BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016C05

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    231   4e-70   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    235   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    234   5e-69   
emb|CDO98832.1|  unnamed protein product                                232   1e-68   Coffea canephora [robusta coffee]
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             231   8e-68   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    230   1e-67   Eucalyptus grandis [rose gum]
ref|XP_008370617.1|  PREDICTED: pectinesterase                          230   2e-67   
ref|XP_002314364.1|  putative pectinesterase family protein             229   2e-67   Populus trichocarpa [western balsam poplar]
emb|CDO98833.1|  unnamed protein product                                228   4e-67   Coffea canephora [robusta coffee]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    228   5e-67   Populus euphratica
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     226   3e-66   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         226   4e-66   Jatropha curcas
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    226   5e-66   Prunus mume [ume]
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    226   5e-66   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    226   5e-66   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             225   9e-66   Prunus persica
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    225   1e-65   Populus euphratica
ref|XP_002512459.1|  Pectinesterase precursor, putative                 224   2e-65   Ricinus communis
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    224   2e-65   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    224   3e-65   Vitis vinifera
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          223   5e-65   
emb|CDO98834.1|  unnamed protein product                                223   5e-65   Coffea canephora [robusta coffee]
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    224   5e-65   Prunus mume [ume]
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    223   7e-65   Vitis vinifera
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     222   7e-65   Nicotiana sylvestris
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             223   1e-64   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    222   1e-64   Eucalyptus grandis [rose gum]
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     221   2e-64   Sesamum indicum [beniseed]
emb|CBI39537.3|  unnamed protein product                                224   3e-64   Vitis vinifera
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    221   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     220   4e-64   Nicotiana tomentosiformis
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    220   9e-64   Cucumis sativus [cucumbers]
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    221   1e-63   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    219   1e-63   Morus notabilis
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-63   Cucumis melo [Oriental melon]
ref|XP_006382447.1|  pectin methylesterase family protein               218   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     217   7e-63   Nicotiana tomentosiformis
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     216   8e-63   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          216   1e-62   Vitis vinifera
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             216   1e-62   Prunus persica
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    216   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     216   2e-62   Sesamum indicum [beniseed]
emb|CBI22967.3|  unnamed protein product                                222   2e-62   Vitis vinifera
ref|XP_009761202.1|  PREDICTED: pectinesterase                          216   2e-62   Nicotiana sylvestris
emb|CAN77092.1|  hypothetical protein VITISV_026596                     214   2e-62   Vitis vinifera
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    217   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    215   5e-62   Morus notabilis
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     214   5e-62   Solanum lycopersicum
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             215   5e-62   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   215   6e-62   Citrus sinensis [apfelsine]
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             215   6e-62   Prunus persica
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    214   7e-62   Solanum tuberosum [potatoes]
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    215   7e-62   Citrus sinensis [apfelsine]
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             214   1e-61   Capsella rubella
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    218   1e-61   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    215   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    209   2e-61   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    213   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    213   3e-61   Prunus mume [ume]
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    213   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    213   4e-61   Prunus mume [ume]
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    213   5e-61   Cucumis sativus [cucumbers]
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    213   5e-61   Populus euphratica
emb|CDY71928.1|  BnaCnng75130D                                          207   5e-61   Brassica napus [oilseed rape]
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    211   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    212   1e-60   Cucumis melo [Oriental melon]
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             211   1e-60   Prunus persica
ref|XP_002865716.1|  pectinesterase family protein                      211   1e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    211   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_002516960.1|  Pectinesterase precursor, putative                 211   2e-60   Ricinus communis
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    211   2e-60   Malus domestica [apple tree]
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             210   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             212   3e-60   Capsella rubella
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    208   4e-60   Vitis vinifera
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    212   4e-60   Camelina sativa [gold-of-pleasure]
emb|CDY34927.1|  BnaA01g32580D                                          209   5e-60   Brassica napus [oilseed rape]
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    211   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    209   6e-60   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    210   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    209   8e-60   Prunus mume [ume]
ref|XP_002872255.1|  pectinesterase family protein                      210   1e-59   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    209   1e-59   Tarenaya hassleriana [spider flower]
emb|CDY19737.1|  BnaA09g03900D                                          207   1e-59   Brassica napus [oilseed rape]
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    208   2e-59   Fragaria vesca subsp. vesca
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    210   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    208   2e-59   Arabis alpina [alpine rockcress]
emb|CAN75818.1|  hypothetical protein VITISV_005130                     206   3e-59   Vitis vinifera
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    207   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    207   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             209   4e-59   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    207   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             209   4e-59   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             209   4e-59   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    207   5e-59   Brassica rapa
emb|CDY40719.1|  BnaC03g34350D                                          204   5e-59   Brassica napus [oilseed rape]
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                207   6e-59   Erythranthe guttata [common monkey flower]
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             209   6e-59   
emb|CDX99968.1|  BnaC09g03330D                                          208   7e-59   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    207   7e-59   Nelumbo nucifera [Indian lotus]
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                206   7e-59   Erythranthe guttata [common monkey flower]
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    207   8e-59   Eucalyptus grandis [rose gum]
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         206   8e-59   Jatropha curcas
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     206   9e-59   Nicotiana tomentosiformis
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    208   9e-59   Brassica rapa
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    207   1e-58   Arabis alpina [alpine rockcress]
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    206   1e-58   Brachypodium distachyon [annual false brome]
gb|AAQ21125.1|  pectinesterase                                          196   1e-58   Fragaria x ananassa
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         206   1e-58   Jatropha curcas
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    200   2e-58   
gb|KJB45338.1|  hypothetical protein B456_007G302000                    206   2e-58   Gossypium raimondii
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    206   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    205   3e-58   Prunus mume [ume]
emb|CDY57858.1|  BnaC08g47740D                                          202   3e-58   Brassica napus [oilseed rape]
emb|CDY33925.1|  BnaA02g30620D                                          205   3e-58   Brassica napus [oilseed rape]
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    205   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    205   4e-58   Brassica rapa
ref|XP_007031044.1|  Pectinesterase, putative                           206   4e-58   
gb|KEH15723.1|  pectinesterase                                          196   4e-58   Medicago truncatula
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     203   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             207   4e-58   Capsella rubella
gb|AAF63815.1|  pectin methylesterase, putative                         204   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    204   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    205   5e-58   Nelumbo nucifera [Indian lotus]
dbj|BAC42959.2|  putative pectin methylesterase                         204   5e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24663.1|  BnaA05g30620D                                          204   6e-58   Brassica napus [oilseed rape]
ref|XP_002884519.1|  pectinesterase family protein                      206   6e-58   
emb|CDO97717.1|  unnamed protein product                                196   6e-58   Coffea canephora [robusta coffee]
emb|CDX71786.1|  BnaC08g30880D                                          203   6e-58   
ref|XP_002882495.1|  pectinesterase family protein                      204   7e-58   Arabidopsis lyrata subsp. lyrata
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    206   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    204   7e-58   Brassica rapa
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     202   8e-58   Phoenix dactylifera
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                204   8e-58   Erythranthe guttata [common monkey flower]
emb|CDX80933.1|  BnaC03g01870D                                          198   9e-58   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             204   9e-58   Prunus persica
gb|KJB38562.1|  hypothetical protein B456_006G260800                    203   1e-57   Gossypium raimondii
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             202   1e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             205   1e-57   Eutrema salsugineum [saltwater cress]
gb|ABZ89800.1|  pectin methylesterase-like protein                      203   1e-57   Taiwania cryptomerioides
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   200   1e-57   
ref|XP_003591164.1|  Pectinesterase                                     203   1e-57   Medicago truncatula
emb|CDY41145.1|  BnaA09g38700D                                          202   1e-57   Brassica napus [oilseed rape]
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    202   1e-57   Brassica rapa
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     203   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             203   2e-57   Eutrema salsugineum [saltwater cress]
emb|CDX74137.1|  BnaA03g29100D                                          204   2e-57   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 201   2e-57   Medicago truncatula
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             202   3e-57   Phaseolus vulgaris [French bean]
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    204   3e-57   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    204   3e-57   Brassica rapa
ref|XP_006361902.1|  PREDICTED: probable pectinesterase/pectinest...    202   3e-57   Solanum tuberosum [potatoes]
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    204   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002876579.1|  pectinesterase family protein                      201   3e-57   
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    201   3e-57   Brassica rapa
dbj|BAC42986.1|  putative pectinesterase                                204   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59322.1|  pectinesterase                                          201   3e-57   Genlisea aurea
emb|CDY05295.1|  BnaC05g45080D                                          202   3e-57   
ref|XP_006361900.1|  PREDICTED: probable pectinesterase/pectinest...    202   4e-57   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                202   5e-57   Erythranthe guttata [common monkey flower]
gb|KEH21378.1|  pectinesterase                                          197   5e-57   Medicago truncatula
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                201   5e-57   Erythranthe guttata [common monkey flower]
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    197   5e-57   Petunia integrifolia [violet-flowered petunia]
ref|XP_003604119.1|  Pectinesterase                                     202   6e-57   
emb|CDX70179.1|  BnaA10g25280D                                          202   6e-57   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     200   7e-57   Elaeis guineensis
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   200   8e-57   Cucumis sativus [cucumbers]
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     192   8e-57   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                205   9e-57   Erythranthe guttata [common monkey flower]
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    202   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009122545.1|  PREDICTED: probable pectinesterase/pectinest...    202   1e-56   Brassica rapa
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    200   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003630894.1|  Pectinesterase                                     195   1e-56   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             201   1e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    199   1e-56   Nicotiana tomentosiformis
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     197   1e-56   Glycine soja [wild soybean]
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             201   1e-56   Capsella rubella
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                201   1e-56   Erythranthe guttata [common monkey flower]
gb|KJB38563.1|  hypothetical protein B456_006G260900                    200   1e-56   Gossypium raimondii
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    200   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    199   1e-56   Nicotiana sylvestris
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    201   2e-56   Elaeis guineensis
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         200   2e-56   Jatropha curcas
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    202   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010271283.1|  PREDICTED: pectinesterase                          199   2e-56   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             200   2e-56   Prunus persica
emb|CDX98808.1|  BnaC09g50270D                                          200   2e-56   
ref|XP_009130852.1|  PREDICTED: probable pectinesterase/pectinest...    201   2e-56   Brassica rapa
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   199   2e-56   Nicotiana sylvestris
ref|XP_004231267.1|  PREDICTED: probable pectinesterase/pectinest...    200   2e-56   Solanum lycopersicum
ref|XP_011046483.1|  PREDICTED: probable pectinesterase/pectinest...    200   2e-56   Populus euphratica
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         199   2e-56   Jatropha curcas
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   199   2e-56   Pyrus x bretschneideri [bai li]
emb|CDY11323.1|  BnaA03g01590D                                          200   2e-56   Brassica napus [oilseed rape]
gb|KFK37147.1|  hypothetical protein AALP_AA4G219300                    198   2e-56   Arabis alpina [alpine rockcress]
ref|XP_010667122.1|  PREDICTED: pectinesterase                          200   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        199   2e-56   
emb|CDY05188.1|  BnaC05g46150D                                          201   3e-56   
gb|KJB30790.1|  hypothetical protein B456_005G160000                    199   3e-56   Gossypium raimondii
ref|XP_006369079.1|  pectinesterase family protein                      191   3e-56   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    201   3e-56   Arabis alpina [alpine rockcress]
ref|XP_006292970.1|  hypothetical protein CARUB_v10019247mg             198   4e-56   Capsella rubella
dbj|BAO02509.1|  predicted pectin esterase ortholog                     199   4e-56   Nicotiana alata [flowering tobacco]
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          198   4e-56   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     199   4e-56   Eucalyptus grandis [rose gum]
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    199   4e-56   Setaria italica
gb|KFK24938.1|  hypothetical protein AALP_AA8G044700                    199   5e-56   Arabis alpina [alpine rockcress]
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 199   5e-56   Medicago truncatula
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   198   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    198   5e-56   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   198   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    199   6e-56   Brassica rapa
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     198   6e-56   Nelumbo nucifera [Indian lotus]
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     198   6e-56   Solanum tuberosum [potatoes]
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               197   6e-56   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             197   7e-56   Phaseolus vulgaris [French bean]
ref|XP_008224789.1|  PREDICTED: pectinesterase                          198   7e-56   Prunus mume [ume]
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     197   7e-56   
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    190   7e-56   
emb|CDY27751.1|  BnaA05g31600D                                          199   8e-56   Brassica napus [oilseed rape]
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        191   8e-56   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    199   8e-56   Brassica rapa
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     198   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_003591166.1|  Pectinesterase                                     199   9e-56   Medicago truncatula
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     198   9e-56   Nicotiana sylvestris
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 197   9e-56   Medicago truncatula
ref|XP_003604120.1|  Pectinesterase                                     199   1e-55   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    197   1e-55   Gossypium arboreum [tree cotton]
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   197   1e-55   Pyrus x bretschneideri [bai li]
gb|AAN84553.1|  methyl pectinesterase                                   189   1e-55   Lolium perenne [perennial ryegrass]
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    198   1e-55   Gossypium arboreum [tree cotton]
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     197   1e-55   Phoenix dactylifera
