRPPGYAFIEFDDRRDALDAVQALNG  60

Query  653  KNGWRVELSHNss----ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS+     G GGR RGGG+D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSTGSGGRGGGGRGRGGGEDLKCYECGEPGHFAREC  106



>ref|XP_010942206.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X12 [Elaeis guineensis]
Length=203

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942205.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X11 [Elaeis guineensis]
Length=206

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>ref|XP_010942197.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Elaeis guineensis]
Length=245

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR YGVLRSVWVA+RPPGYAF+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFREYGVLRSVWVAQRPPGYAFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-DSKCYECGEPGHFAREC  528
            ++GWRVELS+NS+GG G R   G D D KCY+CG+PGHFAREC
Sbjct  61   RHGWRVELSYNSAGGGGSRGGRGRDQDMKCYQCGKPGHFAREC  103



>gb|KJB53763.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=169

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+F+DRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFEDRRDAEDAIRELDG  60

Query  653  KNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN     G  GG+   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHFAREC  105



>gb|AFW85524.1| hypothetical protein ZEAMMB73_327204 [Zea mays]
Length=138

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+Y+GN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYIGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_009614737.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Nicotiana tomentosiformis]
Length=181

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDLRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            K GWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>ref|XP_004964637.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X3 [Setaria italica]
Length=186

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>ref|NP_001149338.1| LOC100282961 [Zea mays]
 ref|XP_008658629.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 ref|XP_008658630.1| PREDICTED: LOC100282961 isoform X1 [Zea mays]
 gb|ACG25623.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG27710.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACN25174.1| unknown [Zea mays]
 gb|ACN27371.1| unknown [Zea mays]
 gb|AFW85525.1| Splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW85526.1| Splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW85527.1| Splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW85528.1| Splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AGE46036.1| arginine/serine-rich splicing factor RSZ21 transcript I [Zea 
mays]
 gb|AGE46037.1| arginine/serine-rich splicing factor RSZ21 transcript II [Zea 
mays]
Length=184

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+Y+GN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYIGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_009614738.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Nicotiana tomentosiformis]
Length=180

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDLRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            K GWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>ref|XP_009614739.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Nicotiana tomentosiformis]
Length=179

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDLRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            K GWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KTGWRVELSHNSREGRGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>gb|ACG35084.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=184

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+Y+GN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYIGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+SGGRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASGGRGGRDRHGGSESKCYECGETGHFAREC  102



>ref|XP_010325195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
 ref|XP_010325196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Solanum lycopersicum]
Length=184

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDDRRDA DA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIKELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_006305671.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
 gb|EOA38569.1| hypothetical protein CARUB_v10010388mg [Capsella rubella]
Length=186

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DP+ TERELEDEFR++GVLR+VWVARRPPGYAF+EFDD RDALDA+R LD 
Sbjct  1    MTRVYVGNLDPKVTERELEDEFRVFGVLRNVWVARRPPGYAFLEFDDERDALDAIRTLDR  60

Query  653  KNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH +  G   G  RGG +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGRRGGIEDSKCYECGELGHFAREC  103



>ref|XP_004964636.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X2 [Setaria italica]
Length=193

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>ref|XP_004245307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
 ref|XP_010325197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Solanum lycopersicum]
Length=183

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDDRRDA DA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIKELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_004964635.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like isoform 
X1 [Setaria italica]
Length=209

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T RELEDEFR +GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTARELEDEFRTFGVLRSVWVARKPPGFAFIDFDDKRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE+S NSS GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVEISRNSSSGRGGRDRQGGSESKCYECGETGHFAREC  102



>ref|XP_001782492.1| predicted protein [Physcomitrella patens]
 gb|EDQ52711.1| predicted protein [Physcomitrella patens]
Length=224

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPRATERELEDEFR+YGVLRSVWV R+PPG+AFIEF+DRRDA DA+R L+G
Sbjct  1    MSRVYVGNLDPRATERELEDEFRVYGVLRSVWVGRKPPGFAFIEFEDRRDADDAIRALNG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS + SGG GG    GGDD KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSRS-SGGGGGPRGRGGDDMKCYECGEPGHFAREC  101



>ref|XP_006355194.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006355195.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006355196.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X3 [Solanum tuberosum]
Length=184

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD+RDA DA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDQRDAQDAIKELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_006647490.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Oryza brachyantha]
Length=206

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS   +G   GR R  G D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELS-TKAGSGRGRDRSSGSDMKCYECGEPGHFAREC  101



>gb|KJB68434.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
 gb|KJB68435.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=240

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 93/116 (80%), Gaps = 10/116 (9%)
 Frame = -1

Query  845  RQDTMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVR  666
            +  TMSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R
Sbjct  51   KTHTMSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIR  110

Query  665  GLDGKNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
             LDGKNGWRVELSHN            GG GGR R GG D KCYECGEPGHFAREC
Sbjct  111  ELDGKNGWRVELSHNSRGRGGRGGGGGGGGGGRGRSGGSDLKCYECGEPGHFAREC  166



>ref|XP_006647491.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Oryza brachyantha]
Length=203

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS   +G   GR R  G D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELS-TKAGSGRGRDRSSGSDMKCYECGEPGHFAREC  101



>ref|XP_006355197.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X4 [Solanum tuberosum]
Length=183

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFRI+GV+RSVWVARRPPGYAFI+FDD+RDA DA++ LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRIFGVIRSVWVARRPPGYAFIDFDDQRDAQDAIKELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGESGHFAREC  107



>ref|XP_009386654.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A-like [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR +GVLRSVWVARRPPGY F+EFDDRRDALDA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRAFGVLRSVWVARRPPGYGFVEFDDRRDALDAIRDLDG  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS   GG  G    GG D  CYECGEPGHFAREC
Sbjct  61   KHGWRVELSHNSKGGGGGRGGYGRGGGDMNCYECGEPGHFAREC  104



>ref|XP_009630985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X1 [Nicotiana tomentosiformis]
Length=196

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDD+RDA DA+R +DG
Sbjct  16   MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDQRDARDAIREIDG  75

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  76   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  122



>ref|XP_009630986.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 isoform 
X2 [Nicotiana tomentosiformis]
Length=181

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDD+RDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDQRDARDAIREIDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  107



