BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016E05

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29082.1|  hypothetical protein JCGZ_16471                         367   5e-125   Jatropha curcas
emb|CAL25349.1|  elongation factor 1 alpha                              364   8e-125   Platanus x hispanica [London plane tree]
ref|XP_002539209.1|  elongation factor 1-alpha, putative                368   9e-125   Ricinus communis
ref|XP_002518072.1|  elongation factor 1-alpha, putative                368   9e-125   Ricinus communis
gb|AGZ15393.1|  elongation factor 1-alpha                               368   1e-124   Phaseolus vulgaris [French bean]
gb|ADC68236.1|  elongation factor 1-alpha                               364   4e-124   Dendrobium nobile
dbj|BAO57272.1|  elongation factor 1-alpha                              372   4e-124   Ipomoea nil [qian niu]
gb|ABV26710.1|  elongation factor 1 alpha                               371   9e-124   Gerbera hybrid cultivar
ref|XP_002528020.1|  elongation factor 1-alpha, putative                367   1e-123   
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             370   1e-123   Citrus clementina [clementine]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  370   1e-123   Citrus sinensis [apfelsine]
dbj|BAN42601.1|  putative elongation factor 1-alpha                     361   2e-123   Pyrus pyrifolia var. culta [Asian pear]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         368   2e-123   Jatropha curcas
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               369   4e-123   Elaeis guineensis
emb|CAL07988.1|  translation elongation factor 1 alpha                  361   4e-123   Platanus x hispanica [London plane tree]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                369   5e-123   Ricinus communis
gb|AGZ90153.1|  elongation factor 1-alpha                               361   5e-123   Litsea cubeba [may chang]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    363   6e-123   
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               368   8e-123   Elaeis guineensis
dbj|BAN42602.1|  putative elongation factor 1-alpha                     359   9e-123   Pyrus pyrifolia var. culta [Asian pear]
gb|AAL69396.1|  elongation factor 1-alpha                               368   1e-122   Elaeis oleifera
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          368   1e-122   Phoenix dactylifera
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         368   1e-122   Jatropha curcas
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    362   1e-122   
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          367   2e-122   Nicotiana sylvestris
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             367   2e-122   Phaseolus vulgaris [French bean]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         367   2e-122   Jatropha curcas
ref|XP_002528028.1|  elongation factor 1-alpha, putative                367   2e-122   
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          367   2e-122   Nicotiana tomentosiformis
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          367   2e-122   Nicotiana sylvestris
gb|AGH32502.1|  translation elongation factor-1 alpha                   367   2e-122   Stylosanthes guianensis [stylo]
gb|AGT16628.1|  elongation factor 1 alpha                               365   3e-122   Saccharum hybrid cultivar R570
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    367   3e-122   
gb|ABA12225.1|  translation elongation factor 1A-9                      367   3e-122   Gossypium hirsutum [American cotton]
gb|AFJ04514.1|  elongation factor 1-alpha                               367   3e-122   Vernicia fordii [tung oil tree]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          367   3e-122   Elaeis guineensis
gb|KHG26926.1|  Elongation factor 1-alpha                               367   3e-122   Gossypium arboreum [tree cotton]
gb|AFY06644.1|  elongation factor 1-alpha                               363   3e-122   Carica papaya [mamon]
gb|AGH55661.1|  elongation factor 1-alpha                               362   4e-122   Atropa belladonna [deadly nightshade]
gb|KHG24249.1|  Elongation factor 1-alpha                               365   4e-122   Gossypium arboreum [tree cotton]
gb|AAN77897.1|  elongation factor 1 alpha                               366   5e-122   Stevia rebaudiana
gb|ABA12221.1|  translation elongation factor 1A-5                      366   5e-122   Gossypium hirsutum [American cotton]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          366   6e-122   Setaria italica
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               366   6e-122   Nicotiana tomentosiformis
gb|KHG27341.1|  Elongation factor 1-alpha                               366   6e-122   Gossypium arboreum [tree cotton]
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   361   6e-122   Gossypium raimondii
gb|AHE76183.1|  elongation factor 1-alpha                               366   6e-122   Chrysanthemum indicum
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    366   8e-122   Nicotiana tabacum [American tobacco]
dbj|BAC66180.1|  elongation factor 1A                                   366   8e-122   Avicennia marina
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          366   8e-122   Phoenix dactylifera
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               366   8e-122   Phoenix dactylifera
dbj|BAH56641.1|  elongation factor 1a                                   362   1e-121   Nelumbo nucifera [Indian lotus]
gb|KHG23927.1|  Elongation factor 1-alpha                               365   1e-121   Gossypium arboreum [tree cotton]
gb|ABU63160.1|  elongation factor                                       365   1e-121   Saccharum officinarum [noble cane]
gb|ABD66072.1|  elongation factor 1-alpha                               358   1e-121   Phoenix dactylifera
gb|AAL79775.1|  elongation factor 1 alpha                               365   1e-121   Saccharum hybrid cultivar CP72-2086
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               365   1e-121   Tarenaya hassleriana [spider flower]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        365   1e-121   Hevea brasiliensis [jebe]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               365   1e-121   Nicotiana sylvestris
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               365   1e-121   Eucalyptus grandis [rose gum]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    362   1e-121   
gb|KJB76528.1|  hypothetical protein B456_012G093800                    365   2e-121   Gossypium raimondii
gb|AEN79476.1|  elongation factor 1-alpha                               365   2e-121   Ziziphus jujuba [Chinese jujube]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          365   2e-121   Solanum tuberosum [potatoes]
gb|AGT16893.1|  elongation factor 1-alpha                               365   2e-121   Saccharum hybrid cultivar R570
gb|AAC15413.1|  translation elongation factor-1 alpha                   365   2e-121   Oryza sativa Japonica Group [Japonica rice]
gb|KHN18669.1|  Elongation factor 1-alpha                               365   2e-121   Glycine soja [wild soybean]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     365   2e-121   Saccharum hybrid cultivar CP65-357
gb|ACR38047.1|  unknown                                                 365   2e-121   Zea mays [maize]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          365   2e-121   Eucalyptus grandis [rose gum]
gb|ABA12218.1|  translation elongation factor 1A-2                      365   2e-121   Gossypium hirsutum [American cotton]
emb|CDX70032.1|  BnaA10g23810D                                          361   2e-121   
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   360   2e-121   Gossypium raimondii
dbj|BAL14665.1|  elongation factor 1-alpha                              365   2e-121   Chrysanthemum seticuspe f. boreale
gb|KJB48746.1|  hypothetical protein B456_008G084000                    363   2e-121   Gossypium raimondii
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        365   2e-121   Hevea brasiliensis [jebe]
ref|NP_001152668.1|  LOC100286309                                       365   2e-121   Zea mays [maize]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               365   2e-121   Nicotiana tomentosiformis
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          365   2e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          364   3e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049145.1|  Os03g0177400                                       364   3e-121   
gb|AIX10769.1|  elongation factor 1 alpha                               364   3e-121   Panax notoginseng [san-qi]
ref|NP_001234035.1|  elongation factor 1-alpha                          364   3e-121   Solanum lycopersicum
dbj|BAA34348.1|  elongation factor-1 alpha                              364   3e-121   Nicotiana paniculata
gb|AIZ68131.1|  translation elongation factor 1-alpha                   364   3e-121   Ornithogalum longebracteatum [sea-onion]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     364   3e-121   Glycine max [soybeans]
gb|AFC88830.1|  putative elongation factor 1-alpha                      364   3e-121   Miscanthus sinensis
dbj|BAA23658.1|  EF-1 alpha                                             364   3e-121   Oryza sativa [red rice]