ref|XP_002314796.1|  pectin methylesterase 6 family protein             197   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    198   1e-55   Glycine max [soybeans]
emb|CDY56347.1|  BnaCnng30140D                                          196   2e-55   Brassica napus [oilseed rape]
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     195   2e-55   Glycine soja [wild soybean]
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     196   2e-55   Glycine soja [wild soybean]
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               196   2e-55   Ricinus communis
ref|XP_002315399.2|  hypothetical protein POPTR_0010s25400g             197   2e-55   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    196   2e-55   Glycine max [soybeans]
ref|XP_002266980.1|  PREDICTED: pectinesterase                          196   2e-55   Vitis vinifera
dbj|BAK06157.1|  predicted protein                                      202   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK94644.1|  unknown                                                 191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010040919.1|  PREDICTED: probable pectinesterase/pectinest...    188   2e-55   Eucalyptus grandis [rose gum]
emb|CDY08030.1|  BnaC03g34930D                                          189   2e-55   Brassica napus [oilseed rape]
gb|AAQ21126.1|  pectinesterase                                          187   3e-55   Fragaria x ananassa
ref|XP_006398954.1|  hypothetical protein EUTSA_v10013020mg             197   3e-55   Eutrema salsugineum [saltwater cress]
gb|AAF16637.1|AC011661_15  T23J18.24                                    188   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     195   3e-55   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   196   3e-55   Nelumbo nucifera [Indian lotus]
emb|CAA96436.1|  pectin methylesterase                                  189   3e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             195   3e-55   Prunus persica
ref|XP_010423511.1|  PREDICTED: probable pectinesterase/pectinest...    198   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             197   3e-55   Phaseolus vulgaris [French bean]
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    199   3e-55   Solanum tuberosum [potatoes]
ref|XP_009600658.1|  PREDICTED: probable pectinesterase/pectinest...    197   3e-55   Nicotiana tomentosiformis
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    196   3e-55   Solanum tuberosum [potatoes]
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    196   3e-55   Glycine max [soybeans]
gb|KHN16553.1|  Pectinesterase 2                                        193   3e-55   Glycine soja [wild soybean]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          196   3e-55   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    196   3e-55   Solanum lycopersicum
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    197   3e-55   Phoenix dactylifera
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      196   3e-55   Glycine soja [wild soybean]
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     197   3e-55   Elaeis guineensis
gb|AAR03544.1|  pectin methylesterase isoform 1                         188   4e-55   Fragaria x ananassa
emb|CBI38888.3|  unnamed protein product                                189   4e-55   Vitis vinifera
ref|XP_010469150.1|  PREDICTED: probable pectinesterase/pectinest...    196   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     197   4e-55   Sesamum indicum [beniseed]
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             195   4e-55   Phaseolus vulgaris [French bean]
emb|CAA96435.1|  pectin methylesterase                                  190   4e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     196   5e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    196   5e-55   Gossypium arboreum [tree cotton]
emb|CAA96434.1|  pectin methylesterase                                  190   5e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002873178.1|  hypothetical protein ARALYDRAFT_487284             197   5e-55   Arabidopsis lyrata subsp. lyrata
gb|AAP04164.1|  putative pectinesterase                                 195   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315470.1|  PREDICTED: pectinesterase                          197   5e-55   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          196   5e-55   Solanum lycopersicum
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    194   5e-55   Cicer arietinum [garbanzo]
ref|NP_001054042.1|  Os04g0641200                                       200   5e-55   
gb|ABE67980.1|  pectin methylesterase                                   187   5e-55   
ref|NP_192139.1|  Probable pectinesterase/pectinesterase inhibito...    196   5e-55   
gb|ABQ42392.1|  pectin methylesterase-like protein                      196   5e-55   
gb|KJB57711.1|  hypothetical protein B456_009G176700                    196   6e-55   
gb|EAY95754.1|  hypothetical protein OsI_17629                          199   6e-55   
emb|CAH68135.1|  B0414F07.5                                             199   6e-55   
ref|XP_010452398.1|  PREDICTED: probable pectinesterase/pectinest...    197   6e-55   
ref|NP_196116.1|  putative pectinesterase/pectinesterase inhibito...    197   6e-55   
gb|KJB09419.1|  hypothetical protein B456_001G140500                    196   6e-55   
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    194   6e-55   
ref|NP_566379.1|  pectinesterase 25                                     188   6e-55   
gb|AEL79481.1|  pectin methylesterase-like protein                      196   7e-55   
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   187   7e-55   
ref|XP_010096538.1|  Pectinesterase 1                                   187   7e-55   
emb|CBI27741.3|  unnamed protein product                                191   8e-55   
ref|XP_004297462.2|  PREDICTED: pectinesterase                          196   8e-55   
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...    197   9e-55   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    190   9e-55   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    195   9e-55   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          196   9e-55   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     195   9e-55   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    194   9e-55   
gb|AJH66132.1|  pectin methylesterase                                   196   9e-55   
gb|AFK42744.1|  unknown                                                 188   9e-55   
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 196   1e-54   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-54   
ref|NP_001042866.1|  Os01g0312500                                       192   1e-54   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  189   1e-54   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   196   1e-54   
gb|AAM67242.1|  putative pectinesterase                                 188   1e-54   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    195   1e-54   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg             197   1e-54   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             195   1e-54   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     196   1e-54   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     196   1e-54   
ref|XP_002872846.1|  predicted protein                                  194   1e-54   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    195   1e-54   
emb|CDY34642.1|  BnaC08g42010D                                          193   1e-54   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    195   1e-54   
gb|AFW03480.1|  pectin methylesterase 1                                 195   1e-54   
ref|XP_009760201.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-54   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   194   1e-54   
ref|XP_002317208.1|  pectin methylesterase family protein               195   1e-54   
gb|KJB45965.1|  hypothetical protein B456_007G340800                    200   1e-54   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    195   1e-54   
gb|AFB77929.1|  pectin methylesterase                                   195   1e-54   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    195   1e-54   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          197   1e-54   
gb|KJB57093.1|  hypothetical protein B456_009G147900                    195   1e-54   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    195   1e-54   
gb|KHG08631.1|  Pectinesterase 3                                        195   1e-54   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             195   1e-54   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    195   2e-54   
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    195   2e-54   
ref|NP_001049858.1|  Os03g0300500                                       195   2e-54   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    195   2e-54   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    194   2e-54   
dbj|BAK06954.1|  predicted protein                                      194   2e-54   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                194   2e-54   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            194   2e-54   
gb|EMS65302.1|  putative pectinesterase/pectinesterase inhibitor 21     186   2e-54   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                194   2e-54   
ref|XP_002515774.1|  Pectinesterase-2 precursor, putative               194   2e-54   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   192   2e-54   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   191   2e-54   
ref|XP_004293266.1|  PREDICTED: pectinesterase                          194   2e-54   
ref|XP_006287480.1|  hypothetical protein CARUB_v10000691mg             194   2e-54   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    194   2e-54   
ref|XP_006290060.1|  hypothetical protein CARUB_v10003696mg             195   3e-54   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     198   3e-54   
gb|EPS72184.1|  pectinesterase family protein                           194   3e-54   
ref|XP_002868170.1|  predicted protein                                  196   3e-54   
emb|CDY53657.1|  BnaC04g52910D                                          193   3e-54   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    192   3e-54   
gb|KDO53806.1|  hypothetical protein CISIN_1g0081982mg                  189   3e-54   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  186   3e-54   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    192   3e-54   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     198   3e-54   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          194   3e-54   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    194   3e-54   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-54   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    194   3e-54   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             192   3e-54   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          194   3e-54   
emb|CAC01624.1|  putative pectin methylesterase                         194   3e-54   
ref|XP_006411580.1|  hypothetical protein EUTSA_v10016522mg             193   3e-54   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   184   3e-54   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    196   3e-54   
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    194   4e-54   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    194   4e-54   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          194   4e-54   
gb|KFK38464.1|  hypothetical protein AALP_AA3G116300                    195   4e-54   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           187   4e-54   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    193   4e-54   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     193   4e-54   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     192   4e-54   
emb|CBI35795.3|  unnamed protein product                                195   4e-54   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    194   4e-54   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    193   4e-54   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     194   4e-54   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    194   4e-54   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    194   4e-54   
ref|XP_009355065.1|  PREDICTED: probable pectinesterase/pectinest...    194   5e-54   
ref|XP_008796891.1|  PREDICTED: pectinesterase-like                     192   5e-54   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    195   5e-54   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    194   5e-54   
ref|XP_010413524.1|  PREDICTED: probable pectinesterase/pectinest...    193   5e-54   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     194   5e-54   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   192   5e-54   
emb|CDX80613.1|  BnaC07g28310D                                          195   5e-54   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               193   5e-54   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     195   6e-54   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          193   6e-54   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        192   6e-54   
ref|XP_010491028.1|  PREDICTED: probable pectinesterase/pectinest...    194   7e-54   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    194   7e-54   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          192   7e-54   
emb|CDY68790.1|  BnaAnng28400D                                          195   7e-54   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     192   7e-54   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    193   7e-54   
emb|CDY18942.1|  BnaC04g04080D                                          186   7e-54   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             193   7e-54   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    192   7e-54   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             193   7e-54   
gb|ACJ85756.1|  unknown                                                 189   8e-54   
emb|CDP21156.1|  unnamed protein product                                184   8e-54   
emb|CDO97787.1|  unnamed protein product                                186   8e-54   
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   193   8e-54   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   189   8e-54   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          193   9e-54   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     192   9e-54   
ref|XP_002889876.1|  At1g11580/T23J18_33                                192   9e-54   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     192   9e-54   
emb|CDY55503.1|  BnaA05g34400D                                          192   9e-54   
ref|XP_010523198.1|  PREDICTED: putative pectinesterase/pectinest...    191   9e-54   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         190   1e-53   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     192   1e-53   
gb|AFQ23194.1|  pectin methylesterase                                   193   1e-53   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    192   1e-53   
ref|XP_009142905.1|  PREDICTED: probable pectinesterase/pectinest...    192   1e-53   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   192   1e-53   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    195   1e-53   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          192   1e-53   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     192   1e-53   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    193   1e-53   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   193   1e-53   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             192   1e-53   
ref|XP_009122661.1|  PREDICTED: probable pectinesterase/pectinest...    193   1e-53   
emb|CDY36270.1|  BnaA01g31480D                                          193   1e-53   
gb|KDP28779.1|  hypothetical protein JCGZ_14550                         191   1e-53   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             192   1e-53   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   191   1e-53   
ref|NP_181833.1|  putative pectinesterase/ pectinerase inhibitor 16     191   1e-53   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          192   1e-53   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             191   1e-53   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          192   1e-53   
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg             194   1e-53   
gb|AFW03475.1|  pectin methylesterase 1                                 192   1e-53   
ref|XP_006289196.1|  hypothetical protein CARUB_v10002644mg             192   1e-53   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  192   1e-53   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    184   1e-53   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   191   1e-53   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     192   1e-53   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     192   2e-53   
gb|EPS70728.1|  pectinesterase                                          192   2e-53   
tpg|DAA44943.1|  TPA: hypothetical protein ZEAMMB73_754551              189   2e-53   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    190   2e-53   
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
ref|XP_008346152.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
gb|KJB49322.1|  hypothetical protein B456_008G113200                    191   2e-53   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            192   2e-53   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    192   2e-53   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 192   2e-53   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               191   2e-53   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     192   2e-53   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    191   2e-53   
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     192   2e-53   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    192   2e-53   
ref|XP_010493501.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 192   2e-53   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          192   2e-53   
ref|XP_003626199.1|  Pectinesterase                                     192   2e-53   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     190   2e-53   
emb|CAC09455.2|  H0423H10.1                                             194   2e-53   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     192   2e-53   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 191   2e-53   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                190   2e-53   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 191   2e-53   
gb|KHN35618.1|  Pectinesterase 2                                        187   2e-53   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      191   2e-53   
gb|AAK59760.1|  At1g11580/T23J18_33                                     191   2e-53   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    192   2e-53   
ref|NP_172624.1|  methylesterase PCR A                                  191   2e-53   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   192   2e-53   
gb|EEC70505.1|  hypothetical protein OsI_01594                          192   2e-53   
gb|KHN25547.1|  Pectinesterase 2                                        187   3e-53   
ref|XP_010069899.1|  PREDICTED: probable pectinesterase/pectinest...    191   3e-53   
ref|XP_006649104.1|  PREDICTED: probable pectinesterase/pectinest...    190   3e-53   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             190   3e-53   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     192   3e-53   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   191   3e-53   
ref|XP_010489755.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-53   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    192   3e-53   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    191   3e-53   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     191   3e-53   
emb|CAN60506.1|  hypothetical protein VITISV_022717                     184   3e-53   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-53   
ref|XP_008812365.1|  PREDICTED: pectinesterase                          191   3e-53   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          192   3e-53   
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     191   3e-53   
gb|EYU25793.1|  hypothetical protein MIMGU_mgv1a020083mg                191   3e-53   
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   191   3e-53   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     191   3e-53   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     191   3e-53   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     191   3e-53   
ref|XP_010543915.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    189   4e-53   
ref|XP_002880019.1|  pectinesterase family protein                      190   4e-53   
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          191   4e-53   