>ref|XP_010526263.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Tarenaya 
hassleriana]
Length=181

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 87/108 (81%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YG +R+VWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGTIRNVWVARRPPGYAFIDFDDPRDARDAIRDLDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN        GG GG    GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGGRGRGGSDLKCYECGEPGHFAREC  108



>ref|XP_010438021.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Camelina 
sativa]
Length=196

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 86/111 (77%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+RG+DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDPRDARDAIRGVDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G     GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGDCGGRGGSDLKCYECGEPGHFAREC  111



>ref|XP_010432845.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=196

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 86/111 (77%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+RG+DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDPRDARDAIRGVDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G     GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGDCGGRGGSDLKCYECGEPGHFAREC  111



>ref|XP_010447518.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Camelina 
sativa]
Length=199

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 87/111 (78%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+RG+DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDPRDARDAIRGVDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G R   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGDRGGRGGSDLKCYECGEPGHFAREC  111



>ref|XP_009779999.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Nicotiana sylvestris]
Length=198

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDD+RDA DA+R +DG
Sbjct  16   MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDQRDARDAIREIDG  75

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         G  GGR R GG D KCYECGE GHFAREC
Sbjct  76   KNGWRVELSHNSRGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  124



>ref|NP_001047400.1| Os02g0610600 [Oryza sativa Japonica Group]
 sp|Q6K9C3.1|RZP23_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ23; AltName: 
Full=RS-containing zinc finger protein 23; Short=Os-RSZ23; 
Short=Os-RSZp23 [Oryza sativa Japonica Group]
 dbj|BAD19227.1| putative splicing factor RSZp22 (RSZP22) [Oryza sativa Japonica 
Group]
 dbj|BAF09314.1| Os02g0610600 [Oryza sativa Japonica Group]
 dbj|BAG94201.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96908.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS   +G   GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELS-TKAGSGRGRDRSGGSDMKCYECGEPGHFAREC  101



>gb|KDO67328.1| hypothetical protein CISIN_1g046599mg [Citrus sinensis]
Length=131

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDYRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>gb|ACX54788.2| putative arginine/serine-rich splicing factor [Arachis diogoi]
 gb|AET50931.1| SR-protein [Arachis diogoi]
 gb|AFW97328.1| SR protein [Arachis diogoi]
Length=181

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDSRDARDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>ref|XP_004498562.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cicer 
arietinum]
Length=188

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 88/112 (79%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVTERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN            G   G   GGG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRSGGGGGGGGGGRGRGGGGGGGSDLKCYECGEPGHFAREC  112



>gb|EEE57352.1| hypothetical protein OsJ_07486 [Oryza sativa Japonica Group]
Length=203

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS   +G   GR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELS-TKAGSGRGRDRSGGSDMKCYECGEPGHFAREC  101



>ref|XP_010498894.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X2 [Camelina sativa]
Length=186

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVLR+VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRVFGVLRNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRG      G  +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_009780000.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Nicotiana sylvestris]
Length=183

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDD+RDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDQRDARDAIREIDG  60

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  109



>ref|XP_008466294.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
 ref|XP_008466295.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Cucumis 
melo]
Length=186

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDPRDARDAIHELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN        G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  107



>gb|KDP33463.1| hypothetical protein JCGZ_07034 [Jatropha curcas]
Length=179

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R TERELEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDARVTERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAEDAIHELDG  60

Query  653  KNGWRVELSHNs---sggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS    G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGRGGGRGRFGGSDLKCYECGEPGHFAREC  105



>ref|XP_010498892.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
 ref|XP_010498893.1| PREDICTED: serine/arginine-rich splicing factor RSZ21 isoform 
X1 [Camelina sativa]
Length=187

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVLR+VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRVFGVLRNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_003564174.1| PREDICTED: serine/arginine-rich splicing factor RSZ21A [Brachypodium 
distachyon]
Length=185

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DP  T RELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R +DG
Sbjct  1    MARVYVGNLDPAVTARELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRDIDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>ref|XP_006412579.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
 gb|ESQ54032.1| hypothetical protein EUTSA_v10026315mg [Eutrema salsugineum]
Length=192

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 86/109 (79%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDPRDARDAIRDLDG  60

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN            G R   GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGDRGGDRGGRGGSDLKCYECGEPGHFAREC  109



>gb|KJB68433.1| hypothetical protein B456_010G245400 [Gossypium raimondii]
Length=185

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIRELDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN            GG GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGGGGGGRGRSGGSDLKCYECGEPGHFAREC  112



>ref|XP_004136307.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 ref|XP_004164814.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Cucumis 
sativus]
 gb|KGN60178.1| hypothetical protein Csa_3G881900 [Cucumis sativus]
Length=192

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 89/107 (83%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDPRDARDAIHELDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN        G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  107



>emb|CDY68847.1| BnaAnng28560D [Brassica napus]
Length=194

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV++SVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIKSVWVARRPPGYAFLDFEDSRDARDAIRDLDG  60

Query  653  KNGWRVELSHN-ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN   G   G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGRGDGGRGRGGSDLKCYECGESGHFAREC  103



>gb|EMS45589.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=191

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVG++DP  T RELEDEFR++GVLRSVWVAR+PPG+AF++FDDRRDA DA++ LDG
Sbjct  1    MARVYVGSLDPAVTARELEDEFRVFGVLRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|KHG09265.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
 gb|KHG19345.1| Serine/arginine-rich splicing factor 7 [Gossypium arboreum]
Length=187

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 91/113 (81%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIRELDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN             GG GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGGGGGGGRGRSGGSDLKCYECGEPGHFAREC  113



>ref|NP_001117342.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30442.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=164

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEF+ +GVLR+VWVARRPPGYAF+EFDD RDALDA+  LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRGG     G  +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_006450201.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450202.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006450203.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 ref|XP_006483489.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Citrus sinensis]
 gb|ESR63441.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63442.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
 gb|ESR63443.1| hypothetical protein CICLE_v10009655mg [Citrus clementina]
Length=180

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDYRDAQDAIRELDG  60

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN      G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  106



>gb|EYU29179.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
 gb|EYU29180.1| hypothetical protein MIMGU_mgv1a014305mg [Erythranthe guttata]
Length=194

