BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016E09

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03802.1|  unnamed protein product                                162   3e-43   Coffea canephora [robusta coffee]
ref|XP_009803384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    149   4e-41   Nicotiana sylvestris
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    152   7e-40   Nicotiana tomentosiformis
gb|KJB42339.1|  hypothetical protein B456_007G150200                    150   2e-39   Gossypium raimondii
gb|KJB42336.1|  hypothetical protein B456_007G150200                    150   3e-39   Gossypium raimondii
gb|KJB42340.1|  hypothetical protein B456_007G150200                    150   4e-39   Gossypium raimondii
gb|KHG08643.1|  hypothetical protein F383_12346                         149   4e-39   Gossypium arboreum [tree cotton]
gb|KJB42335.1|  hypothetical protein B456_007G150200                    150   6e-39   Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    148   8e-39   
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       148   2e-38   Cucumis sativus [cucumbers]
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         148   3e-38   Jatropha curcas
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    148   3e-38   
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    148   3e-38   Cucumis melo [Oriental melon]
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    148   3e-38   Eucalyptus grandis [rose gum]
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    147   4e-38   
ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   4e-38   Sesamum indicum [beniseed]
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   9e-38   Glycine max [soybeans]
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    146   2e-37   Vitis vinifera
ref|XP_004140669.1|  PREDICTED: ABC transporter C family member 5...    151   2e-37   
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             145   3e-37   Phaseolus vulgaris [French bean]
gb|ABK94679.1|  unknown                                                 144   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             144   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   9e-37   Populus euphratica
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    144   1e-36   
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                143   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   4e-36   Solanum tuberosum [potatoes]
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   7e-36   Cicer arietinum [garbanzo]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   9e-36   Fragaria vesca subsp. vesca
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   9e-36   Tarenaya hassleriana [spider flower]
gb|AFK48198.1|  unknown                                                 141   1e-35   Lotus japonicus
gb|ACU23211.1|  unknown                                                 140   1e-35   Glycine max [soybeans]
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             140   2e-35   
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             140   2e-35   
gb|ACJ84721.1|  unknown                                                 140   2e-35   Medicago truncatula
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010091822.1|  hypothetical protein L484_015891                   139   6e-35   Morus notabilis
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34   Malus domestica [apple tree]
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   2e-34   Elaeis guineensis
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             137   3e-34   
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   1e-33   
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          135   1e-33   Amborella trichopoda
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   3e-33   Pyrus x bretschneideri [bai li]
gb|EPS69627.1|  hypothetical protein M569_05135                         133   6e-33   Genlisea aurea
gb|KJB42341.1|  hypothetical protein B456_007G150200                    132   8e-33   Gossypium raimondii
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   1e-32   Phoenix dactylifera
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   2e-32   
gb|EEE58042.1|  hypothetical protein OsJ_08874                          130   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   5e-32   Setaria italica
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    130   6e-32   
dbj|BAG95473.1|  unnamed protein product                                129   7e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048516.1|  Os02g0816800                                       130   1e-31   
gb|EEC74241.1|  hypothetical protein OsI_09443                          130   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          129   2e-31   Sorghum bicolor [broomcorn]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   2e-31   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH20309.1|  AT2G20360                                              128   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    128   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149069.1|  LOC100282690                                       128   6e-31   
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   6e-31   
gb|ACF85773.1|  unknown                                                 128   7e-31   Zea mays [maize]
emb|CDY31970.1|  BnaA07g00250D                                          127   9e-31   Brassica napus [oilseed rape]
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                127   1e-30   Arabidopsis lyrata subsp. lyrata
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  127   1e-30   
emb|CDY39772.1|  BnaA09g10240D                                          127   2e-30   Brassica napus [oilseed rape]
emb|CDX81965.1|  BnaC08g36360D                                          127   2e-30   
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   2e-30   Brassica rapa
emb|CDY13877.1|  BnaA09g43790D                                          127   2e-30   Brassica napus [oilseed rape]
emb|CDY03308.1|  BnaC09g10400D                                          127   2e-30   
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             126   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   5e-30   
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   7e-30   Camelina sativa [gold-of-pleasure]
dbj|BAJ86608.1|  predicted protein                                      125   9e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   1e-29   Brassica rapa
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    123   1e-29   Triticum urartu
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    123   2e-29   
gb|ABK24353.1|  unknown                                                 122   1e-28   Picea sitchensis
emb|CDY05746.1|  BnaC07g00570D                                          122   1e-28   
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    121   2e-28   Brassica rapa
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    120   3e-28   Arabis alpina [alpine rockcress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   116   5e-27   Citrus sinensis [apfelsine]
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  95.5    2e-19   Prunus mume [ume]
ref|XP_001757609.1|  predicted protein                                73.2    1e-11   
ref|XP_001765756.1|  predicted protein                                70.9    7e-11   
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564           65.5    4e-09   
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106            65.5    4e-09   
gb|KJB42342.1|  hypothetical protein B456_007G150200                  63.5    8e-09   Gossypium raimondii
ref|XP_001420142.1|  predicted protein                                64.7    8e-09   Ostreococcus lucimarinus CCE9901
gb|KJB42337.1|  hypothetical protein B456_007G150200                  64.3    1e-08   Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                  64.3    1e-08   Gossypium raimondii
ref|XP_003059930.1|  predicted protein                                62.8    3e-08   Micromonas pusilla CCMP1545
emb|CEF99374.1|  NAD(P)-binding domain                                62.8    4e-08   Ostreococcus tauri
ref|XP_007510295.1|  predicted protein                                62.0    8e-08   Bathycoccus prasinos
ref|XP_005651289.1|  NAD(P)-binding protein                           60.1    3e-07   Coccomyxa subellipsoidea C-169
ref|XP_002504449.1|  predicted protein                                55.5    1e-05   Micromonas commoda