ref|NP_001290506.1|  elongation factor 1-alpha                          364   3e-121   Elaeis guineensis
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          364   3e-121   Eucalyptus grandis [rose gum]
gb|KHG20498.1|  Elongation factor 1-alpha                               364   3e-121   Gossypium arboreum [tree cotton]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          364   4e-121   Oryza brachyantha
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     355   4e-121   Glycine max [soybeans]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            360   4e-121   
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      360   4e-121   Cicer arietinum [garbanzo]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               364   4e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    364   4e-121   Sesamum indicum [beniseed]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     356   4e-121   Vitis vinifera
gb|AID52924.1|  elongation factor 1-alpha                               364   4e-121   Carthamus tinctorius
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          364   4e-121   Tarenaya hassleriana [spider flower]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               364   4e-121   Pyrus x bretschneideri [bai li]
gb|AEI29162.1|  EF1a-like protein                                       362   4e-121   Phalaenopsis hybrid cultivar
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          364   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    364   5e-121   Daucus carota [carrots]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               364   5e-121   Sesamum indicum [beniseed]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          363   5e-121   Elaeis guineensis
gb|KJB48747.1|  hypothetical protein B456_008G084000                    363   6e-121   Gossypium raimondii
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          363   6e-121   Elaeis guineensis
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               363   6e-121   Vitis vinifera
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             363   6e-121   Citrus clementina [clementine]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          363   6e-121   Phoenix dactylifera
gb|AIM48895.1|  elongation factor 1-alpha                               363   7e-121   Cinnamomum camphora
gb|AGV54713.1|  elongation factor 1-alpha                               363   7e-121   Phaseolus vulgaris [French bean]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          363   7e-121   Amborella trichopoda
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    363   7e-121   Eucalyptus grandis [rose gum]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    363   7e-121   
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          363   8e-121   Elaeis guineensis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          363   8e-121   Solanum lycopersicum
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    363   8e-121   Theobroma cacao [chocolate]
gb|AAQ90154.1|  putative translation elongation factor protein          357   8e-121   Solanum tuberosum [potatoes]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             363   9e-121   Eutrema salsugineum [saltwater cress]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       359   9e-121   Cucumis sativus [cucumbers]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    363   9e-121   
ref|NP_001280807.1|  elongation factor 1-alpha-like                     363   1e-120   Malus domestica [apple tree]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          363   1e-120   Tarenaya hassleriana [spider flower]
gb|ABA12219.1|  translation elongation factor 1A-3                      363   1e-120   Gossypium hirsutum [American cotton]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    363   1e-120   Gossypium raimondii
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        363   1e-120   Bruguiera sexangula
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          363   1e-120   Pyrus x bretschneideri [bai li]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          363   1e-120   Zea mays [maize]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             363   1e-120   Populus trichocarpa [western balsam poplar]
gb|ABF00115.1|  elongation factor 1-alpha                               363   1e-120   Litchi chinensis [litchi]
gb|ABS10822.1|  elongation factor 1-alpha                               353   1e-120   Phaseolus vulgaris [French bean]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    362   1e-120   
dbj|BAC23049.1|  Elongation factor 1-alpha                              362   2e-120   Solanum tuberosum [potatoes]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    362   2e-120   Eucalyptus grandis [rose gum]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          362   2e-120   Amborella trichopoda
gb|EPS66340.1|  elongation factor 1-alpha                               362   2e-120   Genlisea aurea
ref|NP_001105587.1|  elongation factor 1-alpha                          362   2e-120   Zea mays [maize]
emb|CDY61938.1|  BnaCnng38780D                                          362   2e-120   Brassica napus [oilseed rape]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          362   2e-120   Populus euphratica
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          362   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA12223.1|  translation elongation factor 1A-7                      362   2e-120   Gossypium hirsutum [American cotton]
emb|CDY22710.1|  BnaC08g43440D                                          361   2e-120   Brassica napus [oilseed rape]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          362   2e-120   
gb|ACG34498.1|  elongation factor 1-alpha                               362   2e-120   Zea mays [maize]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   362   2e-120   Lilium longiflorum [Easter lily]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    362   2e-120   Zea mays [maize]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          362   2e-120   Pyrus x bretschneideri [bai li]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               362   2e-120   Malus domestica [apple tree]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    362   2e-120   Manihot esculenta [manioc]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        362   2e-120   Brassica rapa
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             362   3e-120   Citrus clementina [clementine]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    362   3e-120   Theobroma cacao [chocolate]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        362   3e-120   Brassica rapa
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    362   3e-120   Setaria italica
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             362   3e-120   Brassica rapa
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               362   3e-120   Fragaria vesca subsp. vesca
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          362   3e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADI24333.1|  elongation factor 1-alpha                               362   3e-120   Miscanthus sinensis
gb|ABA12220.1|  translation elongation factor 1A-4                      362   4e-120   Gossypium hirsutum [American cotton]
gb|ABA12224.1|  translation elongation factor 1A-8                      362   4e-120   Gossypium hirsutum [American cotton]
ref|NP_001105933.1|  elongation factor alpha2                           361   4e-120   
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          361   4e-120   
emb|CDX93604.1|  BnaA06g04440D                                          362   4e-120   
gb|AAV92325.1|  translation elongation factor-1 alpha                   354   4e-120   Pseudotsuga menziesii var. menziesii
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       356   4e-120   Cucumis sativus [cucumbers]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          361   4e-120   
ref|NP_001105617.1|  elongation factor alpha3                           361   4e-120   Zea mays [maize]
gb|ABA12217.1|  translation elongation factor 1A-1                      361   4e-120   Gossypium hirsutum [American cotton]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          361   5e-120   
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             361   5e-120   Prunus persica
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          361   5e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         358   5e-120   Medicago truncatula
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               361   5e-120   Tarenaya hassleriana [spider flower]
gb|AAY56337.1|  elongation factor-1 alpha                               361   6e-120   Musa acuminata [banana]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     361   6e-120   Zea mays [maize]
gb|ACG31866.1|  elongation factor 1-alpha                               361   6e-120   Zea mays [maize]
ref|NP_001237425.1|  elongation factor-1A                               361   6e-120   
gb|AFP44110.1|  elongation factor 1-alpha                               361   7e-120   Lycoris longituba
dbj|BAM13877.1|  elongation factor 1 alpha                              361   7e-120   Arum maculatum [cuckoo-pint]