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 88/113 (78%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +GV+RSVWVARRPPGYAFI+FDDRRDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRAFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRDIDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN             GG GGR    G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGSGGGGGGRGGGGGGRGGRSGSDLKCYECGEAGHFAREC  113



>ref|XP_010268362.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
 ref|XP_010268363.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Nelumbo 
nucifera]
Length=289

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R TERELEDEFR++GVLRSVWVAR+PPGYAFI+F+DRRDA DA+  LDG
Sbjct  1    MTRVYVGNLDLRVTERELEDEFRVFGVLRSVWVARKPPGYAFIDFEDRRDAQDAIHELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGD-----DSKCYECGEPGHFAREC  528
            KNGWRVELSHNS G  GG   G        D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGGGRGGDRGRSGGYDMKCYECGEPGHFAREC  107



>gb|EMT27182.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=187

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVG++DP  T RELEDEFR++GVLRSVWVAR+PPG+AF++FDDRRDA DA++ LDG
Sbjct  1    MARVYVGSLDPAVTARELEDEFRVFGVLRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|EPS60072.1| hypothetical protein M569_14729, partial [Genlisea aurea]
Length=197

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 88/113 (78%), Gaps = 10/113 (9%)
 Frame = -1

Query  836  TMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD  657
            TMSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LD
Sbjct  2    TMSRVYVGNLDPRVTERELEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRELD  61

Query  656  ---------GKNGWRVELSH-NssggrggrsrggGDDSKCYECGEPGHFAREC  528
                     GK+GWRVELSH  S  G G      G D KCYECGEPGHFAREC
Sbjct  62   GCIISFSLTGKHGWRVELSHGGSGRGGGRGGGRSGSDLKCYECGEPGHFAREC  114



>ref|XP_009140565.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Brassica 
rapa]
 emb|CDY45585.1| BnaA04g14520D [Brassica napus]
 emb|CDY20328.1| BnaC04g36280D [Brassica napus]
Length=196

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 87/110 (79%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV++SVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIKSVWVARRPPGYAFLDFEDSRDARDAIRDLDG  60

Query  653  KNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN          GG  G    GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEESHNRGGGGGRGGRGGGDGGRGRGGSDLKCYECGEPGHFAREC  110



>ref|XP_003588649.1| RNA-binding protein Rsf1 [Medicago truncatula]
Length=190

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 88/112 (79%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDDRRDA DA+R LDG
Sbjct  1    MSRVYVGNLDSRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN            G   G   GGG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRSGGGGGGGGGGRGRGGGGGGGSDLKCYECGEPGHFAREC  112



>ref|XP_009138024.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Brassica 
rapa]
Length=194

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (79%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YG ++SVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGAIKSVWVARRPPGYAFLDFEDPRDASDAIRDLDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN        G       GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAREC  107



>ref|XP_010477689.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=178

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVLR+VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRLFGVLRNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRG      G  +DSKCY+CGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYDCGELGHFAREC  104



>ref|XP_009396254.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=222

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 87/111 (78%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R +ERELEDEFR +GVLRSVWVARRPPGY F+EFDDRRDALDA+R +DG
Sbjct  1    MSRVYVGNLDSRVSERELEDEFRAFGVLRSVWVARRPPGYGFVEFDDRRDALDAIRDIDG  60

Query  653  KNGWRVELSHNssg---------grggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS             GG   GGG D  CYECGEPGHFAREC
Sbjct  61   KHGWRVELSHNSKAGGGGRGGRGRGGGGGGGGGGDMNCYECGEPGHFAREC  111



>ref|XP_010477687.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
 ref|XP_010477688.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=179

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVLR+VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRLFGVLRNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRG      G  +DSKCY+CGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGRRGGIEDSKCYDCGELGHFAREC  104



>ref|XP_007011623.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 ref|XP_007011624.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29242.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
 gb|EOY29243.1| Serine/arginine-rich 22 isoform 1 [Theobroma cacao]
Length=181

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD RDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRCFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIREVDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       GG GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGRGRSGGSDLKCYECGEPGHFAREC  107



>ref|XP_006284575.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
 gb|EOA17473.1| hypothetical protein CARUB_v10005800mg [Capsella rubella]
Length=193

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 84/108 (78%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +G++RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRAFGIIRSVWVARRPPGYAFLDFEDPRDARDAIRALDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN         G       GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGGRGGSDLKCYECGEPGHFAREC  108



>ref|NP_001185074.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 gb|AEE30443.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=183

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEF+ +GVLR+VWVARRPPGYAF+EFDD RDALDA+  LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRGG     G  +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>emb|CAA05351.1| RSZp21 protein [Arabidopsis thaliana]
Length=184

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEF+ +GVLR+VWVARRPPGYAF+EFDD RDALDA+  LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDR  60

Query  653  KNGWRVELSHNss--ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSH      G GG  RGG +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_009396262.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 87/111 (78%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+D R +ERELEDEFR +GVLRSVWVARRPPGY F+EFDDRRDALDA+R +DG
Sbjct  1    MSRVYVGNLDSRVSERELEDEFRAFGVLRSVWVARRPPGYGFVEFDDRRDALDAIRDIDG  60

Query  653  KNGWRVELSHNssg---------grggrsrggGDDSKCYECGEPGHFAREC  528
            K+GWRVELSHNS             GG   GGG D  CYECGEPGHFAREC
Sbjct  61   KHGWRVELSHNSKAGGGGRGGRGRGGGGGGGGGGDMNCYECGEPGHFAREC  111



>ref|NP_564208.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 ref|NP_973901.1| serine/arginine-rich splicing factor RSZ21 [Arabidopsis thaliana]
 sp|O81127.1|RSZ21_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=At-RSZ21; 
Short=At-RSZp21; Short=AtRSZ21 [Arabidopsis thaliana]
 gb|AAD12770.1| SRZ21 [Arabidopsis thaliana]
 dbj|BAH20240.1| AT1G23860 [Arabidopsis thaliana]
 gb|AEE30440.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
 gb|AEE30441.1| RS-containing zinc finger protein 21 [Arabidopsis thaliana]
Length=187

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEF+ +GVLR+VWVARRPPGYAF+EFDD RDALDA+  LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRGG     G  +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|NP_001140388.1| uncharacterized protein LOC100272442 [Zea mays]
 gb|ACF83722.1| unknown [Zea mays]
 gb|AFW72279.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79941.1| arginine/serine-rich splicing factor RSZ28IV [Zea mays]
Length=141