>ref|XP_008351186.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Malus domestica]
Length=363

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDCT++GTIDFIFG+AA VFQ+CK+I+RKPM N    Q+CM
Sbjct  171  CQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACM  226

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+GI + N  IS  PEY+       S+LGRPW+  ARTV++ S+ID  I
Sbjct  227  VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  286

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + G+   + CW+GE+ N G G+ +SKR KW+G+K  ++  QA  F  GKF+ G
Sbjct  287  APEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIKN-LSADQAVAFTSGKFVEG  345

Query  188  DTWIPASGVPYSAK*VSI  135
            D WI  SGVPY A  VS+
Sbjct  346  DKWIKPSGVPYVAGMVSV  363



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDCT++GTIDFIFG+AA VFQ+CK+I+RKPM N    Q+CM
Sbjct  386  CQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACM  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+GI + N  IS  PEY+       S+LGRPW+  ARTV++ S+ID  I
Sbjct  442  VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + G+   + CW+GE+ N G G+D+SKR KW+G+K  +   QA  F  GKF+ G
Sbjct  502  APEGWMEWTGSNNHQSCWFGEYRNRGPGSDMSKRVKWSGIKN-LGADQAVAFTSGKFVEG  560

Query  188  DTWIPASGVPYSAK*VSI  135
            D WI  SGVPY A  VS+
Sbjct  561  DKWIKPSGVPYVAGMVSV  578



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDCT++GTIDFIFG+AA VFQ+CK+I+RKPM N    Q+CM
Sbjct  386  CQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACM  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+GI + N  IS  PEY+       S+LGRPW+  ARTV++ S+ID  I
Sbjct  442  VTAQGRIDRRQPSGIILQNCTISGDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGII  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + G+   + CW+GE+ N G G+ +SKR KW+G+K  ++  QA  F  GKF+ G
Sbjct  502  APEGWMEWTGSNNHQSCWFGEYRNRGPGSHMSKRVKWSGIKN-LSADQAVAFTSGKFVEG  560

Query  188  DTWIPASGVPYSAK*VSI  135
            D WI  SGVPY A  VS+
Sbjct  561  DKWIKPSGVPYVAGMVSV  578



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ DAYQDTLY H +RQ+YR+CT++GTIDFIFG+A+AVFQ CK+++RKPM N G    CM
Sbjct  370  CQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCKMVVRKPMENQG----CM  425

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +      I + N  I A P +L    PI ++LGRPW++ +RT+I+ + ID  I
Sbjct  426  VTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFI  485

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGWSP+ G +G++ C+Y E+ N G GAD SKR +W G+K  IT   A  F PG +I G
Sbjct  486  APEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIAQSFTPGAYIQG  544

Query  188  DTWIPASGVPYS  153
            D WI ASGVPY+
Sbjct  545  DAWITASGVPYA  556



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   231 bits (588),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H HRQFYRDCT++GTIDF+FG+AAA+FQ+C  ++ KP+ +    QSC+
Sbjct  399  CSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVHKPLPD----QSCI  454

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS I+A P+Y    +   ++LGRPW++++RT+I+ S ID  I
Sbjct  455  VTAQGRKEGRQPSAIVIQNSTITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVI  514

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G WGL  C+Y EF NTG  A+ ++R  W G+K  IT+  A +F PGKF  G
Sbjct  515  QPEGWLPWAGQWGLRTCFYTEFRNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRG  573

Query  188  DTWIPASGVPYSAK  147
            D WI  SGVPYS K
Sbjct  574  DEWIKLSGVPYSYK  587



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 142/198 (72%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HAHRQFYRDCT++GTIDFIFG+A+A+FQ+CK+++RKP+ N    Q C+
Sbjct  380  CHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQNCKMLVRKPLDN----QQCI  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I + N  I+A   Y+   +   SFLGRPW++++RT+I+ S ID  I
Sbjct  436  VTAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDII  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +G++ C+Y EFGN G G+ ++ R KW G+K  IT A A +F  G F+ G
Sbjct  496  QPEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-TITPAHAVDFTVGTFLRG  554