gb|KHG01531.1|  Elongation factor 1-alpha                               361   7e-120   Gossypium arboreum [tree cotton]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    361   7e-120   
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          361   7e-120   Cicer arietinum [garbanzo]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         361   7e-120   
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          361   7e-120   Tarenaya hassleriana [spider flower]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             359   7e-120   Solanum tuberosum [potatoes]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          360   8e-120   Eucalyptus grandis [rose gum]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          360   8e-120   Malus domestica [apple tree]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     360   9e-120   Zea mays [maize]
emb|CAD60652.1|  elongation factor                                      360   9e-120   Solanum tuberosum [potatoes]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          360   9e-120   Nelumbo nucifera [Indian lotus]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               360   9e-120   Fragaria vesca subsp. vesca
gb|EPS66069.1|  elongation factor 1-alpha                               360   9e-120   Genlisea aurea
emb|CDX95108.1|  BnaC05g05630D                                          362   1e-119   
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             360   1e-119   Prunus persica
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          360   1e-119   Amborella trichopoda
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             360   1e-119   Capsella rubella
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             360   1e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          360   1e-119   Populus euphratica
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    360   1e-119   Theobroma cacao [chocolate]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    360   1e-119   Populus euphratica
gb|AGJ50595.1|  EF1alpha                                                360   1e-119   Pericallis cruenta
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             360   1e-119   Prunus persica
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     360   1e-119   Glycine max [soybeans]
emb|CAA34456.1|  elongation factor 1-alpha                              360   1e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200847.1|  elongation factor 1-alpha 4                           360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    360   1e-119   Populus euphratica
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             360   2e-119   Prunus persica
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       356   2e-119   Cucumis sativus [cucumbers]
dbj|BAF02151.1|  elongation factor 1-alpha                              360   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AGY80449.1|  elongation factor 1-alpha                               360   2e-119   Dendrocalamus latiflorus [sweet bamboo]
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  358   2e-119   Solanum tuberosum [potatoes]
gb|AAL57653.1|  At1g07930/T6D22_3                                       360   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               360   2e-119   Prunus mume [ume]
gb|ABD66517.1|  EF-1 alpha                                              360   2e-119   Gymnadenia conopsea
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          356   2e-119   Populus euphratica
gb|ACI96243.1|  elongation factor 1-alpha                               360   2e-119   Prunus persica
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          360   2e-119   Solanum tuberosum [potatoes]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    360   2e-119   Zea mays [maize]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     360   2e-119   Solanum tuberosum [potatoes]
gb|KHN42761.1|  Elongation factor 1-alpha                               359   2e-119   Glycine soja [wild soybean]
gb|ABA12222.1|  translation elongation factor 1A-6                      359   3e-119   Gossypium hirsutum [American cotton]
gb|KHN14872.1|  Elongation factor 1-alpha                               359   3e-119   Glycine soja [wild soybean]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               359   3e-119   Tarenaya hassleriana [spider flower]
gb|ABB86283.1|  elongation factor-1 alpha-like                          359   3e-119   Solanum tuberosum [potatoes]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    359   3e-119   Glycine max [soybeans]
gb|ACS68200.1|  elongation factor 1 alpha                               359   3e-119   Brassica napus [oilseed rape]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             359   3e-119   Phaseolus vulgaris [French bean]
emb|CDY58828.1|  BnaAnng15460D                                          363   3e-119   Brassica napus [oilseed rape]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          359   3e-119   Tarenaya hassleriana [spider flower]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               359   4e-119   Cucumis melo [Oriental melon]
gb|KJB76560.1|  hypothetical protein B456_012G094600                    358   4e-119   Gossypium raimondii
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        359   4e-119   Brassica rapa
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          359   4e-119   Prunus mume [ume]
gb|AAX54511.1|  elongation factor 1 alpha                               359   4e-119   Actinidia deliciosa [Chinese gooseberry]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   359   4e-119   Lilium longiflorum [Easter lily]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  352   4e-119   Plantago major [cart-track plant]
gb|KHG28979.1|  Elongation factor 1-alpha                               358   5e-119   Gossypium arboreum [tree cotton]
gb|AEQ75495.1|  elongation factor 1-alpha                               358   6e-119   Rosa multiflora [Japanese rose]
gb|AGC94754.1|  elongation factor 1 alpha                               358   6e-119   Euphorbia lathyris
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    358   6e-119   Populus euphratica
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    358   6e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               358   6e-119   Cucumis melo [Oriental melon]
gb|KGN51228.1|  Elongation factor 1-alpha                               357   7e-119   Cucumis sativus [cucumbers]
emb|CAA65453.1|  elongation factor                                      350   9e-119   Narcissus pseudonarcissus
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         358   9e-119   Medicago truncatula
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               358   1e-118   Brachypodium distachyon [annual false brome]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         358   1e-118   Medicago truncatula
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               358   1e-118   Vitis vinifera
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             358   1e-118   Solanum tuberosum [potatoes]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    358   1e-118   Glycine max [soybeans]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          358   1e-118   Sesamum indicum [beniseed]
ref|NP_001183947.1|  uncharacterized protein LOC100502553               356   1e-118   
ref|NP_001105935.1|  elongation factor alpha8                           358   1e-118   
ref|XP_003588821.1|  Elongation factor 1-alpha                          358   1e-118   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         358   1e-118   Medicago truncatula
dbj|BAH19898.1|  AT1G07930                                              358   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               357   1e-118   Prunus mume [ume]
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          357   1e-118   Sorghum bicolor [broomcorn]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               357   1e-118   Vitis vinifera
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    361   2e-118   
ref|XP_003604823.1|  Elongation factor 1-alpha                          357   2e-118   
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          357   2e-118   Cucumis sativus [cucumbers]
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              357   2e-118   Capsicum annuum
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   348   2e-118   Gossypium raimondii
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             357   2e-118   Phaseolus vulgaris [French bean]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          357   2e-118   Cucumis sativus [cucumbers]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         357   2e-118   Medicago truncatula
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    357   3e-118   Daucus carota [carrots]
gb|AHB86963.1|  elongation factor 1-alpha                               357   3e-118   Sedum alfredii
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          356   4e-118   Malus domestica [apple tree]
gb|AAL32631.1|  putative elongation factor 1-a                          356   5e-118   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM13874.1|  elongation factor 1 alpha                              356   5e-118   Symplocarpus renifolius