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>gb|AAF87159.1|AC002423_24 T23E23.2 [Arabidopsis thaliana]
Length=183

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEF+ +GVLR+VWVARRPPGYAF+EFDD RDALDA+  LD 
Sbjct  1    MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG--DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRGG     G  +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFAREC  104



>ref|XP_011031384.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Populus 
euphratica]
Length=188

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN          G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  110



>ref|XP_006382133.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 ref|XP_006382134.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
 gb|ERP59930.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 gb|ERP59931.1| hypothetical protein POPTR_0006s28720g [Populus trichocarpa]
Length=187

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN          G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  110



>gb|AAY84872.1| pre-mRNA processing factor [Triticum aestivum]
Length=167

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVG++DP  T RELEDEFR++GVLRSVWVAR+PPG+AF++FDDRRDA DA++ LDG
Sbjct  1    MARVYVGSLDPAVTARELEDEFRVFGVLRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|KJB65745.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=182

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIRELDG  60

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         GG GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHFAREC  109



>gb|KJB65740.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65741.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65742.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65744.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65746.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
 gb|KJB65747.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=183

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIRELDG  60

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         GG GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHFAREC  109



>dbj|BAJ94659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVG++DP  T RELEDEFR++GVLRSVWVAR+PPG+AF++FDDRRDA DA++ LDG
Sbjct  1    MARVYVGSLDPAVTARELEDEFRVFGVLRSVWVARKPPGFAFVDFDDRRDAQDAIKDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N+S GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNASSGRGGRDRSGGSEMKCYECGESGHFAREC  102



>gb|KJB65743.1| hypothetical protein B456_010G121100 [Gossypium raimondii]
Length=172

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFDDHRDAEDAIRELDG  60

Query  653  KNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         GG GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGRGGRGGGGGGGRGRSGGSDLKCYECGEAGHFAREC  109



>ref|XP_003603553.1| Splicing factor arginine/serine-rich [Medicago truncatula]
Length=199

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 91/115 (79%), Gaps = 13/115 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVY+GN+D R +ER+LED+F ++GV+RSVWVARRPPGYAFI+FDDRRDALDA+R LDG
Sbjct  1    MTRVYIGNLDSRISERDLEDDFHVFGVIRSVWVARRPPGYAFIDFDDRRDALDAIRELDG  60

Query  653  KNGWRVELSHNssg-------------grggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS               G  GRS GGG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSKTGGGGGGRGGGGGGGGRGRSGGGGSDLKCYECGEPGHFAREC  115



>ref|XP_010112118.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
 gb|EXC32743.1| Serine/arginine-rich splicing factor 7 [Morus notabilis]
Length=187

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 88/112 (79%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR TER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLSPRVTERDLEDEFRTFGVIRSVWVARRPPGYAFIDFDDARDAEDAIRELDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN            G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  112



>ref|XP_011044978.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X1 [Populus euphratica]
Length=189

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 88/110 (80%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN--------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN          G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  110



>ref|XP_002454683.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|EES07659.1| hypothetical protein SORBIDRAFT_04g035540 [Sorghum bicolor]
 gb|AGE46110.1| arginine/serine-rich splicing factor RSZ19 transcript II [Sorghum 
bicolor]
Length=163

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDARVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>gb|AGC79943.1| arginine/serine-rich splicing factor RSZ28VI [Zea mays]
Length=185

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_004954180.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Setaria italica]
Length=169

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDARVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|XP_006295037.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27935.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=155

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 84/113 (74%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR YGV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRTYGVIRSVWVARRPPGYAFLDFEDSRDARDAIRELDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGESGHFAREC  113



>ref|XP_010460162.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Camelina sativa]
Length=187

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVL +VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRVFGVLCNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG---DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRG    G     +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGGRRGGIEDSKCYECGELGHFAREC  105



>ref|XP_009117114.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
 ref|XP_009117115.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Brassica 
rapa]
Length=205

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 85/111 (77%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV++SVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIKSVWVARRPPGYAFLDFEDSRDARDAIRDLDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN           G   G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGRGDGGRGRGGSDLKCYECGESGHFAREC  111



>ref|XP_010460161.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Camelina sativa]
Length=188

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR TERELEDEFR++GVL +VWVARRPPGYAF+EFDD RDA DA+R LD 
Sbjct  1    MTRVYVGNLDPRITERELEDEFRVFGVLCNVWVARRPPGYAFLEFDDERDASDAIRALDR  60

Query  653  KNGWRVELSHNssggrggrsrggG---DDSKCYECGEPGHFAREC  528
            KNGWRVELSH   GGRG    G     +DSKCYECGE GHFAREC
Sbjct  61   KNGWRVELSHKDKGGRGAGGGGRRGGIEDSKCYECGELGHFAREC  105



>ref|XP_007225929.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
 ref|XP_008219954.1| PREDICTED: serine/arginine-rich splicing factor RSZ22 [Prunus 
mume]
 gb|EMJ27128.1| hypothetical protein PRUPE_ppa012147mg [Prunus persica]
Length=182

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E +LEDEFR++GV+RSVWVARRPPGYAF++FDD RDA DA+R +DG
Sbjct  1    MSRVYVGNLSPRVSEADLEDEFRVFGVIRSVWVARRPPGYAFVDFDDSRDAEDAIREIDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN       G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  107



>ref|XP_008681365.1| PREDICTED: uncharacterized protein LOC100272442 isoform X3 [Zea 
mays]
 gb|ACL54220.1| unknown [Zea mays]
 gb|AFW72285.1| hypothetical protein ZEAMMB73_339392 [Zea mays]
 gb|AGC79942.1| arginine/serine-rich splicing factor RSZ28V [Zea mays]
Length=231

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_002878770.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55029.1| hypothetical protein ARALYDRAFT_481315 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 86/114 (75%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDSRDARDAIRELDG  60

Query  653  KNGWRVELSHN------------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              GG  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGGDGGRGRGGSDLKCYECGESGHFAREC  114



>ref|XP_010429442.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Camelina 
sativa]
Length=197

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 85/113 (75%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRLFGVIRSVWVARRPPGYAFLDFEDSRDARDAIRALDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGESGHFAREC  113