Query  188  DTWIPASGVPYSAK*VSI  135
            +TW+P  GVP+SA  V++
Sbjct  555  NTWLPKFGVPFSAGMVAV  572



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQFYRDCT++GTIDF+FG+A A+FQ+C  +IRKP+ N    QSC+
Sbjct  399  CSMDGYQDTLYTHAQRQFYRDCTISGTIDFVFGDATAIFQNCTFLIRKPLPN----QSCI  454

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS I+A P+Y        ++LGRPW++++RT+I++S ID  I
Sbjct  455  VTAQGRKERRQPSAIIIQNSTITADPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVI  514

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P++G WGL+ C+Y E GNTG  A+ ++R  W G+K  IT+  A +F PG+F  G
Sbjct  515  QPEGWLPWEGEWGLKTCFYAELGNTGPAANKARRVTWRGIKK-ITENHAADFTPGRFFRG  573

Query  188  DTWIPASGVPY  156
            D WI  SGVPY
Sbjct  574  DKWIRLSGVPY  584



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 138/197 (70%), Gaps = 5/197 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYRDCT+TGTIDFIFG+A AVFQ+CKL++RKP+ N    Q C+
Sbjct  379  CQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLDN----QQCI  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  EP G  I N  I+A P+Y        ++LGRPWR+ +RT+++ S ID  I
Sbjct  435  VTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW P+ G++GL   +Y E+ N G+GA  + R KWAG+K +  +A AD +   KFI G
Sbjct  495  APEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIKKLTPEA-ADGYTAAKFIQG  553

Query  188  DTWIPASGVPYSAK*VS  138
            D WIP +GVPY+A  +S
Sbjct  554  DEWIPQTGVPYTAGMIS  570



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 135/193 (70%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ DAYQDTLY H +RQ+YR+CT++GTIDFIFG+ +AVFQ CK+++RKPM N G    CM
Sbjct  354  CQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMVVRKPMENQG----CM  409

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +      I + N  I A P +L    PI ++LGRPW++ +RT+I+ + ID  I
Sbjct  410  VTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFI  469

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGWSP+ G +G++ C+Y E+ N G GAD SKR +W G+K  IT   A  F PG +I G
Sbjct  470  APEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIAQSFTPGAYIQG  528

Query  188  DTWIPASGVPYSA  150
            D WI ASGV Y++
Sbjct  529  DAWITASGVTYAS  541



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 137/197 (70%), Gaps = 5/197 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYRDCT+TGTIDFIFG+A AVFQ+CKL++RKP+ N    Q C+
Sbjct  379  CQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLEN----QQCI  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  EP G  I N  I+A P+Y        ++LGRPWR+ +RT+++ S ID  I
Sbjct  435  VTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW P+ G +GL   +Y E+ N G+GA  + R KWAG+K +  +A AD +   KFI G
Sbjct  495  APEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIKKLTPEA-ADGYTAAKFIQG  553

Query  188  DTWIPASGVPYSAK*VS  138
            D WIP +GVPY+A  +S
Sbjct  554  DEWIPQTGVPYTAGMIS  570



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY HAHRQFYRDCT+TGTIDFIFGNAAAVFQ+CK+++RKPM N    Q C+
Sbjct  378  CQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAAVFQNCKILVRKPMDN----QQCI  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+Q  EP  I + N  IS+ P +        ++LGRPW+Q++RT+I+  +ID  I
Sbjct  434  VTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGRPWKQYSRTIIMQCQIDDLI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G + L   +Y E  N G GA   KR KW G+K  IT   A +F  G+FI G
Sbjct  494  QPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIKK-ITPQHALDFTVGRFIRG  552

Query  188  DTWIPASGVPYSA  150
            D WI  +GVPYS+
Sbjct  553  DPWIKPTGVPYSS  565



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 133/192 (69%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQFYR+C+++GTIDF+FG+A  VFQ+CK ++RKP+ N    Q C+
Sbjct  389  CAMDGYQDTLYTHAKRQFYRECSISGTIDFVFGDAPVVFQNCKFLVRKPLEN----QQCI  444

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR Q  +P+GI I N   +A PE +       S+LGRPW+Q +RT+I+ S ID  I
Sbjct  445  VTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQYKSYLGRPWKQFSRTIIMESYIDDII  504

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ GT+GL+ CWY EF N G G+D   R KW G+K  I +  A +F PG+F+ G
Sbjct  505  EPEGWLPWFGTFGLKTCWYTEFNNYGPGSDKKARVKWNGIK-TIDRQHALDFTPGRFLRG  563

Query  188  DTWIPASGVPYS  153
            DTWI  +G+PYS
Sbjct  564  DTWIKPTGIPYS  575



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDCT++GTIDFIFG+AA VFQ+CK+I+RKPM N    Q+CM
Sbjct  383  CQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACM  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P  + + N  IS  PEY+       ++LGRPW+  ART+++ S+ID  I
Sbjct  439  VTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRPWKALARTIVMQSQIDDII  498

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G+   + CW+GE+GN G G+D+++R  W+G+K  +T   A +F  G+ + G
Sbjct  499  TPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK-LTPEHAVDFTAGRLMEG  557

Query  188  DTWIPASGVPYSAK*VSI  135
            D WI  SGVPY A  VS+
Sbjct  558  DKWIKPSGVPYVAGMVSV  575



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY HAHRQFYRDCT+TGTIDFIFGN A VFQ+CK+++RKPM N    Q C+
Sbjct  378  CQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDN----QQCI  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+Q  EP  I + N  IS+ P++        +FLGRPW+Q++RT+I+ S+ID  I
Sbjct  434  VTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G + L   +Y E  N G GA   KR KW G+K  IT   A +F   +FI G
Sbjct  494  QPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITMEHALDFTAARFIRG  552

Query  188  DTWIPASGVPYSA  150
            D WI  +GVPY++
Sbjct  553  DPWIKPTGVPYTS  565



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY HAHRQFYRDCT+TGTIDFIFGN A VFQ+CK+++RKPM N    Q C+
Sbjct  381  CQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAVVFQNCKILVRKPMDN----QQCI  436

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+Q  EP  I + N  IS+ P++        +FLGRPW+Q++RT+I+ S+ID  I
Sbjct  437  VTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGRPWKQYSRTIIMQSQIDDLI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G + L   +Y E  N G GA   KR KW G+K  IT   A +F   +FI G
Sbjct  497  QPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIKK-ITMEHALDFTAARFIRG  555

Query  188  DTWIPASGVPYSA  150
            D WI  +GVPY++
Sbjct  556  DPWIKPTGVPYTS  568



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDCT++GTIDFIFG+AA VFQ+CK+I+RKPM N    Q+CM
Sbjct  383  CQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDN----QACM  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P  + + N  IS  PEY+       ++LGRPW+  ART+++ S+ID  I
Sbjct  439  VTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDII  498

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G+   + CW+GE+GN G G+D+++R  W+G+K  +T   A +F  G+ + G
Sbjct  499  TPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK-LTPEHAVDFTAGRLMEG  557

Query  188  DTWIPASGVPYSAK*VSI  135
            D WI  SGVPY A  VS+
Sbjct  558  DRWIKPSGVPYVAGMVSV  575



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D +QDTLY HA RQFYRDC+++GTIDF+FG+A+AVFQ+CK ++RKP+ N    Q C+
Sbjct  385  CSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN----QQCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+ + I NS I+A P+         S+LGRPW++++RT+I+ S ID  I
Sbjct  441  VTAQGRKMRRQPSALIIQNSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ GT+GL+ CWY EF N G G+  + R KW G+K  I +  A +F PG+F+ G
Sbjct  501  QPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGRFLKG  559

Query  188  DTWIPASGVPYS  153
            D+WI A+G+PY+
Sbjct  560  DSWIKATGIPYT  571



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQFYRDCTV+GTIDF+FG+A  VFQ+C  ++RKP+ N    Q C+
Sbjct  390  CSMDGYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVVFQNCTFLVRKPLEN----QQCI  445

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+ I I NS I+A PE         S+LGRPW++ +RT+I+ + ID  I
Sbjct  446  VTAQGRKARRQPSAIIIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLI  505

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGWSP+ G++GL+ CWYGE+ N G G+D+  R KW G+K V ++  A +F PG+F+ G
Sbjct  506  QPEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGIKPV-SRQHAIDFTPGRFLRG  564

Query  188  DTWIPASGVPYS  153
            D+WI  +GVPY+
Sbjct  565  DSWIKPTGVPYA  576



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQFY DCT++GTIDF+FG+A AVFQ+C  +IRKP+ N    QSC+
Sbjct  394  CSMDGYQDTLYTHAQRQFYCDCTISGTIDFVFGDATAVFQNCTFLIRKPLPN----QSCI  449

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS I+A P+Y        ++LGRPW++++RT+I++S ID  I
Sbjct  450  VTAQGRKERRQPSAIIIQNSTITAEPDYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVI  509

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P++G WGL+ C+Y E GNTG  A+ ++R  W G+K +     AD F PG+F  G
Sbjct  510  QPEGWLPWEGEWGLKTCFYAESGNTGPAANKARRVTWRGIKQITENHTAD-FTPGRFFRG  568

Query  188  DTWIPASGVPY  156
            D WI  SGVPY
Sbjct  569  DKWIRLSGVPY  579



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 136/193 (70%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLYVHAHRQFYRDCT+TGTIDFIFG++A VFQ+C +++RKP+ N    Q C+
Sbjct  393  CRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDN----QQCI  448

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  EP GI + N  ISA  +Y+   +   S+LGRPW+  +RT+I+ S+ID  I
Sbjct  449  VTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLI  508

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            +PEGW P+ G +GL  C+Y E+GN G  +  + R  W G+K  IT    ++F  G+FI G
Sbjct  509  SPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQHVNDFTVGRFISG  567

Query  188  DTWIPASGVPYSA  150
              W+ ASGVPY++
Sbjct  568  HLWLGASGVPYTS  580



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 136/193 (70%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
               + +QDTLY HA+RQ+YRDCT+TGTIDFIFG+AAAVFQ+C++I+RKP+ N G    CM
Sbjct  380  VHMNGFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQG----CM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +        I N  I A P +L+   P+ ++LGRPW+Q +RT+I+ + ID  I
Sbjct  436  VTAQGRKERRSTGVTVIQNCHILAEPAFLSTTPPLKAYLGRPWKQFSRTIIMQTLIDGFI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+P+QG + L+  +YGEF N G G+D+S+R +W G++  IT A AD F PG+   G
Sbjct  496  APEGWAPWQGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIADSFTPGRLFAG  554