ref|NP_001151074.1|  elongation factor 1-alpha                          356   5e-118   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    356   6e-118   
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    356   6e-118   
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          356   7e-118   
ref|XP_003591959.1|  Elongation factor 1-alpha                          360   7e-118   
ref|NP_001105565.1|  elongation factor alpha5                           355   8e-118   
gb|AAF99703.1|  elongation factor                                       355   1e-117   
gb|AGI15328.1|  elongation factor 1                                     355   1e-117   
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            345   2e-117   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             354   2e-117   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          354   2e-117   
gb|ADK73624.1|  elongation factor 1 alpha                               349   2e-117   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   354   3e-117   
emb|CAC27139.1|  translation elongation factor-1 alpha                  354   4e-117   
gb|KHG15275.1|  Elongation factor 1-alpha                               353   4e-117   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             354   4e-117   
gb|ACN40081.1|  unknown                                                 353   5e-117   
gb|ABK25072.1|  unknown                                                 353   6e-117   
gb|ACN41180.1|  unknown                                                 353   6e-117   
gb|ACF81592.1|  unknown                                                 343   6e-117   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        353   6e-117   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        353   8e-117   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               353   9e-117   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          353   1e-116   
gb|ADW83729.1|  elongation factor 1-alpha                               343   1e-116   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             353   1e-116   
ref|XP_002312029.1|  ADR12-2 family protein                             353   1e-116   
ref|XP_002311107.1|  ADR12-2 family protein                             353   1e-116   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             352   1e-116   
gb|EMS49772.1|  Elongation factor 1-alpha                               352   1e-116   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    352   1e-116   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             352   1e-116   
gb|AER42621.1|  elongation factor 1 alpha                               352   2e-116   
ref|NP_001104939.1|  elongation factor alpha6                           352   3e-116   
gb|ABK24265.1|  unknown                                                 352   3e-116   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                351   4e-116   
gb|EMT12343.1|  Elongation factor 1-alpha                               351   4e-116   
ref|XP_002311106.1|  ADR12-2 family protein                             351   5e-116   
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  351   5e-116   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             351   5e-116   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             351   5e-116   
ref|NP_001104938.1|  elongation factor 1 alpha                          351   6e-116   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          351   6e-116   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    350   8e-116   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    350   1e-115   
gb|ABK24843.1|  unknown                                                 350   1e-115   
gb|ACN40740.1|  unknown                                                 350   1e-115   
gb|EMS52529.1|  Elongation factor 1-alpha                               350   1e-115   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 350   1e-115   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                350   2e-115   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    350   2e-115   
gb|EMS59091.1|  Elongation factor 1-alpha                               351   2e-115   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         348   2e-115   
dbj|BAF75826.1|  hypothetical protein                                   340   2e-115   
dbj|BAF75825.1|  hypothetical protein                                   340   3e-115   
gb|ABW74483.1|  elongation factor                                       340   3e-115   
dbj|BAH20400.1|  AT1G07940                                              340   3e-115   
gb|AGO97079.1|  elongation factor 1-alpha                               340   3e-115   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        349   3e-115   
gb|AHA84124.1|  elongation factor 1-alpha                               348   5e-115   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    362   8e-115   
ref|NP_001105934.1|  elongation factor alpha7                           348   1e-114   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   347   1e-114   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         347   1e-114   
gb|ABR17675.1|  unknown                                                 347   3e-114   
gb|AGO97080.1|  elongation factor 1-alpha                               337   3e-114   
ref|XP_002892424.1|  T6D22.2                                            360   3e-114   
ref|XP_001763198.1|  predicted protein                                  343   3e-114   
ref|XP_003604587.1|  Elongation factor 1-alpha                          346   4e-114   
gb|AAF79822.1|AC026875_2  T6D22.2                                       360   6e-114   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 345   7e-114   
gb|AEE98364.1|  elongation factor 1-alpha                               345   9e-114   
gb|EMS65134.1|  Elongation factor 1-alpha                               350   2e-113   
ref|XP_001766482.1|  predicted protein                                  344   3e-113   
gb|AGO97078.1|  elongation factor 1-alpha                               334   4e-113   
ref|XP_001753167.1|  predicted protein                                  343   6e-113   
ref|XP_001763201.1|  predicted protein                                  343   8e-113   
ref|XP_001753181.1|  predicted protein                                  343   8e-113   
gb|EMT09703.1|  Elongation factor 1-alpha                               352   9e-113   
ref|XP_001763194.1|  predicted protein                                  343   9e-113   
gb|AGI78242.1|  elongation factor 1 alpha                               342   1e-112   
ref|XP_003618775.1|  Elongation factor 1-alpha                          357   2e-112   
ref|XP_001753059.1|  predicted protein                                  341   5e-112   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    357   5e-112   
gb|AHZ58493.1|  translation elongation factor alpha                     340   1e-111   
gb|ABQ81942.1|  elongation factor 1-alpha                               331   3e-111   
gb|ABQ81936.1|  elongation factor 1-alpha                               338   5e-111   
dbj|BAK08744.1|  elongation factor 1-alpha                              338   9e-111   
dbj|BAK08818.1|  elongation factor 1-alpha                              337   1e-110   
gb|AFN42763.1|  elongation factor 1-alpha                               330   2e-110   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    327   2e-110   
dbj|BAK08819.1|  elongation factor 1-alpha                              337   2e-110   
gb|AAO61852.1|  translation elongation factor-1 alpha                   330   2e-108   
dbj|BAH23674.1|  elongation factor 1-alpha                              321   8e-108   
gb|ABL10112.1|  translation elongation factor 1-alpha                   317   2e-106   
gb|AAV34150.1|  EF-1 alpha                                              315   5e-105   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    315   3e-104   
gb|AAR83865.1|  elongation factor 1-alpha                               310   4e-104   
gb|ACT36602.1|  elongation factor 1 alpha                               316   2e-103   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     317   5e-103   
ref|XP_005650451.1|  translation elongation factor                      317   8e-103   
gb|ACO50109.1|  elongation factor 1 alpha                               311   1e-102   
gb|ACL97366.1|  elongation factor-1 alpha                               316   1e-102   
gb|ABQ81935.1|  elongation factor 1-alpha                               316   2e-102   
gb|ACO50110.1|  elongation factor 1 alpha                               313   2e-101   
gb|ACL97363.1|  elongation factor-1 alpha                               313   2e-101   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             312   3e-101   
gb|AFB18314.1|  translation elongation factor-1 alpha                   311   5e-101   
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          306   5e-101   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             308   2e-100   
gb|ABD98043.1|  elongation factor 1 alpha subunit                       300   2e-99    
gb|ACL97367.1|  elongation factor-1 alpha                               308   2e-99    