>gb|EMS62939.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=250

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RE+EDEFR++GVL+SVWVAR+PPG+AFI+FD+ RDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATAREIEDEFRVFGVLKSVWVARKPPGFAFIDFDETRDAKDAIRELDG  60

Query  653  KNGWRVELS-HNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  + SG    R R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTKSGSGRGRERERSGGSDMKCYECGESGHFAREC  103



>ref|XP_010417215.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
 ref|XP_010472468.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A [Camelina 
sativa]
Length=197

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 85/113 (75%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR++GV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRLFGVIRSVWVARRPPGYAFLDFEDSRDARDAIRALDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGESGHFAREC  113



>ref|XP_006404997.1| hypothetical protein EUTSA_v10000328mg [Eutrema salsugineum]
 gb|ESQ46450.1| hypothetical protein EUTSA_v10000328mg [Eutrema salsugineum]
Length=202

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 86/114 (75%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIRSVWVARRPPGYAFLDFEDSRDARDAIRDLDG  60

Query  653  KNGWRVELSHN------------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              GG  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGGDGGRGRGGSDLKCYECGESGHFAREC  114



>ref|NP_001132794.1| hypothetical protein [Zea mays]
 ref|XP_008681240.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81790.1| unknown [Zea mays]
 gb|ACN36863.1| unknown [Zea mays]
 gb|AFW73822.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73823.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AFW73824.1| hypothetical protein ZEAMMB73_600026 [Zea mays]
 gb|AGE46038.1| arginine/serine-rich splicing factor RSZ20 transcript I [Zea 
mays]
 gb|AGE46039.1| arginine/serine-rich splicing factor RSZ20 transcript II [Zea 
mays]
 gb|AGE46040.1| arginine/serine-rich splicing factor RSZ20 transcript III [Zea 
mays]
 gb|AGE46041.1| arginine/serine-rich splicing factor RSZ20 transcript IV [Zea 
mays]
Length=173

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R T  ELEDEFR++GVLRSVW+AR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDSRVTSGELEDEFRVFGVLRSVWIARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|XP_004953059.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like [Setaria 
italica]
Length=237

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR +GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRTFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--AGGGRGRDRNGSDMKCYECGETGHFAREC  100



>ref|XP_008681364.1| PREDICTED: uncharacterized protein LOC100272442 isoform X2 [Zea 
mays]
Length=243

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_008681360.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681361.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681362.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 ref|XP_008681363.1| PREDICTED: uncharacterized protein LOC100272442 isoform X1 [Zea 
mays]
 gb|ACF78238.1| unknown [Zea mays]
 gb|ACF84789.1| unknown [Zea mays]
 gb|ACL53509.1| unknown [Zea mays]
 gb|ACN25660.1| unknown [Zea mays]
 gb|ACN33377.1| unknown [Zea mays]
 gb|ACR36653.1| unknown [Zea mays]
 gb|AFW72280.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW72281.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
 gb|AFW72282.1| splicing factor, arginine/serine-rich 7 isoform 3 [Zea mays]
 gb|AFW72283.1| splicing factor, arginine/serine-rich 7 isoform 4 [Zea mays]
 gb|AFW72284.1| splicing factor, arginine/serine-rich 7 isoform 5 [Zea mays]
 gb|AGC79938.1| arginine/serine-rich splicing factor RSZ28I [Zea mays]
 gb|AGC79939.1| arginine/serine-rich splicing factor RSZ28II [Zea mays]
 gb|AGC79940.1| arginine/serine-rich splicing factor RSZ28III [Zea mays]
Length=253

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_003575333.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
 ref|XP_010235686.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X2 [Brachypodium distachyon]
Length=231

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RE+EDEFR++G+LRSVWVAR+PPG+AFI+FD+ RDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATAREIEDEFRVFGILRSVWVARKPPGFAFIDFDESRDAKDAIRELDG  60

Query  653  KNGWRVELS-HNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  + SG    R R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTKSGSGRGRERERPGGSDMKCYECGESGHFAREC  103



>gb|EMT10866.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=249

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RE+EDEFR++GVL+SVWVAR+PPG+AFI+FD+ RDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATAREIEDEFRVFGVLKSVWVARKPPGFAFIDFDETRDAKDAIRELDG  60

Query  653  KNGWRVELS-HNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  + SG    R R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTKSGSGRGRERERSGGSDMKCYECGESGHFAREC  103



>ref|XP_006295038.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
 gb|EOA27936.1| hypothetical protein CARUB_v10024105mg [Capsella rubella]
Length=196

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 84/113 (74%), Gaps = 11/113 (10%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR YGV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRTYGVIRSVWVARRPPGYAFLDFEDSRDARDAIRELDG  60

Query  653  KNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              G  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGGGGRGGDGGRGRGGSDLKCYECGESGHFAREC  113



>gb|ACG44253.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=255

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRMFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTK--VGGGRGRDRNGSDMKCYECGEAGHFAREC  100



>ref|XP_010235684.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010235685.1| PREDICTED: serine/arginine-rich splicing factor RSZ23-like isoform 
X1 [Brachypodium distachyon]
Length=234

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPRAT RE+EDEFR++G+LRSVWVAR+PPG+AFI+FD+ RDA DA+R LDG
Sbjct  1    MARVYVGNLDPRATAREIEDEFRVFGILRSVWVARKPPGFAFIDFDESRDAKDAIRELDG  60

Query  653  KNGWRVELS-HNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  + SG    R R GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSTKSGSGRGRERERPGGSDMKCYECGESGHFAREC  103



>emb|CDX72313.1| BnaC07g43350D [Brassica napus]
Length=197

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 85/110 (77%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRS---VWVARRPPGYAFIEFDDRRDALDAVRG  663
            MSRVYVGN+DPR TERELEDEFR+YGV++    VWVARRPPGYAF++F+D RDA DA+RG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIKRQEFVWVARRPPGYAFLDFEDPRDARDAIRG  60

Query  662  LDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            LDGKNGWRVE SHN        G       GG D KCYECGEPGHFAREC
Sbjct  61   LDGKNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAREC  110



>ref|XP_009363631.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
 ref|XP_009367985.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like [Pyrus 
x bretschneideri]
Length=186