Query  188  DTWIPASGVPYSA  150
            D W+  SGVPY A
Sbjct  555  DEWVRQSGVPYVA  567



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H +RQFYRD T++GTIDFIFG+AAAVFQ+CKLI+R P++N    Q+CM
Sbjct  374  CQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLIVRMPLVN----QACM  429

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+       I + N  I A P  L+A  P+ ++LGRPW++++RT+I+ S ID  I
Sbjct  430  VTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRTIIMQSNIDGFI  489

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GWSP+ GT+GL+  +Y E+ N G GA+  +R  W G++  IT   A+ F PGK+ +G
Sbjct  490  DPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQH-ITPQVAESFTPGKYFIG  548

Query  188  DTWIPASGVPY  156
            D+WI ASG PY
Sbjct  549  DSWITASGFPY  559



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 133/190 (70%), Gaps = 5/190 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H HRQFYRDCT++GTIDF+FG+AAA+FQ+C  ++RKP+ +    QSC+
Sbjct  401  CSMDGYQDTLYTHTHRQFYRDCTISGTIDFVFGDAAAIFQNCTFVVRKPLPD----QSCI  456

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS I+A P+Y    +   ++LGRPW++++RT+I+ S ID  I
Sbjct  457  VTAQGRKERRQPSAIVIQNSTITADPDYFPVKNVNRAYLGRPWKEYSRTIIMESYIDDVI  516

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G WGL  C+Y EF NTG  A+ ++R  W G+K  IT+  A +F PGKF  G
Sbjct  517  QPEGWLAWAGQWGLRTCFYTEFCNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRG  575

Query  188  DTWIPASGVP  159
            D WI  SGVP
Sbjct  576  DEWIKLSGVP  585



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 140/207 (68%), Gaps = 8/207 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYRDCT++GTIDFIFG+AA +FQ+C  ++RKP+ N    Q C+
Sbjct  385  CQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDN----QQCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS  +A PEY    + + S+LGRPW++ +RT+I+ S I+  I
Sbjct  441  VTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L  C+Y EF N G GA    R KW G+K  I  + A +FAPG+F+ G
Sbjct  501  QPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHAIDFAPGRFLSG  559

Query  188  DTWIPASGVPYSAK*VSITSL*YNVTS  108
            D WIP++GVPY++   ++ S   NVT+
Sbjct  560  DRWIPSTGVPYNSGLFTLLS---NVTT  583



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH++RQF+RDCT+TGTIDFIFG+AAAVFQ+CK+I+RKPM N    Q+CM
Sbjct  353  CQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRKPMDN----QACM  408

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR       GI + N  I A   +L A  PI ++LGRPW++ +RT+I+ S+ID  I
Sbjct  409  VTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFI  468

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGWSP+ G + L+  +Y E+ N G G+    R  W G +  I    A +F PG FI+G
Sbjct  469  APEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPGVFIMG  528

Query  188  DTWIPASGVPYS  153
            D W+  SGVPY 
Sbjct  529  DEWVKLSGVPYE  540



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D +QDTLY HA RQFYRDC+++GTIDF+FG+A+AVFQ+CK ++RKP+ N    Q C+
Sbjct  385  CSMDGHQDTLYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLVRKPLEN----QQCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+ + I +S I+A P+         S+LGRPW++++RT+I+ S ID  I
Sbjct  441  VTAQGRKMRRQPSALIIQSSTITAHPDLFPERKQFKSYLGRPWKEYSRTIIMESFIDDLI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ GT+GL+ CWY EF N G G+  + R KW G+K  I +  A +F PG+F+ G
Sbjct  501  QPEGWLPWLGTFGLKTCWYTEFNNYGPGSSKNLRVKWNGIK-TINRQHAMDFTPGRFLKG  559

Query  188  DTWIPASGVPYS  153
            D+WI A+G+PY+
Sbjct  560  DSWIKATGIPYT  571



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 133/193 (69%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H+ RQFYRDCT+TGTIDF+ G+AAAVFQ+CK++IRKP+ N    Q C+
Sbjct  383  CHMDGYQDTLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNCKMLIRKPLDN----QQCI  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS+  E + + + N  I+A P Y      I+S+LGRPW+ ++RT+I+ S ID  I
Sbjct  439  VTAQGRSKRREASALILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDII  498

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL  C+Y E+ N G GA  ++R KW G+K  IT   A EF  G+F+ G
Sbjct  499  QPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIKK-ITPQHAVEFTAGRFMKG  557

Query  188  DTWIPASGVPYSA  150
            D WI  +GVPY A
Sbjct  558  DRWIRTAGVPYVA  570



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 137/193 (71%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
               +++QDTLY HA+RQ+YRDCT+TGTIDFIFG+AAAVFQ+C++I+RKP+ N G    CM
Sbjct  380  VHMNSFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAAVFQNCQMIVRKPLANQG----CM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +        I N  I A P +L+   P+ ++LGRPW+Q +RT+I+ + ID  I
Sbjct  436  VTAQGRKERRSTGVTVIQNCHILAEPAFLSTKPPVKAYLGRPWKQFSRTIIMQTLIDGFI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+P++G + L+  +YGEF N G G+D+S+R +W G++  IT A A+ F PG+   G
Sbjct  496  APEGWAPWEGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ-TITPAIAESFTPGRLFAG  554

Query  188  DTWIPASGVPYSA  150
            D W+  SGVPY A
Sbjct  555  DEWVRQSGVPYVA  567



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 140/207 (68%), Gaps = 8/207 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYRDCT++GTIDFIFG+AA +FQ+C  ++RKP+ N    Q C+
Sbjct  385  CQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDN----QQCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I NS  +A PEY    + + S+LGRPW++ +RT+I+ S I+  I
Sbjct  441  VTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDLI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L  C+Y EF N G GA    R KW G+K  I  + A +FAPG+F+ G
Sbjct  501  QPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHAIDFAPGRFLSG  559

Query  188  DTWIPASGVPYSAK*VSITSL*YNVTS  108
            D WIP++GVPY++    + +L  NVT+
Sbjct  560  DRWIPSTGVPYNS---GLFTLLSNVTT  583



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 132/193 (68%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  383  CKMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR     P GI + N  IS  P Y    +   ++LGRPW+ +AR +++ S+ID  I
Sbjct  439  VTAHGRLDRRSPTGIILQNCTISGEPGYEKDLNK--AYLGRPWKNYARAIVMQSQIDDVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + G+   + CW+GEFGN G GAD +KRA W G+K +  +  AD F  G+F+ G
Sbjct  497  APEGWMEWIGSNNHQSCWFGEFGNRGLGADQTKRATWRGIKELTAQHAAD-FTAGRFVFG  555

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  556  DRWIQPSGVPYVA  568



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH++RQF+RDCT+TGTIDFIFG+AAAVFQ+C++I+RKPM N    Q+CM
Sbjct  353  CQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRKPMDN----QACM  408

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR       GI + N  I A  ++L A  PI ++LGRPW++ +RT+I+ S+ID  I
Sbjct  409  VTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIMQSEIDGFI  468

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGWSP+ G + L+  +Y E+ N G G+    R  W G +  I    A +F P  FI+G
Sbjct  469  APEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQFTPAVFIMG  528

Query  188  DTWIPASGVPYS  153
            D W+  SGVPY 
Sbjct  529  DEWVKLSGVPYE  540



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY HAHRQFYRDCT++GTIDF+FGNAA  FQ+CKL++RKP+ N    Q C+
Sbjct  386  CQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPLDN----QQCI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR    EP  +   +      P YL   +   ++LGRPW++++RT+II S ID  I
Sbjct  442  VTAHGRLNRKEPTALIFQSCHFMGDPAYLPFKAINKAYLGRPWKEYSRTIIIGSTIDDII  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GL   +Y E  N G GAD SKR KW G+K  IT   A +F P +FI G
Sbjct  502  QPEGWLPWMGDFGLNTLFYAEVQNKGAGADESKRVKWRGIKH-ITPQHAADFTPRRFIDG  560

Query  188  DTWIPASGVPYSA  150
            D WIPA G+PYS+
Sbjct  561  DAWIPAKGIPYSS  573



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 131/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H+HRQFYRDCT++GTIDFIFG++A V Q+CK+I+RKP+ N    Q C+
Sbjct  493  CQMDGYQDTLYAHSHRQFYRDCTISGTIDFIFGDSATVLQNCKIIVRKPLEN----QQCI  548

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  E + + + N  IS  PEYL       ++LGRPW++ +RT+I+ S+ID  I
Sbjct  549  VTAQGRIERREVSALVLQNCTISGDPEYLPVKDKNKAYLGRPWKEFSRTLIMQSQIDDII  608

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW P+ G + L   WY EFGN G GA  + R  W G+K  I  A A  F PG F+ G
Sbjct  609  APEGWLPWNGDFALNTLWYAEFGNRGPGAVQTHRVTWRGIKK-INAAIARRFTPGVFLRG  667

Query  188  DTWIPASGVPYS  153
            D WIP +GVPY+
Sbjct  668  DDWIPKAGVPYT  679



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H HRQFYRDC +TGTIDFIFG++AAVFQ+CK++IRKP+ N    Q+C+
Sbjct  385  CHMDGYQDTLYAHTHRQFYRDCVITGTIDFIFGDSAAVFQNCKMVIRKPLDN----QNCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  E   + + N  I+  P YL        +LGRPW++ +RT+I+NS+ID  I
Sbjct  441  VTAQGRTERREATALVLQNCTITGDPAYLPVKDQNKGYLGRPWKEFSRTIIMNSRIDDVI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW P+ G + L  C+Y E  N G G+ +  R KW G+K V  + +A E+ PG+FI G
Sbjct  501  APEGWLPWAGDFALNTCFYTEILNRGPGSKLDGRVKWRGIKKVPAQ-RAVEYTPGRFIRG  559