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFP+PTPSIFNLD IEALTTDT+VSKDALTFDDLGI PHKLKGYPVE+
Sbjct  334  IAMPREVLLKKVPFPMPTPSIFNLDAIEALTTDTLVSKDALTFDDLGIAPHKLKGYPVEF  393

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP+YGSTVSE+VSPES+P
Sbjct  394  LIQYRKGGPKYGSTVSEKVSPESWP  418



>ref|XP_009803384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana sylvestris]
Length=147

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE LL KVP P+PTP+IFNLD IEAL TD +VSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  63   IASPREFLLNKVPAPMPTPTIFNLDAIEALATDNIVSKDALTFEDLGLAPHKVKGYPVEF  122

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP YGSTVSERVSPESYP
Sbjct  123  LIQYRKGGPNYGSTVSERVSPESYP  147



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE LLKKVP P+PTP+IFNLD IEA+TTD +VSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  313  IASPREFLLKKVPAPMPTPTIFNLDAIEAITTDNIVSKDALTFEDLGLAPHKVKGYPVEF  372

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP YGSTVSERVSPESYP
Sbjct  373  LIQYRKGGPNYGSTVSERVSPESYP  397



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  272  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  331

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  332  LIQYRKGGPQFGSTVSEKVNPDSYP  356



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  261  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  320

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  321  LIQYRKGGPQFGSTVSEKVNPDSYP  345



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  299  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  358

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  359  LIQYRKGGPQFGSTVSEKVNPDSYP  383



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  286  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  345

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  346  LIQYRKGGPQFGSTVSEKVNPDSYP  370



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  375

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  376  LIQYRKGGPQFGSTVSEKVNPDSYP  400



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  229  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  288

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  289  LIQYRKGGPQFGSTVSEKVNPEYWP  313



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPRE+LL KVPFPLPTP+IFNLD I ALT DTVVS+ ALTF+DLGIVPHKLKGYPVE+
Sbjct  317  IATPREILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEF  376

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GSTVSERV+P+S+P
Sbjct  377  LISYRKGGPQFGSTVSERVNPDSFP  401



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PREVLL KVPFPLPTP+I NLD I AL+ DTVVSKDALTF DLGIVPHKLKGYPVE+
Sbjct  312  LAMPREVLLNKVPFPLPTPNILNLDEINALSVDTVVSKDALTFHDLGIVPHKLKGYPVEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GSTVSERVSP+S+P
Sbjct  372  LISYRKGGPQFGSTVSERVSPDSFP  396