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 5/107 (5%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E +LEDEFR++G +RSVWVARRPPGYAF++FDD RDA DA+RGLDG
Sbjct  1    MSRVYVGNLSPRVSEADLEDEFRVFGNIRSVWVARRPPGYAFVDFDDIRDAEDAIRGLDG  60

Query  653  KNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELSHN        G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNNWRVELSHNSRGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  107



>gb|AGE46101.1| arginine/serine-rich splicing factor RSZ28 transcript I [Sorghum 
bicolor]
 gb|AGE46102.1| arginine/serine-rich splicing factor RSZ28 transcript II [Sorghum 
bicolor]
 gb|AGE46103.1| arginine/serine-rich splicing factor RSZ28 transcript III [Sorghum 
bicolor]
 gb|AGE46104.1| arginine/serine-rich splicing factor RSZ28 transcript IV [Sorghum 
bicolor]
Length=246

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR T RE+EDEFR +GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDPRVTAREIEDEFRTFGVLRSVWVARKPPGFAFIDFDDRRDAQDAIRELDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGW+VELS     G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWKVELSTK--AGGGRGRDRNGSDMKCYECGESGHFAREC  100



>ref|NP_001141411.1| uncharacterized protein LOC100273521 [Zea mays]
 gb|ACF86335.1| unknown [Zea mays]
Length=222

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RV+VGN+DPR T RE+EDEFR +GVL+SVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVFVGNLDPRVTAREIEDEFRTFGVLKSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  +  G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELS--TKDGGGRGRDRNGSDMKCYECGEVGHFAREC  100



>ref|NP_001048352.1| Os02g0789400 [Oryza sativa Japonica Group]
 sp|Q6K4N0.1|RSZ21_ORYSJ RecName: Full=Serine/arginine-rich splicing factor RSZ21; AltName: 
Full=RS-containing zinc finger protein 21; Short=Os-RSZ21; 
Short=Os-RSZp21 [Oryza sativa Japonica Group]
 dbj|BAD19103.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19873.1| putative Splicing factor, arginine/serine-rich 7 [Oryza sativa 
Japonica Group]
 dbj|BAF10266.1| Os02g0789400 [Oryza sativa Japonica Group]
 dbj|BAG93345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93415.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74149.1| hypothetical protein OsI_09229 [Oryza sativa Indica Group]
 gb|EEE57947.1| hypothetical protein OsJ_08668 [Oryza sativa Japonica Group]
Length=185

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N S  RGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-SSSRGGRDRHGGSEMKCYECGETGHFAREC  101



>emb|CDX76804.1| BnaC08g33900D [Brassica napus]
Length=813

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR+YGV++SVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  617  MSRVYVGNLDPRVTERELEDEFRVYGVIKSVWVARRPPGYAFLDFEDSRDARDAIRDLDG  676

Query  653  KNGWRVELSHN----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN      G   G    GG D KCYECGE GHFAREC
Sbjct  677  KNGWRVEQSHNRGGGGGGRGDGGRGRGGSDLKCYECGESGHFAREC  722



>ref|XP_006648032.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X2 [Oryza brachyantha]
Length=186

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N + GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-TSGRGGRDRHGGSEMKCYECGETGHFAREC  101



>ref|XP_008676820.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 ref|XP_008676821.1| PREDICTED: uncharacterized protein LOC100273521 isoform X1 [Zea 
mays]
 gb|ACG37174.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW62914.1| splicing factor, arginine/serine-rich 7 [Zea mays]
Length=277

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RV+VGN+DPR T RE+EDEFR +GVL+SVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVFVGNLDPRVTAREIEDEFRTFGVLKSVWVARKPPGFAFIDFDDRRDAQDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS  +  G G      G D KCYECGE GHFAREC
Sbjct  61   KNGWRVELS--TKDGGGRGRDRNGSDMKCYECGEVGHFAREC  100



>gb|AGE46109.1| arginine/serine-rich splicing factor RSZ19 transcript I [Sorghum 
bicolor]
Length=163

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+ VYVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MACVYVGNLDARVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N S GRGGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-SSGRGGRDRYGGSESKCYECGETGHFAREC  101



>ref|NP_194886.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 ref|NP_001078474.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 sp|O81126.1|RSZ22_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22; AltName: 
Full=RS-containing zinc finger protein 22; Short=At-RSZ22; 
Short=At-RSZp22; Short=AtRSZ22 [Arabidopsis thaliana]
 emb|CAA19765.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAD12769.1| 9G8-like SR protein [Arabidopsis thaliana]
 emb|CAB79876.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAL38828.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM51281.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAM63524.1| RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AEE85931.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
 gb|AEE85932.1| protein serine/arginine-rich 22 [Arabidopsis thaliana]
Length=200

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 87/114 (76%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +GV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDG  60

Query  653  KNGWRVELSHN------------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              GG GGR   GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFAREC  114



>ref|XP_006648031.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like isoform 
X1 [Oryza brachyantha]
Length=187

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+DPR T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N + GRGGR R GG + KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRN-TSGRGGRDRHGGSEMKCYECGETGHFAREC  101



>ref|XP_002869320.1| hypothetical protein ARALYDRAFT_491582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45579.1| hypothetical protein ARALYDRAFT_491582 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 83/111 (75%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +GV+RSVWVARRPPGYAF++F+D RDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRTFGVIRSVWVARRPPGYAFLDFEDPRDARDAIRDVDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN              GG    G  D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGERGGGGRGGDRGGGGGGRGASDLKCYECGETGHFAREC  111



>ref|NP_180035.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
 sp|Q9SJA6.1|RZ22A_ARATH RecName: Full=Serine/arginine-rich splicing factor RSZ22A; AltName: 
Full=RS-containing zinc finger protein 22A; Short=At-RSZ22a; 
Short=At-RSZp22a; Short=AtRSZ22a [Arabidopsis thaliana]
 gb|AAD23894.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 dbj|BAC42523.1| putative RSZp22 splicing factor [Arabidopsis thaliana]
 gb|AAO63280.1| At2g24590 [Arabidopsis thaliana]
 gb|AEC07595.1| serine/arginine-rich splicing factor RSZ22A [Arabidopsis thaliana]
Length=196