gb|EEE58429.1|  hypothetical protein OsJ_09630                          308   2e-99    
emb|CCA22726.1|  PREDICTED: hypothetical protein                        308   3e-99    
gb|ACO50115.1|  elongation factor 1 alpha                               306   8e-99    
emb|CCI49302.1|  unnamed protein product                                306   2e-98    
emb|CAA40028.1|  42Sp48                                                 302   2e-98    
gb|ABB46371.1|  elongation factor-1 alpha                               297   2e-98    
gb|AEG78376.1|  elongation factor 1 alpha                               298   2e-98    
gb|ABR13275.1|  putative elongation factor-1 alpha 3                    296   3e-98    
gb|ABR16818.1|  unknown                                                 296   3e-98    
dbj|BAN14716.1|  elongation factor 1-alpha                              296   3e-98    
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       305   5e-98    
gb|EJW73271.1|  elongation factor 1-alpha                               299   8e-98    
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    299   1e-97    
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     297   2e-97    
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     304   2e-97    
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          300   2e-97    
gb|AAH65761.1|  EEF1A1 protein                                          296   2e-97    
emb|CDH51884.1|  elongation factor 1-alpha                              297   2e-97    
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       303   2e-97    
gb|KHN88882.1|  Elongation factor 1-alpha                               303   3e-97    
emb|CCW70819.1|  unnamed protein product                                296   3e-97    
gb|AIM46989.1|  translation elongation factor 1-alpha                   303   3e-97    
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             303   3e-97    
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    303   3e-97    
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  303   3e-97    
ref|XP_006794564.1|  PREDICTED: elongation factor 1-alpha-like          295   3e-97    
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         296   3e-97    
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             303   4e-97    
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    300   4e-97    
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    303   5e-97    
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        303   5e-97    
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             303   5e-97    
gb|AJP77649.1|  elongation factor 1-alpha                               295   5e-97    
ref|XP_003380597.1|  elongation factor 1-alpha                          305   5e-97    
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   303   5e-97    
gb|AGT48259.1|  elongation factor 1-alpha                               303   6e-97    
emb|CAB59358.1|  translation elongation factor eEF-1 alpha chain        303   6e-97    
gb|EJW86012.1|  translation elongation factor EF-1                      301   7e-97    
gb|AAH63511.1|  EEF1A1 protein                                          296   7e-97    
gb|ETL93490.1|  elongation factor 1-alpha 2                             293   8e-97    
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   302   8e-97    
gb|ADB55729.1|  elongation factor 1-alpha                               303   9e-97    
gb|AAH14377.1|  Unknown (protein for IMAGE:4041545)                     296   1e-96    
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form             302   1e-96    
ref|XP_005405386.1|  PREDICTED: elongation factor 1-alpha 1             296   1e-96    
dbj|BAG65087.1|  unnamed protein product                                296   1e-96    
dbj|BAE88353.1|  unnamed protein product                                296   1e-96    
gb|KFG40151.1|  elongation factor 1-alpha                               295   2e-96    
gb|AAA52367.1|  elongation factor 1-alpha                               297   2e-96    
gb|ADO51768.1|  elongation factor 1-alpha                               301   2e-96    
dbj|BAH28836.1|  elongation factor 1-alpha                              301   2e-96    
gb|AEV12206.1|  elongation factor 1-alpha                               298   2e-96    
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          294   2e-96    
ref|XP_003141904.1|  elongation factor 1-alpha                          300   2e-96    
gb|AAB65435.1|  elongation factor 1 alpha                               296   2e-96    
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1             301   2e-96    
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    300   2e-96    
gb|AAH22412.1|  Unknown (protein for IMAGE:4134193)                     294   2e-96    
ref|XP_003144331.1|  eukaryotic translation elongation factor 1A        301   3e-96    
ref|XP_001893409.1|  elongation factor 1-alpha                          301   3e-96    
emb|CDQ04680.1|  Protein Bm5196, isoform a                              300   3e-96    
gb|AAN09722.1|AF328730_1  CTCL tumor antigen HD-CL-08                   297   3e-96    
ref|XP_009965335.1|  PREDICTED: elongation factor 1-alpha 1             296   3e-96    
gb|AGW84083.1|  elongation factor 1-alpha                               297   3e-96    
gb|ACL97369.1|  elongation factor-1 alpha                               298   4e-96    
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  300   4e-96    
gb|AAR82894.1|  elongation factor 1-alpha                               300   4e-96    
gb|KFV51009.1|  Elongation factor 1-alpha 1                             296   4e-96    
emb|CBY16376.1|  unnamed protein product                                293   4e-96    
emb|CBY85304.1|  eukaryotic translation elongation factor 1 alpha 1     299   5e-96    
ref|XP_008606624.1|  elongation factor 1-alpha 1                        300   5e-96    
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         295   5e-96    
emb|CDQ71533.1|  unnamed protein product                                293   5e-96    
gb|EPR56707.1|  elongation factor 1-alpha                               294   5e-96    
emb|CAA37169.1|  elongation factor 1-alpha (454 AA)                     300   5e-96    
sp|P17508.2|EF1A3_XENLA  RecName: Full=Elongation factor 1-alpha,...    300   6e-96    
gb|KDO24362.1|  elongation factor 1-alpha 1                             298   6e-96    
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    300   6e-96    
gb|AIM46986.1|  translation elongation factor 1-alpha                   300   6e-96    
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    300   6e-96    
ref|XP_010779184.1|  PREDICTED: elongation factor 1-alpha               300   6e-96    
gb|ACJ61697.1|  translation elongation factor-1 alpha                   292   7e-96    
gb|KIO31120.1|  hypothetical protein M407DRAFT_241866                   300   7e-96    
gb|AEU59990.1|  elongation factor 1 alpha                               290   7e-96    
gb|EPY33803.1|  elongation factor 1-alpha                               295   7e-96    
sp|P14963.1|EF1A_EUGGR  RecName: Full=Elongation factor 1-alpha; ...    299   7e-96    
ref|XP_003873869.1|  elongation factor 1-alpha                          291   7e-96    
ref|XP_007079072.1|  PREDICTED: elongation factor 1-alpha, oocyte...    296   7e-96    
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             300   7e-96    
gb|EPQ10000.1|  Elongation factor 1-alpha 1                             295   7e-96    
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             300   8e-96    
gb|EPY25861.1|  elongation factor 1-alpha                               296   8e-96    
emb|CDP93912.1|  Protein Bm5195, isoform g                              300   8e-96    
gb|ADK90073.1|  elongation factor 1 alpha                               299   8e-96    
ref|XP_007762783.1|  translation elongation factor 1a                   300   8e-96    
ref|XP_822464.1|  elongation factor 1-alpha                             296   9e-96    
gb|AAK93966.1|AF397403_1  translation elongation factor 1 alpha 1...    297   9e-96    
ref|XP_002392294.1|  hypothetical protein MPER_08150                    294   1e-95    
gb|EFQ26666.1|  translation elongation factor EF-1                      299   1e-95    
gb|AEE62879.1|  unknown                                                 299   1e-95    
ref|XP_011149357.1|  PREDICTED: elongation factor 1-alpha               299   1e-95    
gb|AGJ98461.1|  elongation factor 1-alpha                               299   1e-95    
gb|AIZ09099.1|  elongation factor 1-alpha                               291   1e-95    
gb|AEB31334.1|  elongation factor 1-alpha                               299   1e-95    
ref|NP_956303.1|  eukaryotic translation elongation factor 1 alph...    299   1e-95    
ref|XP_010786582.1|  PREDICTED: elongation factor 1-alpha 1             299   1e-95    
ref|XP_009938302.1|  PREDICTED: elongation factor 1-alpha 1             298   1e-95    
ref|XP_009504352.1|  PREDICTED: elongation factor 1-alpha 1             298   1e-95    
ref|XP_009082171.1|  PREDICTED: elongation factor 1-alpha 1             298   1e-95    
ref|XP_001896880.1|  elongation factor 1-alpha (EF-1-alpha)             301   1e-95    
gb|AGG40755.1|  elongation factor 1-alpha                               291   1e-95    