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  308  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  367

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  368  LIQYRKGGPQFGSTVSEKVNPEYWP  392



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPRE+LL KVPFPLPTPSIFNLD I ALT DTVVS+ ALTF+DLGI+PHKLKGYP+E+
Sbjct  318  IATPREILLNKVPFPLPTPSIFNLDQILALTQDTVVSEKALTFNDLGIIPHKLKGYPIEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GSTVSE+VSP+S+P
Sbjct  378  LISYRKGGPQFGSTVSEKVSPDSFP  402



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
             A PRE+LLKKVPFPLP P IFNLD I ALT DTVVSKDALTF+DLGIVPHK+KGYPVE+
Sbjct  310  FAMPRELLLKKVPFPLPNPDIFNLDQINALTEDTVVSKDALTFNDLGIVPHKVKGYPVEF  369

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGP +GSTVSERVSP++YP
Sbjct  370  LISYRKGGPNFGSTVSERVSPDAYP  394



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  375

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  376  LIQYRKGGPQFGSTVSEKVNPEYWP  400



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPREVLL KVPFP+PTP+IFNLD IEAL+TDT+VS++AL F+DLGIVP KLKGYPVE+
Sbjct  316  IATPREVLLNKVPFPMPTPTIFNLDQIEALSTDTLVSENALKFEDLGIVPCKLKGYPVEF  375

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGPQYGSTVSE+V+P+S+
Sbjct  376  LIQYRKGGPQYGSTVSEKVTPQSW  399



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPRE+LL KVPFPLP P I NLD I+ALTTDTVVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKGYPIEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERV+P+S+P
Sbjct  372  LISYRKGGPQFGSTISERVTPDSWP  396



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -3

Query  706  PREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQ  527
            PRE+LL KVPFPLPTP +FNLDLI A T+DTVVS++ALTFDDLGIVPHKLKGYP+E+L+ 
Sbjct  318  PREILLNKVPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDLGIVPHKLKGYPIEFLLS  377

Query  526  YRKGGPQYGSTVSERVSPESYP  461
            YRKGGPQ+GST+SERV PE++P
Sbjct  378  YRKGGPQFGSTISERVDPEAFP  399



>ref|XP_004140669.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
 ref|XP_004157617.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
Length=1752

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  715   IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
             IATPRE+LL KVPFPLPTP+IFNLD I ALT DTVVS+ ALTF+DLGIVPHKLKGYPVE+
Sbjct  1668  IATPREILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEF  1727

Query  535   LIQYRKGGPQYGSTVSERVSPESYP  461
             LI YRKGGPQ+GSTVSERV+P+S+P
Sbjct  1728  LISYRKGGPQFGSTVSERVNPDSFP  1752



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPRE+LL KVPFPLP P IFNLD I+ALTTDT+VS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPREILLNKVPFPLPNPDIFNLDKIQALTTDTIVSENALTFNDLGIVPHKLKGYPIEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPES  467
            LI YRKGGPQ+GST+SER+SP++
Sbjct  372  LISYRKGGPQFGSTISERISPDA  394



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPR VL+ KVPFPLP P IFNLD I ALT D+VVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPR VL+ KVPFPLP P IFNLD I ALT D+VVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE LL KVPFPLPTP IFNLD I ALT DTVVS++ALTF+DLGIVPHKLKGYPVEY
Sbjct  314  LASPREFLLNKVPFPLPTPDIFNLDQINALTVDTVVSENALTFNDLGIVPHKLKGYPVEY  373

Query  535  LIQYRKGGPQYGSTVSERVSPE  470
            LI YRKGGPQ+GST+SERVSP+
Sbjct  374  LISYRKGGPQFGSTISERVSPD  395



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPR VL+ KVPFPLPTP+IFNLD I ALT ++VVS++ALTF DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPTPNIFNLDEINALTINSVVSENALTFSDLGIVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE LL KVP P+P P+IFNLD I+AL TD VVSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  317  IASPREFLLNKVPTPMPVPTIFNLDAIKALATDNVVSKDALTFEDLGLAPHKVKGYPVEF  376