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 85/111 (77%), Gaps = 9/111 (8%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +GV+RSVWVARRPPGYAF++F+D RDA DA+R +DG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSRDARDAIREVDG  60

Query  653  KNGWRVELSHN---------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVE SHN           GG  G    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVEQSHNRGGGGGRGGGRGGGDGGRGRGGSDLKCYECGESGHFAREC  111



>ref|NP_001147002.1| LOC100280612 [Zea mays]
 ref|XP_008677172.1| PREDICTED: LOC100280612 isoform X1 [Zea mays]
 gb|ACG25020.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|ACG29912.1| splicing factor, arginine/serine-rich 7 [Zea mays]
 gb|AFW64193.1| splicing factor, arginine/serine-rich 7 isoform 1 [Zea mays]
 gb|AFW64194.1| splicing factor, arginine/serine-rich 7 isoform 2 [Zea mays]
Length=163

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDDRRDA DA+R LDG
Sbjct  1    MARVYVGNLDARVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDRRDAEDAIRDLDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGW+VELS + + GRG R R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWKVELSRS-TNGRGSRDRHGGSESKCYECGETGHFAREC  101



>ref|XP_011459026.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=177

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+  R +E ELEDEFR +GV+RSVWVARRPPGYAF++FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLSSRVSEGELEDEFRNFGVIRSVWVARRPPGYAFVDFDDSRDAEDAIRELDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  108



>ref|XP_009353338.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X2 [Pyrus x bretschneideri]
Length=187

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E ELEDEFR++G +RSVWVARRPPGYAF++FDD RDA DA+R +DG
Sbjct  1    MSRVYVGNLSPRVSEGELEDEFRVFGNIRSVWVARRPPGYAFVDFDDSRDAEDAIREIDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELSHN         G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  108



>ref|XP_009353337.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like isoform 
X1 [Pyrus x bretschneideri]
Length=188

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E ELEDEFR++G +RSVWVARRPPGYAF++FDD RDA DA+R +DG
Sbjct  1    MSRVYVGNLSPRVSEGELEDEFRVFGNIRSVWVARRPPGYAFVDFDDSRDAEDAIREIDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELSHN         G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  108



>gb|KJB53757.1| hypothetical protein B456_009G066600 [Gossypium raimondii]
Length=199

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 90/124 (73%), Gaps = 22/124 (18%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD-  657
            MSRVYVGN+DPR +ER+LEDEFR++GV+RSVWVARRPPGYAFI+F+DRRDA DA+R LD 
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRVFGVIRSVWVARRPPGYAFIDFEDRRDAEDAIRELDA  60

Query  656  ------------------GKNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHF  540
                              GKNGWRVELSHN     G  GG+   GG D KCYECGEPGHF
Sbjct  61   YHLRSTSFTSFMNHVFGSGKNGWRVELSHNSRGRGGRGGGQGCSGGSDLKCYECGEPGHF  120

Query  539  AREC  528
            AREC
Sbjct  121  AREC  124



>ref|XP_004291288.1| PREDICTED: serine/arginine-rich splicing factor RSZ22-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=187

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+  R +E ELEDEFR +GV+RSVWVARRPPGYAF++FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLSSRVSEGELEDEFRNFGVIRSVWVARRPPGYAFVDFDDSRDAEDAIRELDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN         G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  108



>ref|XP_009353309.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A-like [Pyrus 
x bretschneideri]
Length=192

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E ELEDEFR++G +RSVWVARRPPGYAF++FDD RDA DA+R +DG
Sbjct  1    MSRVYVGNLSPRVSEGELEDEFRVFGNIRSVWVARRPPGYAFVDFDDSRDAEDAIREIDG  60

Query  653  KNGWRVELSHN------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELSHN         G GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNNWRVELSHNSRGGGGGGRGGGGRGRSGGSDLKCYECGEPGHFAREC  108



>ref|XP_002324943.1| splicing factor RSZp22 family protein [Populus trichocarpa]
 gb|EEF03508.1| splicing factor RSZp22 family protein [Populus trichocarpa]
Length=198

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 88/114 (77%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD-  657
            MSRVYVGN+DPR +ERELEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LD 
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDA  60

Query  656  GKNGWRVELSHN-----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            GKNGWRVELSHN             G  GGR R GG D KCYECGE GHFAREC
Sbjct  61   GKNGWRVELSHNSRGGGGGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC  114



>emb|CAA05352.1| RSZp22 protein [Arabidopsis thaliana]
Length=200

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 85/114 (75%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TERELEDEFR +GV+RSVWVARRPPGYAF++F+D RDA DA+R LDG
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDG  60

Query  653  KNGWRVELSHN------------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRV  SHN              GG  GR   GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVAQSHNRGERGGGGRGGDRGGGGAGRGGRGGSDLKCYECGETGHFAREC  114



>ref|XP_008357431.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RSZ22A-like [Malus domestica]
Length=194

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 87/114 (76%), Gaps = 12/114 (11%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+ PR +E ELEDEFR++G +RSVWVARRPPGYAF++FDD RDA DA+R LDG
Sbjct  1    MSRVYVGNLSPRVSEGELEDEFRVFGNIRSVWVARRPPGYAFVDFDDSRDAEDAIRELDG  60

Query  653  KNGWRVELSHN------------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KN WRVELSHN              GG GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNNWRVELSHNXRGGGGGGGGGGGGGGGGGRGRSGGSDLKCYECGEPGHFAREC  114



>emb|CDY13444.1| BnaA03g51620D [Brassica napus]
Length=199

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 83/112 (74%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLR-----SVWVARRPPGYAFIEFDDRRDALDAV  669
            MSRVYVGN+DPR TERELEDEFR+YGV++      VWVARRPPGYAF++F+D RDA DA+
Sbjct  1    MSRVYVGNLDPRVTERELEDEFRVYGVIKRQALIHVWVARRPPGYAFLDFEDPRDASDAI  60

Query  668  RGLDGKNGWRVELSHN-----ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            R LDG NGWRVE SHN        G       GG D KCYECGEPGHFAREC
Sbjct  61   RDLDGNNGWRVEQSHNRGDRGGGRGGDRGGDRGGSDLKCYECGEPGHFAREC  112



>ref|XP_002963848.1| hypothetical protein SELMODRAFT_68846, partial [Selaginella moellendorffii]
 gb|EFJ35719.1| hypothetical protein SELMODRAFT_68846, partial [Selaginella moellendorffii]
Length=181