Query  188  DTWIPASGVPY  156
            D WI A+GVPY
Sbjct  560  DWWIKAAGVPY  570



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY HAHRQFYRDCT++GTIDF+FGNAA  FQ+CKL++RKPM N    Q C+
Sbjct  385  CQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPMDN----QQCI  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR    EP  +          P YL   S   ++LGRPW+Q++RT+II S+ID  I
Sbjct  441  VTAHGRMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDII  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GL   +Y E  N G GA  +KR KW G+K  IT   A +F P +FI G
Sbjct  501  QPEGWLPWMGDFGLNTLFYAEVQNKGPGAVETKRVKWRGIKH-ITPQHAADFTPRRFIDG  559

Query  188  DTWIPASGVPYSA  150
            D WIPA G+PYS+
Sbjct  560  DAWIPAKGIPYSS  572



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 131/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D +QDT+Y HA RQFYRDC+++GTIDF+FG+A+AVFQ+CK +IRKP+ N    Q C+
Sbjct  386  CSMDGHQDTMYTHAKRQFYRDCSISGTIDFVFGDASAVFQNCKFLIRKPLEN----QQCI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+ I I NS I+A P+         S+LGRPW++ +RT+I+ S ID  I
Sbjct  442  VTAQGRKMRRQPSAIIIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVI  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ GT+GL+ CWY EF N G G+  + R KW G+K  I +  A +F PG+F  G
Sbjct  502  QPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TIDRQHALDFTPGRFFKG  560

Query  188  DTWIPASGVPYS  153
              WI  +G+PY+
Sbjct  561  GAWIKTTGIPYT  572



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 132/192 (69%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H++RQFY+DCT+TGTIDFIFG+A+ VFQ+CK+I+RKP    G  Q+CM
Sbjct  370  CNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASVVFQNCKMIVRKP----GDNQACM  425

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR        I + N  I A P + +A  PI ++LGRPW++++RT+II S IDA I
Sbjct  426  VTAQGRKDHRGVGAIVLQNCDIRAEPAFTSAQPPIKAYLGRPWKEYSRTIIIQSYIDAFI  485

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW+P+ G + L   +Y E+ N G GA++ KR KW G K  I+  +A+++AP  FI  
Sbjct  486  DPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQ  545

Query  188  DTWIPASGVPYS  153
            D WI  +G+ Y+
Sbjct  546  DNWIKKTGISYA  557



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 135/191 (71%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H++RQFY+DC+++GTIDFIFG+A+AVFQ+CK+I+RKP    G+ Q+CM
Sbjct  362  CNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKP----GANQACM  417

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR        I + N  ISA P ++    PI ++LGRPW++++RT+I+ S+IDA I
Sbjct  418  VTAQGRKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFI  477

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW+P+ G + L   +Y E+ N G GA+  +R KWAG K  I+  +A+++AP  FI  
Sbjct  478  DPEGWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYKKSISPQEAEKYAPNIFIDQ  537

Query  188  DTWIPASGVPY  156
            D+WI  +G+ Y
Sbjct  538  DSWIKKTGISY  548



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 132/193 (68%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH  RQFYR C V GT+DFIFG+A AV Q+C + +R+PM N    Q+ +
Sbjct  344  CSFKGYQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSN----QANV  399

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGRS  +E  GI+I NS + A P+     S   ++LGRPWR+++RTV + + +D  I
Sbjct  400  ITAQGRSDQNENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLI  459

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGWSP++G +GL   +YGE+ NTG GA    R KW G   + + A+AD+F  G+F++G
Sbjct  460  HPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVG  519

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVPY++
Sbjct  520  DSWIPTTGVPYAS  532



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  383  CNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR     P+ + + N  IS    Y    +   ++LGRPW+ +AR +++ S+ID  I
Sbjct  439  VTAQGRLDRRSPSALILQNCTISGERGYDKELNK--AYLGRPWKSYARAIVMQSQIDDVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + GT     CW+GEFGN G GA++SKR  W G+K  +T   A +F  GKFI G
Sbjct  497  APEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRGMKK-LTPEHAADFTAGKFIFG  555

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  556  DRWILPSGVPYVA  568



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQFYRDCT+TGT+DFIFG+  A+FQ+CK+++RKP    G  Q+CM
Sbjct  377  CHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GETQACM  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI + N  I+  P+Y+       ++LGRPW+  AR V++ S ID  I
Sbjct  433  VTAQGRTDHNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKNFARVVVMQSSIDEAI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+ + G    ++C++GE+GNTG G+DV++R KW+ VK  +T  QA  F P +   G
Sbjct  493  APEGWTEWTGEEYHQNCFFGEYGNTGPGSDVTQRVKWSTVKR-LTPDQAAAFTPARVFEG  551

Query  188  DTWIPASGVPY  156
            D WI  SGVPY
Sbjct  552  DKWIKPSGVPY  562



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 137/194 (71%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDT++ H HRQF+RDCT++GTIDFIFGNA AVFQ+C L++RKP+ N    ++C+
Sbjct  372  CQIDGYQDTVFAHNHRQFFRDCTISGTIDFIFGNARAVFQNCTLLVRKPLENQ---KACL  428

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA+GR+  +E + I + N  I   PEY        ++LGRPW+ ++RTVI++S +D+ +
Sbjct  429  VTAEGRTTINETSAIVLQNCRILPAPEYPVNDPTYKTYLGRPWKPYSRTVIMDSHLDSLV  488

Query  368  APEGWSPFQGTWG-LEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFIL  192
             PEGW+P+  T   L+ CWY E  N G GAD+S+R  W G+K  IT  +AD+F PG+F++
Sbjct  489  DPEGWAPWNVTSAHLDTCWYAELNNKGPGADLSRRVAWPGIKK-ITVNEADDFTPGQFMV  547

Query  191  GDTWIPASGVPYSA  150
            GD+WI   G+PY +
Sbjct  548  GDSWIAGKGIPYDS  561



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLYVHAHRQFYRDCT+TGTIDFIFG++A VFQ+C +++RKP+ N    Q C+
Sbjct  353  CRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDN----QQCI  408

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  EP GI + N  ISA  +Y+   +   S+LGRPW+  +RT+I+ S+ID  I
Sbjct  409  VTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLI  468

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            +PEGW P+ G +GL  C+Y E+GN G  +  + R  W G+K  IT    ++F  G+FI G
Sbjct  469  SPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQHVNDFTVGRFISG  527

Query  188  DTWIPASGVPYSAK*VSI  135
              W+ ASGVPY++  +++
Sbjct  528  HLWLGASGVPYTSDMMAV  545



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H++RQFY+DCT+TGTIDFIFG+A+AVFQ+CK+I+RKP    G  Q+CM
Sbjct  370  CNIDGYQDTLYTHSYRQFYKDCTITGTIDFIFGDASAVFQNCKMIVRKP----GDNQACM  425

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR        I + N  I A P + +   PI ++LGRPW++++RT+I+ S IDA I
Sbjct  426  VTAQGRKDHRGVGAIVLQNCDIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQSYIDAFI  485

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW+P+ G + L   +Y E+ N G GA++ KR KW G K  I+  +A+++AP  FI  
Sbjct  486  DPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYKRNISPQEAEKYAPAHFIDQ  545

Query  188  DTWIPASGVPY  156
            D WI  +G+ Y
Sbjct  546  DNWIKKTGISY  556



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 131/193 (68%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH  RQFYR C V GT+DFIFG+A AV Q+C + +R+PM N    Q  +
Sbjct  317  CSFKGYQDTLYVHTQRQFYRSCDVYGTVDFIFGDAVAVLQNCNIYVRRPMSN----QPNV  372

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGRS  +E  GI+I NS + A P+     S   ++LGRPWR+++RTV + + +D  I
Sbjct  373  ITAQGRSDQNENTGISIHNSRVMAAPDLRPVQSRFKTYLGRPWRKYSRTVFMKTSLDGLI  432

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGWSP++G +GL   +YGE+ NTG GA    R KW G   + + A+AD+F  G+F++G
Sbjct  433  HPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYHVITSAAEADKFTVGRFLVG  492

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVPY++
Sbjct  493  DSWIPTTGVPYAS  505



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 134/192 (70%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG++A VFQ+C L++RKP+ N    Q+C 
Sbjct  375  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTLLVRKPLPN----QACP  430

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P EP G       I   P+YL   +   ++LGRPW++++RT+I+N+ I   +
Sbjct  431  ITAHGRQDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFV  490

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+   +GL+  +Y E  NTG G+D++ R  WAG+K + +K   D+F P KFI G
Sbjct  491  QPQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIKKLTSK-DIDQFTPAKFIQG  549

Query  188  DTWIPASGVPYS  153
            D+WIPA+GVPY+
Sbjct  550  DSWIPATGVPYT  561



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQFYRDC V+GTIDF+FG+AAAVFQ+C+ I+R+PM N    Q C+
Sbjct  388  CAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAVFQNCRFIVRRPMDN----QQCI  443

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+ I I N    A P+Y      + ++LGRPW++ +RT+I+ S ID  I
Sbjct  444  VTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRPWKEFSRTIIMESFIDDLI  503

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGA-DVSKRAKWAGVKGVITKAQADEFAPGKFIL  192
             P GW P+ G +GL  C+Y EFGN G GA + S+RAKW GVK  IT   A +F PG F  
Sbjct  504  QPRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWKGVKN-ITAKHARDFTPGSFFK  562

Query  191  GDTWIPASGVPY  156
            GD WI  +G+PY
Sbjct  563  GDWWIKRTGIPY  574



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 130/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVHA+RQF+RDCT+TGTIDFIFG+A++VFQSCK+I+RKPM N    Q+CM
Sbjct  361  CQFDGYQDTLYVHAYRQFFRDCTITGTIDFIFGDASSVFQSCKMIVRKPMAN----QACM  416

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR        I + N  I A  E+++    I ++LGRPW++ +RT+I+ S ID  I
Sbjct  417  VTAQGRKDRRGVGAIVMQNCEIRAEHEFISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFI  476

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GWS + G + L   +Y E+ N G GA+ + R  W G K  I K  A  FAPG FIL 
Sbjct  477  DPQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYKKNIGKEIAAGFAPGVFILA  536