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP YGSTVSE++SPESYP
Sbjct  377  LIQYRKGGPNYGSTVSEKMSPESYP  401



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            I+TPRE+LLKKVPFPLP P+IFNLDLIE+L+TDTVVS++ALTF+DLGI P KLKGYPVE+
Sbjct  316  ISTPRELLLKKVPFPLPVPTIFNLDLIESLSTDTVVSENALTFEDLGIAPRKLKGYPVEF  375

Query  535  LIQYRKGGPQYGSTVSERVSPE  470
            LIQYRKGGP YGSTVSE++SP+
Sbjct  376  LIQYRKGGPNYGSTVSEKISPK  397



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE LL KVP P+P P+IFNLD I+A  TD +VSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  317  IASPREFLLNKVPTPMPVPTIFNLDAIKAFATDNIVSKDALTFEDLGLAPHKVKGYPVEF  376

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP YGSTVSE++SPESYP
Sbjct  377  LIQYRKGGPNYGSTVSEKMSPESYP  401



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PREVLL K+PFPLPTP IFNLD I ALTTDT+VS +ALTF DLGI PHKLKGYPVEY
Sbjct  318  MASPREVLLNKLPFPLPTPQIFNLDQINALTTDTLVSGNALTFQDLGIAPHKLKGYPVEY  377

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GSTVSE+V  + YP
Sbjct  378  LIQYRKGGPQFGSTVSEKVPTDFYP  402



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPRE+LL KVPFPLP P +FNLD I A  TDTVVS++ALTF+DLGIVPHKLKGYP+EY
Sbjct  312  LATPRELLLNKVPFPLPKPEMFNLDQIHAFATDTVVSENALTFNDLGIVPHKLKGYPIEY  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI +RKGGP++GSTVSE+VSPE +P
Sbjct  372  LISHRKGGPRFGSTVSEKVSPEDWP  396



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PRE+LLKKVPFPLP P IFNLD I A   DTVVS++ALTF+DLGI+PHK+KGYP+E+
Sbjct  313  IAMPREILLKKVPFPLPNPEIFNLDQILAQAPDTVVSENALTFNDLGILPHKIKGYPIEF  372

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE+VSP+SYP
Sbjct  373  LIQYRKGGPNFGSTVSEKVSPDSYP  397



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PREV+L KVPFPLPTP IFNLD I ALTTDT+VS +ALTF DLGIVPHKLKGYPVEY
Sbjct  318  LASPREVMLNKVPFPLPTPQIFNLDQINALTTDTLVSDNALTFQDLGIVPHKLKGYPVEY  377

Query  535  LIQYRKGGPQYGSTVSERV  479
            LIQYRKGGPQ+GSTVSE+V
Sbjct  378  LIQYRKGGPQFGSTVSEKV  396



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE+L+ K+PFPLPTP+IFNLD I ALTTDTVVS++ALTF+DLGI P KLKGYP E+
Sbjct  312  LASPRELLINKLPFPLPTPNIFNLDQIRALTTDTVVSENALTFNDLGINPQKLKGYPTEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERVSP+++P
Sbjct  372  LISYRKGGPQFGSTISERVSPDAWP  396



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPRE+LL KVPFPLP P I NLD I+ALTTDTVVS++ALTF+DLGIVPHKLK YP+E+
Sbjct  312  LATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKEYPIEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGPQ+GST+SERV+P+ +P
Sbjct  372  LISYRKGGPQFGSTISERVTPDFWP  396



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PRE+LLKKVPFPLP P +FNLD I A T+DT+VS +ALTF DLGIVPHKLKGYP EY
Sbjct  316  VAMPREILLKKVPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEY  375

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LI YRKGGP++GSTVSER++PE++P
Sbjct  376  LIWYRKGGPKFGSTVSERINPEAWP  400



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PRE+LL KVPFPLP P IFN D I A  TDTVVS+++LTF DLG+VPHKLKGYPVE+
Sbjct  315  IAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP YGSTVSERVSP+++P
Sbjct  375  LIQYRKGGPNYGSTVSERVSPDAWP  399