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR+TERELEDEFR +GVLRSVWVAR+PPG+AFIEFDD RDA DA++ ++G
Sbjct  1    MARVYVGNLDPRSTERELEDEFRSFGVLRSVWVARKPPGFAFIEFDDYRDAQDAIQNMNG  60

Query  653  KNGWRVELSHNss--------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS +S+         G      GGGD+ KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRSSNGGRGGGRDPGAREGRGGGGDELKCYECGEAGHFAREC  110



>ref|XP_010235900.1| PREDICTED: serine/arginine-rich splicing factor RSZ21-like [Brachypodium 
distachyon]
Length=194

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 7/109 (6%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+D R T  ELEDEFR++G LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDARVTAGELEDEFRVFGALRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHNss-------ggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS NSS       GG GGR R GG +SKCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHFAREC  109



>gb|EMT04120.1| Splicing factor, arginine/serine-rich 7 [Aegilops tauschii]
Length=224

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N           +GG GG    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNDRGDRGGRGGGAGGGGGGRDRGGSDMKCYECGESGHFAREC  112



>ref|XP_004135236.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine-rich splicing 
factor RSZ21-like [Cucumis sativus]
Length=158

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 79/102 (77%), Gaps = 20/102 (20%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVY+GN+DPR TER+LEDEFR++GVLRSVWVARRPPGYAFIEFDDRRDALDA++ LDG
Sbjct  1    MTRVYIGNLDPRVTERDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALDG  60

Query  653  KNGWRVELSHNssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHNS GG                    GHFAREC
Sbjct  61   KNGWRVELSHNSKGG--------------------GHFAREC  82



>ref|XP_002971799.1| hypothetical protein SELMODRAFT_172361 [Selaginella moellendorffii]
 gb|EFJ27548.1| hypothetical protein SELMODRAFT_172361 [Selaginella moellendorffii]
Length=229

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+RVYVGN+DPR+TERELEDEFR +GVLRSVWVAR+PPG+AFIEFDD RDA DA++ ++G
Sbjct  1    MARVYVGNLDPRSTERELEDEFRSFGVLRSVWVARKPPGFAFIEFDDYRDAQDAIQNMNG  60

Query  653  KNGWRVELSHNssg--------grggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS +S+G        G      GGGD+ KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRSSNGGRGGGRDPGAREGRGGGGDELKCYECGEAGHFAREC  110



>dbj|BAJ98217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 85/112 (76%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N            GG GG    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNDRGDRGGRGGGGGGGGGGRDRGGSDMKCYECGESGHFAREC  112



>gb|AAY84871.1| pre-mRNA processing factor [Triticum aestivum]
Length=194

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 10/112 (9%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            M+R+YVGN+D R T  ELEDEFR++G+LRSVWVAR+PPG+AFI+FDD+RDA DA+R LDG
Sbjct  1    MARLYVGNLDARVTAGELEDEFRVFGILRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG  60

Query  653  KNGWRVELSHN----------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELS N            GG GG    GG D KCYECGE GHFAREC
Sbjct  61   KNGWRVELSRNDRGDRGGRGGGGGGGGGGRGRGGSDMKCYECGESGHFAREC  112



>gb|EMS58509.1| Serine/arginine-rich splicing factor 7 [Triticum urartu]
Length=375

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 86/110 (78%), Gaps = 7/110 (6%)
 Frame = -1

Query  836  TMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD  657
            TM+R+YVGN+D R T  ELEDEFR++GVLRSVWVAR+PPG+AFI+FDD+RDA DA+R LD
Sbjct  93   TMARLYVGNLDARVTAGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLD  152

Query  656  GKNGWRVELSHN-------ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            GKNGWRVELS N         GG GG    GG D KCYECGE GHFAREC
Sbjct  153  GKNGWRVELSRNDRGDRGGRGGGGGGGRDRGGSDMKCYECGESGHFAREC  202



>gb|KGN51817.1| hypothetical protein Csa_5G602160 [Cucumis sativus]
Length=266

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -1

Query  836  TMSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLD  657
            TM+RVY+GN+DPR TER+LEDEFR++GVLRSVWVARRPPGYAFIEFDDRRDALDA++ LD
Sbjct  82   TMTRVYIGNLDPRVTERDLEDEFRMFGVLRSVWVARRPPGYAFIEFDDRRDALDAIQALD  141

Query  656  GKNGWRVELSHN  621
            GKNGWRVELSHN
Sbjct  142  GKNGWRVELSHN  153



>ref|XP_002515364.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
 gb|EEF46813.1| arginine/serine-rich splicing factor, putative [Ricinus communis]
Length=179

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR TER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVTERDLEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDADDAIHELDG  60

Query  653  KNGWRVELSHN---ssggrggrsrggGDDSKCYECGEPGHFAREC  528
            KNGWRVELSHN     G  GGR R GG D KCYECGEPGHFAREC
Sbjct  61   KNGWRVELSHNSRGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC  105



>ref|XP_006371787.1| hypothetical protein POPTR_0018s03390g [Populus trichocarpa]
 gb|ERP49584.1| hypothetical protein POPTR_0018s03390g [Populus trichocarpa]
Length=149

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN  621
            KNGWRVELSHN
Sbjct  61   KNGWRVELSHN  71



>ref|XP_011044979.1| PREDICTED: serine/arginine-rich splicing factor RSZ22A isoform 
X2 [Populus euphratica]
Length=150

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ERELEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN  621
            KNGWRVELSHN
Sbjct  61   KNGWRVELSHN  71



>gb|ABK96398.1| unknown [Populus trichocarpa x Populus deltoides]
Length=166

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -1

Query  833  MSRVYVGNVDPRATERELEDEFRIYGVLRSVWVARRPPGYAFIEFDDRRDALDAVRGLDG  654
            MSRVYVGN+DPR +ER+LEDEFR +GV+RSVWVARRPPGYAFI+FDD+RDA DA+  LDG
Sbjct  1    MSRVYVGNLDPRVSERDLEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAQDAIHELDG  60

Query  653  KNGWRVELSHN  621
            KNGWRVELSHN
Sbjct  61   KNGWRVELSHN  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779474092270