Query  188  DTWIPASGVPYSA  150
            D W+  SGVPY +
Sbjct  537  DEWVRLSGVPYES  549



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  386  CNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR     P+ + + N  IS    Y    +   ++LGRPW   AR +++ S+ID  I
Sbjct  442  VTAHGRLDMRSPSALILQNCTISGERGYDKELNK--AYLGRPWTSLARAIVMQSQIDDVI  499

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + GT     CW+GEFGN G GA++SKR  W+G+K  +T  QA +F  GKFI G
Sbjct  500  APEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK-LTPEQAADFTAGKFIFG  558

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  559  DRWILPSGVPYVA  571



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  402  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  457

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  458  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  517

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  518  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  577

Query  188  DTWIPASGVPY  156
            D WI   GVPY
Sbjct  578  DDWIKPRGVPY  588



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  383  CNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR     P+ + + N  IS    Y    +   ++LGRPW   AR +++ S+ID  I
Sbjct  439  VTAHGRLDMRSPSALILQNCTISGERGYDKELNK--AYLGRPWTSLARAIVMQSQIDDVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + GT     CW+GEFGN G GA++SKR  W+G+K  +T  QA +F  GKFI G
Sbjct  497  APEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK-LTPEQAADFTAGKFIFG  555

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  556  DRWILPSGVPYVA  568



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 134/191 (70%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H++RQFY+DC+++GTIDFIFG+A+AVFQ+CK+I+RKP    G+ Q+CM
Sbjct  366  CNIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKP----GNNQACM  421

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR        I + N  I A P + +   PI ++LGRPW++++RT+I+ ++IDA I
Sbjct  422  VTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQPPIKAYLGRPWKEYSRTIIMQTQIDAFI  481

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW+P+ G + L   +Y E+ N G GA+  KR KWAG K  I+  +A+++AP  FI  
Sbjct  482  DPEGWAPWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGYKRNISPQEAEKYAPNIFIDQ  541

Query  188  DTWIPASGVPY  156
            D+WI  +G+ Y
Sbjct  542  DSWIKKTGISY  552



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  406  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  462  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  522  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  581

Query  188  DTWIPASGVPY  156
            D WI   GVPY
Sbjct  582  DDWIKPRGVPY  592



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQFYRDCT++GT+DFIFG+   V Q+C +++RKPM N    QSCM
Sbjct  381  CQIDGYQDTLYVHSHRQFYRDCTISGTVDFIFGDGKVVLQNCNIVVRKPMKN----QSCM  436

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   E  G+ + N  I   PEY+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  437  ITAQGRTDVRESTGLVLHNCHIMGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +Y EF NTG G+D S+R KW G+K +  K QA  F P +F+ G
Sbjct  497  DPAGWLPWDGDFALSTLYYAEFENTGPGSDQSQRVKWPGIKKLSPK-QALRFTPARFLRG  555

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  556  NLWIPPNRVPY  566



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 131/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQSC L++RKP+ N    Q+C 
Sbjct  373  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQSCTLLVRKPLPN----QACP  428

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I   P+YLT      S+LGRPW++++RT+ +N+ I   I
Sbjct  429  ITAHGRKDPRESTGFVLQGCTIVGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFI  488

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GLE  +Y E GNTG GADV+KR  W G+K  +++ +  +  P ++I G
Sbjct  489  PPEGWQPWLGNFGLETLFYSEVGNTGPGADVTKRVTWPGIKK-LSEEEILKITPAEYIQG  547

Query  188  DTWIPASGVPY  156
            D WIP  GVPY
Sbjct  548  DAWIPGKGVPY  558



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 133/192 (69%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  378  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P EP G       I+  P+YL+  +   ++LGRPW+ ++RT+I+N+ I   +
Sbjct  434  ITAHGRQDPREPTGFVFQGCQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFV  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL   +Y E  NTG G+DV  R  WAG+K  +T     +F P +FI G
Sbjct  494  QPQGWQPWNGDFGLSTLFYSEIQNTGPGSDVVNRVTWAGIKK-LTNNDLLQFTPAQFIQG  552

Query  188  DTWIPASGVPYS  153
            D+WIPA+GVPY+
Sbjct  553  DSWIPATGVPYT  564



>ref|XP_008390620.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=388

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQFYRDCT+TGT+DFIFG+  A+FQ+CK+++RKP    G  Q+CM
Sbjct  196  CHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GEAQACM  251

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI + N  I+  P+Y+       ++LGRPW++ AR V++ S ID  I
Sbjct  252  VTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAI  311

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+ + G    ++C++GE+GN G   D+++R KW+ VK  +T  QA  F P +   G
Sbjct  312  APEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPDQAAAFTPARVFEG  370

Query  188  DTWIPASGVPY  156
            D W+  SGVPY
Sbjct  371  DKWVKPSGVPY  381



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYR+CT++GTIDF+FG+AA VFQ+C +++RKPM N    Q C+
Sbjct  386  CQMDGYQDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMAN----QQCI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI + N  ISA P   +A +  VS+LGRPW++++RT+I+ S+ID  I
Sbjct  442  VTAQGRKDRHEATGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLI  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              +GW P+ G +GL+ C+Y E GN G GA  +KR  W G K V     A ++   +FI G
Sbjct  502  NEDGWQPWLGEFGLKTCFYTEIGNRGPGAATTKRVTWKGYKKV-DLTHAHKYTVQQFIQG  560

Query  188  DTWIPASGVPYS  153
             TW+P +GVP++
Sbjct  561  KTWLPKTGVPFT  572



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 127/193 (66%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  384  CNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  439

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR     P  + + N  IS    Y    +   ++LGRPW+ +AR +++ S+ID  I
Sbjct  440  VTAHGRLDRRSPTALILQNCTISGESGYDKELNK--AYLGRPWKSYARAIVMQSQIDDVI  497

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + G      CW+GEFGN G GA++SKR  W G+K  +T   A +F  GKFI G
Sbjct  498  APEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRGMKK-LTPEHAADFTAGKFIFG  556

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  557  DRWILPSGVPYVA  569



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY+H+HRQFYRDCT++GT+DFIFG+   V Q C +++RKPM     GQSCM
Sbjct  380  CQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KGQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   E  G+ + N  I+  PEY+   S   ++LGRPW+Q +RT+I+ + ID  +
Sbjct  436  ITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVV  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G++ L   +Y E+ N G G+D S+R KW G+K +  K QA  F P +F+ G
Sbjct  496  DPAGWLPWNGSFALNTLYYAEYENNGPGSDQSQRVKWPGIKKLSPK-QALRFTPARFLRG  554

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  555  NLWIPPTRVPY  565



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 7/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY   HRQFYRDCT++GTIDFIFG+AAAVFQ+CK+I+RKP+ N    Q+CM
Sbjct  384  CNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLEN----QACM  439

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR     P+ + + N  IS    Y    +   ++LGRPW+ +AR +++ S+ID  I
Sbjct  440  VTAHGRLDMRSPSALILQNCTISGERGYNKELNK--AYLGRPWKSYARAIVMQSQIDDVI  497

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW  + GT     CW+ EFGN G GA++SKR  W+G+K  +T   A +F  GKF+ G
Sbjct  498  APEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSGMKK-LTPEHAADFTAGKFMFG  556

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  557  DRWILPSGVPYVA  569



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+   YQDTLYVH  RQFYRDCTV+GTIDFIFG+AAA+FQSC  ++RKP+ N    Q C+
Sbjct  383  CEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCTFLVRKPLPN----QQCI  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR +  +P+ + I N       + +       SFLGRPW++++RT+I+ S I   I
Sbjct  439  VTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLI  498

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G WGL  C+Y E+ N G G+D SKR KW G+K  IT   A +F PG+F+ G
Sbjct  499  QPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGIKN-ITPQHAVDFTPGRFLKG  557

Query  188  DTWIPASGVPY  156
            D WI  +GVPY
Sbjct  558  DRWIKPTGVPY  568



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D +QDTLY  A RQF RDC+V+GTIDF+FG+A+AVFQ+CK +IRKP+ N    Q C+
Sbjct  386  CSMDGHQDTLYTDAKRQFSRDCSVSGTIDFVFGHASAVFQNCKFLIRKPLEN----QQCI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P+ I I NS I+A P+         S+LGRPW++ +RT+I+ S ID  I
Sbjct  442  VTAQGRKMRRQPSAIVIQNSTITAHPDLFPERKLFKSYLGRPWKEFSRTIIMESFIDDVI  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ GT+GL+ CWY EF N G G+  + R KW G+K  I +  A +F PG+F  G
Sbjct  502  QPEGWLPWLGTFGLKTCWYTEFNNNGPGSSKAARVKWNGIK-TIDRQHALDFTPGRFFKG  560

Query  188  DTWIPASGVPYS  153
              WI  +G+PY+
Sbjct  561  GAWIKTTGIPYT  572



>emb|CDY71928.1| BnaCnng75130D, partial [Brassica napus]
Length=371

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQFYRD T++GT+DFIFG++ A+FQ+C +++RKPM     GQ CM
Sbjct  181  CQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCM  236

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   EP  I + N  I   P YL   +   ++LGRPW++ ART+++ + I   I
Sbjct  237  VTAQGRTDVREPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVI  296

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +Y E+ N+G G++ ++R KW G++  IT+ QA  FAPG+F+ G
Sbjct  297  DPAGWSAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQR-ITRPQALGFAPGRFLSG  355

Query  188  DTWIPASGVPY  156
             +WIP +GVPY
Sbjct  356  GSWIPQTGVPY  366



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY+H+HRQFYRDCT++GT+DFIFG+   V Q C +++RKPM     GQSCM
Sbjct  380  CQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KGQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   E  G+ + N  I+  PEY+   S   ++LGRPW+Q +RT+I+ + I+  +
Sbjct  436  ITAQGRTNERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVV  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G++ L   +Y E+ N G G+D S+R KW G+K +  K QA  F P +F+ G
Sbjct  496  DPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIKKLSPK-QALRFTPARFLRG  554

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  555  NLWIPPTRVPY  565



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+   YQDTLYVH  RQFYRDCTV+GTIDFIFG+AAA+FQ C  ++RKP+ N    Q C+
Sbjct  383  CEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCTFLVRKPLPN----QQCI  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR +  +P+ + I N  I A  +         SFLGRPW++++RT+I+ S I   I
Sbjct  439  VTAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLI  498