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +ATPRE+ L K+PFPLP P +FNLD I A   DTVVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPRELFLNKLPFPLPKPEMFNLDQIHAYAADTVVSENALTFNDLGIVPHKLKGYPIEF  371

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGPQ+GST+SE+VSP+++P
Sbjct  372  LIQYRKGGPQFGSTISEKVSPDAWP  396



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPRE+LLKKVPFPLP P IFNLD I + T DTVVS +ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IATPRELLLKKVPFPLPNPDIFNLDQINSFTVDTVVSDNALTFKDLGIVPHKLKGYPVEY  375

Query  535  LIQYRKGGPQYGSTVSERVSPE  470
            LI YRKGGP +GSTVSERV+ E
Sbjct  376  LISYRKGGPSFGSTVSERVTAE  397



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPRE+LL KVPFPLP P IFNLD I A TTDTVVS++ALTF+DL I+PHKLKGYP+E+
Sbjct  315  IATPREILLNKVPFPLPKPDIFNLDQILAQTTDTVVSENALTFNDLEIMPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            L  YRKGGPQ+GST+SERVSP+++P
Sbjct  375  LACYRKGGPQFGSTISERVSPDAWP  399



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+EY
Sbjct  315  MGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEY  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  375  LIQFRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE LLKKVPFPLP P IFNLD I ALT DT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLKKVPFPLPNPDIFNLDQINALTVDTLVSENALTFSDLGIVPHKLKGYPVEY  374

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LI YRKGGP YGSTVSERV+   +
Sbjct  375  LICYRKGGPAYGSTVSERVTGSEF  398



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 3/88 (3%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA---LTFDDLGIVPHKLKGYP  545
             ATPRE+LL KVPFPLP P +FNLD I +LT DTVVS++    LTF DLGIVPHKLKGYP
Sbjct  297  FATPREILLNKVPFPLPNPKMFNLDEINSLTMDTVVSENGEFTLTFSDLGIVPHKLKGYP  356

Query  544  VEYLIQYRKGGPQYGSTVSERVSPESYP  461
            VE+LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  357  VEFLISYRKGGPQFGSTISERVSPDSFP  384



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF+DLG+VPHKLKGYP+E+
Sbjct  315  MGAPREILLNKVPFPLPNPEIFNRDQILAQETDTLVSENALTFNDLGLVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  375  LIQFRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++AL+F+DLG+VPHKLKGYP+E+
Sbjct  353  MGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALSFNDLGLVPHKLKGYPIEF  412

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  413  LIQFRKGGPNYGSTVSERVSPDAWP  437



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE+LL+KVPFPLPTP +FNLD I +LT DTVVS+ ALTF++LGIVP KLKGYP+E+
Sbjct  313  LASPREILLRKVPFPLPTPDVFNLDYINSLTVDTVVSEKALTFENLGIVPRKLKGYPIEF  372

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LI YRKGGPQYGSTVSERV+   Y
Sbjct  373  LISYRKGGPQYGSTVSERVTGPEY  396



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            I  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+E+
Sbjct  315  IGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQ+RKGGP YGSTVSER SP ++P
Sbjct  375  LIQFRKGGPNYGSTVSERGSPHAWP  399



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PRE  LKKVPFPLPTP IFNLD I+  ++DT+VS++AL F DLGI P KLKGYPVEY
Sbjct  276  IAVPREFFLKKVPFPLPTPKIFNLDQIKEFSSDTLVSENALKFQDLGIAPRKLKGYPVEY  335

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGPQYGSTVSE+  P S+
Sbjct  336  LIQYRKGGPQYGSTVSEKELPRSW  359



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  688  KKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGP  509
            K +PFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEYLIQYRKGGP
Sbjct  237  KYMPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGP  296

Query  508  QYGSTVSERVSPESYP  461
            Q+GSTVSE+V+P+SYP
Sbjct  297  QFGSTVSEKVNPDSYP  312



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE LL KVPFPLP P IFNLD I ALT DTVVS++ALT  DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLNKVPFPLPNPDIFNLDQINALTVDTVVSENALTLSDLGIVPHKLKGYPVEY  374