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   367 bits (941),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  53   GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  112

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  113  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  172

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  173  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  232

Query  167  DPTG  156
            DP+G
Sbjct  233  DPSG  236



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   364 bits (935),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  5    GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  64

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  65   VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  124

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  125  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  184

Query  167  DPTG  156
            DP+G
Sbjct  185  DPSG  188



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   368 bits (944),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  99   GRVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  159  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DP+G
Sbjct  279  DPSG  282



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   368 bits (944),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  99   GRVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  159  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DP+G
Sbjct  279  DPSG  282



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   368 bits (945),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  99   GRVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  159  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DPTG
Sbjct  279  DPTG  282



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   364 bits (934),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  45   GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  104

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTKIDRRSG
Sbjct  105  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSG  164

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PT+PMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  165  KELEKEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  224

Query  167  DPTG  156
            DPTG
Sbjct  225  DPTG  228



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   372 bits (954),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   371 bits (952),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  152  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  211

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  212  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  271

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  272  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  331

Query  167  DPTG  156
            DP+G
Sbjct  332  DPSG  335



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA+NFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA+NFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   361 bits (926),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+ EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  7    GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMLEALPGDNVGFNVKNVAVKDLKRGY  66

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  67   VASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSG  126

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  127  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  186

Query  167  DPTG  156
            DPTG
Sbjct  187  DPTG  190



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  205  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  265  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  325  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  384

Query  167  DPTG  156
            DP+G
Sbjct  385  DPSG  388



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   369 bits (947),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            D +G
Sbjct  433  DASG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   361 bits (927),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVV FGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  42   GRVETGVLKPGMVVAFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  101

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  102  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  161

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  162  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  221

Query  167  DPTG  156
            DP+G
Sbjct  222  DPSG  225



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  45   GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  104

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  105  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  164

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  165  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  224

Query  167  DPTG  156
            DP+G
Sbjct  225  DPSG  228



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   363 bits (932),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  99   GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  159  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DPTG
Sbjct  279  DPTG  282



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   368 bits (945),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   359 bits (922),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  7    GRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  66

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  67   VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  126

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPT+PMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  127  KEIEKEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  186

Query  167  DPTG  156
            DP+G
Sbjct  187  DPSG  190



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANF +QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   362 bits (929),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  99   GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  159  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DP+G
Sbjct  279  DPSG  282



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA+NFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA+NFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   365 bits (938),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  205  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  265  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  325  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  384

Query  167  DPTG  156
            DPTG
Sbjct  385  DPTG  388



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   367 bits (942),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE++QEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESMQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   367 bits (942),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   367 bits (941),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  252  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  311

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  312  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  371

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  372  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  431