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LI YRKGGP YG+TVSERV+   +
Sbjct  375  LICYRKGGPAYGATVSERVTRSDF  398



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE LL KVPFPLP P IFNLD I A T DTVVS++ALT  DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLNKVPFPLPNPDIFNLDQINAFTVDTVVSENALTLSDLGIVPHKLKGYPVEY  374

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LI YRKGGP YGSTVSER++   +
Sbjct  375  LICYRKGGPAYGSTVSERITRSDF  398



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  227  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  286

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  287  LVCYRKGGPAFGSTVSEKI  305



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I A + D +VS+DALTF+DLGI+P KLKGYPVEY
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINAFSVDNLVSEDALTFEDLGIMPQKLKGYPVEY  384

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  385  LLSYRKGGPAFGSTVSEKM  403



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IATPREVL+ KVPFPLPTP+IFNLD I ALT DTVVS++ALTF DLGI+PHKLKGYPVEY
Sbjct  316  IATPREVLINKVPFPLPTPNIFNLDEIIALTMDTVVSENALTFHDLGIMPHKLKGYPVEY  375

Query  535  LIQYRKGGPQYGST  494
            LI YRKGGPQ+GST
Sbjct  376  LISYRKGGPQFGST  389



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  228  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  287

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPAFGSTVSEKI  306



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  384

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVCYRKGGPAFGSTVSEKI  403



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  384

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVCYRKGGPAFGSTVSEKI  403



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DLGI+P KLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLGIMPQKLKGYPVEF  384

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVSYRKGGPSFGSTVSEKM  403



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            ++TPRE+LL KVPFPLP+P+IFNLD I AL+ DTVVS  ALTF DL I PHKL+GYPVEY
Sbjct  311  VSTPRELLLNKVPFPLPSPTIFNLDQIHALSVDTVVSDKALTFADLDIAPHKLRGYPVEY  370

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            L  YRKGGPQ+GST+SERVS + +
Sbjct  371  LSCYRKGGPQFGSTISERVSTDPW  394



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS +AL F DL +VPHKLKGYPVE+
Sbjct  251  MAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEF  310

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  311  LIQYRKGGPNFGSTVSEKIPTDFYP  335



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS +AL F DL +VPHKLKGYPVE+
Sbjct  318  MAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFYP  402



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  324  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  383

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  384  LVSYRKGGPSFGSTVSEKM  402



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            I++PRE+LL KVPFPLP+PSIFNLD I A + D +VS++ALTF DLGI+PHKLKGYPVE+
Sbjct  277  ISSPREMLLNKVPFPLPSPSIFNLDQINAFSVDNLVSENALTFADLGIMPHKLKGYPVEF  336

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  337  LVCYRKGGPAFGSTVSEKI  355



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  324  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  383

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  384  LVSYRKGGPSFGSTVSEKM  402



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS +ALTF DL +VPHKLKGYPVE+
Sbjct  318  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDEALTFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            I  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+E+
Sbjct  315  IGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEF  374

Query  535  LIQYRKGGPQYGSTVSER  482
            LIQ+RKGGP YGSTVSER
Sbjct  375  LIQFRKGGPNYGSTVSER  392



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  AL F DL +VPHKLKGYPVE+
Sbjct  318  MAAPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALKFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFYP  402



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  377  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  436

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  437  LVSYRKGGPSFGSTVSEKM  455



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  319  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFY  402



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  319  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFY  402



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  319  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFY  402



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  319  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFY  402



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  318  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I  LTTDT+VS +AL F DL +VPHKLKGYPVE+
Sbjct  319  MAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFYP  403



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I  LTTDT+VS +AL F DL +VPHKLKGYPVE+
Sbjct  319  MAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFYP  403



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P +FNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  318  MAGPRDFMVNKVPFPLPSPQVFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA+PRE+LL KVPFPLPTPSIFNLD I AL+ D +VS++ALTF DL I PHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINALSVDNLVSENALTFADLEIRPHKLKGYPVEF  384