Query  167  DPTG  156
            DP+G
Sbjct  432  DPSG  435



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   367 bits (942),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   367 bits (942),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   363 bits (931),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  140  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  199

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  200  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  259

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  260  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKNVEKK  319

Query  167  DPTG  156
            DP+G
Sbjct  320  DPSG  323



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   362 bits (930),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  140  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  199

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFA ++TKIDRRSG
Sbjct  200  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAXILTKIDRRSG  259

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  260  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  319

Query  167  DPTG  156
            DPTG
Sbjct  320  DPTG  323



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   365 bits (937),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  205  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGY  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  265  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  325  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  384

Query  167  DPTG  156
            DP+G
Sbjct  385  DPSG  388



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   366 bits (940),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   366 bits (940),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   361 bits (926),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  106  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  165

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  166  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  225

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  226  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  285

Query  167  DPTG  156
            DPTG
Sbjct  286  DPTG  289



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   366 bits (940),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   366 bits (939),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   366 bits (939),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGY
Sbjct  253  GRVETGMLKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +P+G
Sbjct  433  EPSG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   366 bits (939),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   366 bits (939),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LK GMVVTFGPSGLTTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  172  GRVETGILKAGMVVTFGPSGLTTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGF  231

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  232  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  291

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  292  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKK  351

Query  167  DPTG  156
            DPTG
Sbjct  352  DPTG  355



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   358 bits (919),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  64   GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  123

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++T+IDRRSG
Sbjct  124  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTEIDRRSG  183

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLK+GDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  184  KELEKEPKFLKSGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  243

Query  167  DP  162
            DP
Sbjct  244  DP  245



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  247  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  306

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  307  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  366

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  367  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  426

Query  167  DPTG  156
            DPTG
Sbjct  427  DPTG  430



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAATFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  152  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  211

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  212  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  271

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  272  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  331

Query  167  DPTG  156
            DPTG
Sbjct  332  DPTG  335



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELE+EPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  148  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  207

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  208  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  267

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  268  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  327

Query  167  DPTG  156
            DPTG
Sbjct  328  DPTG  331



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   360 bits (924),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  128  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  187

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  188  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  247

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  248  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  307

Query  167  DPTG  156
            DPTG
Sbjct  308  DPTG  311



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  205  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDD AK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  265  VASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  325  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  384

Query  167  DPTG  156
            DPTG
Sbjct  385  DPTG  388



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  255  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  314

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  315  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  374

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  375  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  434

Query  167  DPTG  156
            DPTG
Sbjct  435  DPTG  438



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   355 bits (910),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = -1

Query  692  GVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNS  513
            GVLKPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNS
Sbjct  4    GVLKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNS  63

Query  512  KDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEK  333
            KDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEK
Sbjct  64   KDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEK  123

Query  332  EPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  156
            EPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  124  EPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   360 bits (923),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  129  GRVETGLIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  188

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  189  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  248

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  249  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  308

Query  167  DPTG  156
            DPTG
Sbjct  309  DPTG  312



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   360 bits (923),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPG++VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  132  GRVETGVIKPGVIVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  191

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  192  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  251

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  252  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  311

Query  167  DPTG  156
            DPTG
Sbjct  312  DPTG  315



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSK+DPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKEDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   356 bits (913),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHE+L E LPGDNVGFNVKNVAVKDLKRG+
Sbjct  32   GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHESLVEGLPGDNVGFNVKNVAVKDLKRGF  91

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSG
Sbjct  92   VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSG  151

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  152  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  211

Query  167  DPTG  156
            DP+G
Sbjct  212  DPSG  215



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +PTG
Sbjct  433  EPTG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   362 bits (929),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPG+VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  204  GRVETGXLKPGIVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  263

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  264  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  323

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  324  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKK  383

Query  167  DPTG  156
            DPTG
Sbjct  384  DPTG  387



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMVPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   363 bits (933),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK A +FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  232  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  291

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDD AK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  292  VASNSKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  351

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  352  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  411

Query  167  DPTG  156
            DPTG
Sbjct  412  DPTG  415



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL++KIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLSKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEY PLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AIM48895.1| elongation factor 1-alpha, partial [Cinnamomum camphora]
Length=432

 Score =   363 bits (931),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRG+
Sbjct  244  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGF  303

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  304  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  363

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  364  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  423

Query  167  DPTG  156
            DPTG
Sbjct  424  DPTG  427



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   363 bits (933),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF EYPP GRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFFEYPPFGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   363 bits (933),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGLLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   363 bits (932),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGD+G VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   363 bits (932),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGD+G VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   363 bits (932),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   363 bits (932),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   363 bits (932),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGMLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGD+G VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   357 bits (917),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  92   GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  151

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  152  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  211

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  212  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  271

Query  167  DPTG  156
            DPTG
Sbjct  272  DPTG  275



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   359 bits (922),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  148  GRVETGIIKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  207

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  208  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  267

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  268  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKAVEKK  327

Query  167  DPTG  156
            D +G
Sbjct  328  DASG  331



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANF +QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGL TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPSGLPTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK A++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +P+G
Sbjct  433  EPSG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELE+EPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEREPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPG+VVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKN AVKDLKRG+
Sbjct  252  GRVETGIIKPGIVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNDAVKDLKRGF  311

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+MTKIDRRSG
Sbjct  312  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSG  371

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  372  KELEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  431

Query  167  DPTG  156
            DPTG
Sbjct  432  DPTG  435



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   353 bits (907),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  17   GRVETGVIKPGMLVTFAPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  76

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  77   VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  136

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  137  KEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  196

Query  167  DP  162
            DP
Sbjct  197  DP  198



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGLIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGD+G VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGALKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            D +G
Sbjct  433  DASG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  232  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  291

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  292  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  351

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  352  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  411

Query  167  DPTG  156
            DPTG
Sbjct  412  DPTG  415



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPG+VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGIVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQ IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  231  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  290

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  291  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  350

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  351  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  410

Query  167  DPTG  156
            DPTG
Sbjct  411  DPTG  414



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+ EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +PTG
Sbjct  433  EPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +PTG
Sbjct  433  EPTG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG 
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGI  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   362 bits (928),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSK+DP K AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   362 bits (928),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  264  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  323

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  324  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  383

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  384  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  443