Query  535  LIQYRKGGPQYGSTVSERVS  476
            L+ YRKGGP +GSTVSE++ 
Sbjct  385  LVCYRKGGPSFGSTVSEKMG  404



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I  LTTDT+VS +A  F DL +VPHKLKGYPVE+
Sbjct  319  MAAPRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDNAFKFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESYP  461
            LIQYRKGGP +GSTVSE++  + YP
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFYP  403



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE+LL KVPFPLPTPSIFNLD I+AL+ D +VS++ALTF DL I PHKLKGYP E+
Sbjct  326  MASPREMLLNKVPFPLPTPSIFNLDQIKALSVDNLVSENALTFADLEIKPHKLKGYPTEF  385

Query  535  LIQYRKGGPQYGSTVSERVSPE  470
            L+ YRKGGP +GSTVSE++  E
Sbjct  386  LVCYRKGGPSFGSTVSEKMGSE  407



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP+P IFNLD I ALT DT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  319  MAGPRDFMVNKVPFPLPSPQIFNLDQINALTIDTLVSDKALTFQDLDLVPHKLKGYPVEF  378

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  379  LIQYRKGGPNFGSTVSEKIPTDFY  402



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE+LL KVPFPLPTPSIFNLD I+ALT D +VS++AL+F DL I PHKLKGYP E+
Sbjct  228  MASPREMLLNKVPFPLPTPSIFNLDQIKALTVDNLVSENALSFADLEIKPHKLKGYPTEF  287

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPSFGSTVSEKM  306



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A+PRE+LL KVPFPLPTPSIFNLD I+ALT D +VS++AL+F DL I PHKLKGYP E+
Sbjct  228  MASPREMLLNKVPFPLPTPSIFNLDHIKALTVDNLVSENALSFADLEIKPHKLKGYPTEF  287

Query  535  LIQYRKGGPQYGSTVSERV  479
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPSFGSTVSEKM  306



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            I++PRE LL KVPFPLPTP IFN D +++L  D VVS+DALTF DL +VPHKLKGYP+E+
Sbjct  318  ISSPREFLLNKVPFPLPTPEIFNQDYVDSLLADNVVSQDALTFTDLSVVPHKLKGYPIEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            L QYR GGP +G+T+ ER+S   +
Sbjct  378  LFQYRTGGPSFGATLGERISGAGF  401



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A  R+ ++ KVPFPLP+P IFNLD I  LTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  318  MAGTRDFMVNKVPFPLPSPQIFNLDQINTLTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFY  401



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVP PLP+P IFN D I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  318  MAGPRDFMVNKVPSPLPSPQIFNRDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEF  377

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  378  LIQYRKGGPNFGSTVSEKIPTDFY  401



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PR+ ++ KVPFPLP P +FNLD I A T DT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  320  MAGPRDFMVNKVPFPLPCPQVFNLDQINASTIDTLVSDKALTFQDLDLVPHKLKGYPVEF  379

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  380  LIQYRKGGPNFGSTVSEKIPTDFY  403



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PRE+LLKKVPFPLP P +FNLD I A T+DT+VS +ALTF DLGIVPHKLKGYP EY
Sbjct  257  VAMPREILLKKVPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEY  316

Query  535  LIQYRKGGPQY  503
            LI YRKGGP++
Sbjct  317  LIWYRKGGPKF  327



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            IA PRE+LL KVPFPLP P IFN D I A  TDTVVS+++LTF DLG+VPHKLKGYPVE+
Sbjct  315  IAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEF  374



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A PREV +K+   P+P    F+ D ++ L+ D VVS DA+   DLG+  HK+ G  +E+
Sbjct  311  LAMPREVAMKR-GIPIPFSPTFSKDYLDQLSCDLVVSSDAMGLADLGVTSHKIGGLTIEH  369

Query  535  LIQYRKGGPQYGSTVSERVSPESY  464
            L  YR GGP  G+TV E +    +
Sbjct  370  LNAYRTGGPSVGTTVGESIHGAGF  393



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -3

Query  712  ATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYL  533
            A PRE+ +K+   P+P    F+ D ++ L  D +VS+DA+   DLGI  HK+ G  +E+L
Sbjct  324  AMPRELAMKR-GIPIPFSPSFSKDYLDQLACDLIVSQDAMGLADLGITSHKIGGLTIEHL  382

Query  532  IQYRKGGPQYGSTVSERVSPESY  464
              YR GGP  G+TV E V    +
Sbjct  383  NAYRTGGPSVGTTVGESVHGAGF  405



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            ++  RE   K+VP PLP         I++L  D VVS DALTF++LGI P  L G   EY
Sbjct  278  VSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATEY  337

Query  535  LIQYRKGGPQYGS  497
            L  YR+GGP  G 
Sbjct  338  LFYYREGGPHMGQ  350



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            ++  RE   K+VP PLP         I++L  D VVS DALTF++LGI P  L G   EY
Sbjct  287  VSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATEY  346

Query  535  LIQYRKGGPQYGS  497
            L  YR+GGP  G 
Sbjct  347  LFYYREGGPHMGQ  359



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  556  KGYPVEYLIQYRKGGPQYGSTVSERVSPESYP  461
            +GYPVEYLIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  203  EGYPVEYLIQYRKGGPQFGSTVSEKVNPDSYP  234



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLK-GYPVE  539
            ++ P E LL++VPFP+PTP       I+A + D V   D+L F DLGI P+ ++ GY ++
Sbjct  279  LSCPHEWLLRRVPFPMPTPLGLTRSYIDAQSRDYVKRADSLGFSDLGIEPNNIENGYVLD  338

Query  538  YLIQYRKGGPQYG  500
            YL  +R GG Q G
Sbjct  339  YLRSFRAGGYQVG  351



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA  596
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ 
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENG  355



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA  596
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ 
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENG  355



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +A P E LL +VPFPLPTP+      I+A   D +    +  F +LGIVP KL+G  ++Y
Sbjct  274  LAAPHEFLLNRVPFPLPTPTGLTRSYIDAQGEDYLKDPKSEGFKELGIVPAKLEGVVIDY  333

Query  535  LIQYRKGGPQYGSTVSE  485
            L  +R GG   G+T  +
Sbjct  334  LRAFRFGGYDVGATAGQ  350



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLK-GYPVE  539
            ++ P E LL+KVPFP+PTP       I+A + D V + D L F DLGI P+ ++ GY ++
Sbjct  278  LSCPHEFLLRKVPFPMPTPVGLTRSYIDAQSRDYVKAPDTLGFSDLGIDPNDIENGYVLD  337

Query  538  YLIQYRKGGPQYGSTVSER  482
            YL  +R GG   G    E+
Sbjct  338  YLRSFRAGGYALGEAPWEQ  356



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            ++ P E LL +VPFPLPTP       ++A   D V   + L F +LG+ P K+ G  ++Y
Sbjct  343  LSAPHEFLLNRVPFPLPTPKGLTRSFVDAQDADYVKKPNELGFKELGMTPAKMDGITIDY  402

Query  535  LIQYRKGG  512
            L  YR GG
Sbjct  403  LRSYRSGG  410



>ref|XP_005651289.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26745.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=378

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKL-KGYPVE  539
            +A PRE L K   FP+P  ++F  D IE +T D V+  + LT+ DL +VP K+ +G+P+E
Sbjct  293  LAVPREKLFKM--FPIPVNTMFTADYIEEMTQDHVLPPNVLTYADLEVVPKKVTEGFPIE  350

Query  538  YLIQYRKGG  512
            +L  YR GG
Sbjct  351  HLRHYRVGG  359



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -3

Query  715  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  536
            +  P E LL+KVPFPLPTP+      I+A + + + +     F+ LGI P KL+G  ++Y
Sbjct  308  LGAPHEFLLRKVPFPLPTPTGLTKSYIDAQSVNYLKNPRVPGFEQLGIKPAKLEGVVIDY  367

Query  535  LIQYRKGGPQYG  500
            L  +R GG   G
Sbjct  368  LRAFRFGGYDAG  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410