Query  167  DPTG  156
            DPTG
Sbjct  444  DPTG  447



>gb|AAV92325.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92326.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92327.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92328.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92329.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92330.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92331.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92332.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92333.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92334.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92335.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92336.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92337.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92338.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92339.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92340.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92341.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92342.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92343.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92344.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92345.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92346.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92347.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92348.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92349.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92350.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92351.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
Length=247

 Score =   354 bits (908),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPG +VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  53   GRVETGVIKPGTIVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  112

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VAS+SK+DPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKF+E+MTK+DRRSG
Sbjct  113  VASDSKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFSEIMTKVDRRSG  172

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  173  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKK  232

Query  167  DPTG  156
            DPTG
Sbjct  233  DPTG  236



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   356 bits (913),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EA+PGDNVGFNVKNVAVKDLKRG+
Sbjct  99   GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEAVPGDNVGFNVKNVAVKDLKRGF  158

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  159  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  218

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  219  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  278

Query  167  DPTG  156
            DP+G
Sbjct  279  DPSG  282



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   361 bits (927),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVV+FGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVSFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+P+KPMVVETF+ YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPSKPMVVETFAAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   361 bits (927),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   361 bits (927),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   358 bits (918),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  152  GRVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  211

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  212  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  271

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  272  KEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKK  331

Query  167  DPTG  156
            DP+G
Sbjct  332  DPSG  335



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   361 bits (927),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF E PPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFWESPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   361 bits (927),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   361 bits (926),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   361 bits (926),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNS DDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   361 bits (926),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMVPSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPG++VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGVIVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   359 bits (921),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  205  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  265  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  325  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  384

Query  167  DPTG  156
            DPTG
Sbjct  385  DPTG  388



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   360 bits (925),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AA+F SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   360 bits (925),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSV+MHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVKMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LK GMVVTFGP+GLTTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGILKSGMVVTFGPTGLTTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSK+DPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGALKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGY PVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYTPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            D +G
Sbjct  433  DASG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  274  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  333

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  334  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  393

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  394  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  453

Query  167  DPTG  156
            DPTG
Sbjct  454  DPTG  457



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQI NGYAPVLDCHT HIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIANGYAPVLDCHTCHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGLIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSK+DPAK AANFTSQVIIMNHPGQI NGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKEDPAKEAANFTSQVIIMNHPGQISNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKD+KRGY
Sbjct  253  GRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDIKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG LKPGM+VTF P+GLTTEVKSVEMHHE+LQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGTLKPGMLVTFAPTGLTTEVKSVEMHHESLQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAEMLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  136  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGF  195

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRS 
Sbjct  196  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSA  255

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  256  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKK  315

Query  167  DPTG  156
            DPTG
Sbjct  316  DPTG  319



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEV+SVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  205  GRVETGVIKPGMVVTFGPTGLTTEVQSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  264

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  265  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  324

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  325  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  384

Query  167  DPTG  156
            DPTG
Sbjct  385  DPTG  388



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABD66517.1| EF-1 alpha [Gymnadenia conopsea]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GL+TEVKSVEMHHEAL EALPGDNVGFNVKN+AVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLSTEVKSVEMHHEALLEALPGDNVGFNVKNIAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            +P+G
Sbjct  433  EPSG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPG VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  144  GRVETGVIKPGTVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  203

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  204  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  263

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  264  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  323

Query  167  DPT  159
            D +
Sbjct  324  DAS  326



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VAS SKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEAFPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGM+VTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMLVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+K+VDKK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASN KDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMLVTFAPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  231  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  290

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  291  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  350

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  351  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  410

Query  167  DPTG  156
            DPTG
Sbjct  411  DPTG  414



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EA+PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALPEAVPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|KJB76560.1| hypothetical protein B456_012G094600 [Gossypium raimondii]
Length=425

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMV TFGPSGLT EVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  229  GRVETGILKPGMVATFGPSGLTIEVKSVEMHHESLTEALPGDNVGFNVKNVAVKDLKRGY  288

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHP QIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  289  VASNSKDDPAKEAANFTSQVIIMNHPAQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  348

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVI+SV+KK
Sbjct  349  KELEKEPKFLKNGDAGFVKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIESVEKK  408

Query  167  DPTG  156
            DP+G
Sbjct  409  DPSG  412



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
             PTG
Sbjct  433  HPTG  436



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSK+DPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKEDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EA PGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEASPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGD+G VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   352 bits (902),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE++ EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  53   GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESMPEALPGDNVGFNVKNVAVKDLKRGF  112

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  113  VASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSG  172

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  173  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKK  232

Query  167  DPTG  156
            +P+G
Sbjct  233  EPSG  236



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   358 bits (920),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK +EL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKVSELLTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/183 (93%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPT  159
            D +
Sbjct  433  DAS  435



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNVKN AVKDLKRGY
Sbjct  253  GRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNVKNFAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSG
Sbjct  313  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK
Sbjct  373  KEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+
Sbjct  253  GRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGF  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  373  KELEKEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGRFAVRDMRQTVAVGVIKSVEKK  432

Query  167  DPTG  156
            DPTG
Sbjct  433  DPTG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY
Sbjct  206  GRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  265

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AA+FTSQVIIM HPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSG
Sbjct  266  VASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSG  325

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAGFVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSV+KK
Sbjct  326  KELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKK  385

Query  167  DPTG  156
            DP+G
Sbjct  386  DPSG  389



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   350 bits (899),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGVLKPGM+VTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGY
Sbjct  48   GRVETGVLKPGMLVTFAPTGLTTEVKSVEMHHESLLEAHPGDNVGFNVKNVAVKDLKRGY  107

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAV+FAE++TKIDRRSG
Sbjct  108  VASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVRFAEILTKIDRRSG  167

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPP+GRFAVRDMRQTVAVGVIKSV+KK
Sbjct  168  KELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKK  227

Query  167  DPTG  156
            DPTG
Sbjct  228  DPTG  231



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   358 bits (919),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = -1

Query  707  GRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGY  528
            GRVETGV+KPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGY
Sbjct  253  GRVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGY  312

Query  527  VASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSG  348
            VASNSKDDPAK AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSG
Sbjct  313  VASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSG  372

Query  347  KELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKK  168
            KE+EKEPKFLKNGDAG +KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK
Sbjct  373  KEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKK  432

Query  167  DPTG  156
            DP+G
Sbjct  433  DPSG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350