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G WGL+ C+Y E+ N G G++ SKR KW G+K  IT   A +F  G+F++G
Sbjct  499  QPEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVKWRGIK-TITPQHALDFTAGRFVMG  557

Query  188  DTWIPASGVPY  156
            D WI  +GVPY
Sbjct  558  DRWIKPTGVPY  568



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 5/197 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQ+YRDCT+TGT+DFIFG+  A+FQ+CK+++RKP    G  QSCM
Sbjct  372  CHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKP----GDSQSCM  427

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E   I + N  I+  PEY+       ++LGRPW+  AR V++NS+ID  I
Sbjct  428  VTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMNSQIDEAI  487

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G+     C+ GE+GN G  AD+++R KW  +K  +T  QA  F P K   G
Sbjct  488  QPEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWPSLKK-LTADQAATFTPAKLFEG  546

Query  188  DTWIPASGVPYSAK*VS  138
            D WI  SGVPY +  VS
Sbjct  547  DRWIKPSGVPYVSGMVS  563



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQF+RDCT++GT+DFIFG+A  V Q+C +++RKPM     GQSCM
Sbjct  382  CQIDGYQDTLYVHSHRQFFRDCTISGTVDFIFGDAKVVLQNCNIVVRKPM----KGQSCM  437

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   E +G+ + N  I+  P YL   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  438  ITAQGRTDVRESSGLVLQNCHITGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNII  497

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +Y E+ N G G+D ++R KW G+K  I+  QA  F P +F+ G
Sbjct  498  DPAGWLPWNGDFALNTLYYAEYENNGPGSDQAQRVKWPGIKK-ISPKQARRFTPARFLRG  556

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  557  NLWIPPNRVPY  567



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLYVH HRQFYRDC ++GTIDF+FG+A AVFQ+C+ ++R+PM N    Q C+
Sbjct  397  CRMDGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCQFVVRRPMEN----QQCI  452

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI I  S I   P YL   +   ++LGRPW++++RTVI+NS ID  I
Sbjct  453  VTAQGRKDRRETTGIVIHKSRIMGDPTYLPVKTKNRAYLGRPWKEYSRTVIMNSLIDDII  512

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  +  T+ L+  +Y E+ NTG G+D + R +W G++  ++ + A ++ P  F+ G
Sbjct  513  DPEGWMKWNETFALDTLYYAEYQNTGPGSDQAGRVRWNGIQH-LSDSAATQYTPDNFLRG  571

Query  188  DTWIPASGVPYSA  150
            +TWIP + VPY+A
Sbjct  572  NTWIPKTRVPYAA  584



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 134/193 (69%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQ+TL+ H +RQFYR+CT+TGTIDFI G+AAAVFQ+CK+++RKP+ N    Q C 
Sbjct  387  CQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNCKMVVRKPLEN----QRCT  442

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   EP G  + N  I+A  +YL       SFLGRPW+ ++RT+++ S ID  I
Sbjct  443  ITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDII  502

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW+P+ GT+G++ C   E+GN G GA ++ R  W G+   ++   A+ F  GKF+ G
Sbjct  503  DPKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LSPQDAEAFTAGKFLEG  561

Query  188  DTWIPASGVPYSA  150
            D+WI A+GVPY++
Sbjct  562  DSWIAATGVPYTS  574



>ref|XP_010434900.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH HRQFYRDC ++GTIDF+FG+A AVFQ+C  +IR+PM N    Q C+
Sbjct  503  CHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDN----QQCI  558

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI I NS I     YL   +   +FLGRPW++++RT+I+N++ID  I
Sbjct  559  VTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVI  618

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  +  T+ L   +Y E+ N G+G+  ++R KW G++ +  +A A EFAPG F+ G
Sbjct  619  DPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRRISPRA-AREFAPGNFLRG  677

Query  188  DTWIPASGVPYSA  150
            +TWIP + +PY+A
Sbjct  678  NTWIPQTRIPYNA  690



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQFYRDCT+TGT+DFIFG+  A+FQ+CK+++RKP    G  Q+CM
Sbjct  377  CHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCKMVVRKP----GEAQACM  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI + N  I+  P+Y+       ++LGRPW++ AR V++ S ID  I
Sbjct  433  VTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFARVVVMQSSIDEAI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+ + G    ++C++GE+GN G   D+++R KW+ VK  +T  QA  F P +   G
Sbjct  493  APEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPDQAAAFTPARVFEG  551

Query  188  DTWIPASGVPY  156
            D W+  SGVPY
Sbjct  552  DKWVKPSGVPY  562



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 133/192 (69%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVHAHRQFYRDCT++GT+DFIFG+A ++FQ+C +++RKPM     GQSC+
Sbjct  377  CQMDGYQDTLYVHAHRQFYRDCTISGTVDFIFGDAKSLFQNCNIVVRKPM----GGQSCI  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  GI + N  I+  P Y+   +   ++LGRPW+  +RT+++ + ID  I
Sbjct  433  VTAQGRTDVRESTGIVLHNCRITGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +Y E+ N+G G++ ++R  WAG+K  I+  QA +F P +F+ G
Sbjct  493  DPAGWLPWDGDFALNTLYYAEYQNSGPGSNQAQRVNWAGIKN-ISPRQALKFTPARFLRG  551

Query  188  DTWIPASGVPYS  153
            + WIP + VPY+
Sbjct  552  NLWIPQTHVPYT  563



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  432  ITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+QG +GL+  +Y E  NTG GA V+ R  WAG+K  ++     +F P ++I G
Sbjct  492  QPQGWQPWQGDFGLKTLFYSEVQNTGPGATVANRVTWAGIK-TLSDEDILKFTPAQYIQG  550

Query  188  DTWIPASGVPYSA  150
            DTW+P  GVPY++
Sbjct  551  DTWVPGKGVPYTS  563



>ref|XP_010661658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Vitis vinifera]
 emb|CBI38889.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 128/192 (67%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH++RQF+RDC V GTIDFIFGNAA VFQ+C + +RKPM    + QS M
Sbjct  295  CSFKGYQDTLYVHSNRQFFRDCHVYGTIDFIFGNAAVVFQNCDIYVRKPM----NRQSNM  350

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P+EP GI++  S + ++PE+ T      SFLGRPW++++RTV + + +D  I
Sbjct  351  ITAQGRDIPEEPTGISVQASRVLSSPEFTTVKGSFKSFLGRPWKRYSRTVFLETDLDGLI  410

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW+ + G +GL   +YGE+ N+G GA   +R KW G   +     A  F   +FI G
Sbjct  411  DPRGWTEWSGNYGLSTLYYGEYNNSGGGASTKERVKWPGFHVLNGTEDAMPFTVSRFIQG  470

Query  188  DTWIPASGVPYS  153
            + WIPASGVP+S
Sbjct  471  EKWIPASGVPFS  482



>ref|XP_010440226.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Camelina sativa]
Length=691

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH HRQFYRDC ++GTIDFIFG+A AVFQ+C  +IR+PM N    Q C+
Sbjct  503  CHMNGYQDTLYVHTHRQFYRDCRISGTIDFIFGDAKAVFQNCVFVIRRPMDN----QQCI  558

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI I NS I     YL   +   +FLGRPW++++RT+I+N++ID  I
Sbjct  559  VTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVI  618

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  +  T+ L   +Y E+ N G+G+  ++R KW G++  I+   A EFAPG F+ G
Sbjct  619  DPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRR-ISPRDAREFAPGNFLRG  677

Query  188  DTWIPASGVPYSA  150
            +TWIP + +PY+A
Sbjct  678  NTWIPQTRIPYNA  690



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG++  + Q+CK+++RKPM    +GQSCM
Sbjct  370  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPM----AGQSCM  425

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   EP GI + N  I   P Y+   +   ++LGRPW++ +RT++I + +D  I
Sbjct  426  VTAQGRSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVIKTTVDDVI  485

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  N G GA+ ++R KW G+K  +T  QA  +   +F+ G
Sbjct  486  DPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTHEQALSYTCDRFLSG  544

Query  188  DTWIPASGVPYSA  150
            +TWIP + VPY+A
Sbjct  545  NTWIPRTQVPYTA  557



>ref|XP_010449868.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 43 [Camelina sativa]
Length=691

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH HRQFYRDC ++GTIDF+FG+A AVFQ+C  +IR+PM N    Q C+
Sbjct  503  CHMNGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCVFVIRRPMDN----QQCI  558

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI I NS I     YL   +   +FLGRPW++++RT+I+N++ID  I
Sbjct  559  VTAQGRKDRRETTGIVIHNSRIIGDASYLPVKAKNRAFLGRPWKEYSRTIIMNTEIDDVI  618

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  +  T+ L   +Y E+ N G+G+  ++R KW G++ +  +A A EF+PG F+ G
Sbjct  619  DPEGWLKWNETFALNTLYYTEYRNRGRGSGQARRVKWRGIRRISPRA-AREFSPGNFLRG  677

Query  188  DTWIPASGVPYSA  150
            +TWIP + +PY+A
Sbjct  678  NTWIPQTRIPYNA  690



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 128/191 (67%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY+H+HRQFYRDCT++GT+DFIFG+   V Q C +++RKPM      QSCM
Sbjct  380  CQIDGYQDTLYLHSHRQFYRDCTISGTVDFIFGDGKVVLQKCNIVVRKPM----KSQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+   E  G+ + N  I+  PEY+   S   ++LGRPW+Q +RT+I+ + I+  +
Sbjct  436  ITAQGRTDERESTGLVLDNCHITGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVV  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G++ L   +Y E+ N G G+D S+R KW G+K +  K QA  F P +F+ G
Sbjct  496  DPAGWLPWNGSFALNTLYYAEYENNGLGSDQSQRVKWPGIKKLSPK-QALRFTPARFLRG  554

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  555  NLWIPPTRVPY  565



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  312  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  367

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I+  P+YLT      S+LGRPW++++RT+ +N+ I   I
Sbjct  368  ITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEYSRTIFMNTFIPDFI  427

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G + L+  +Y E  NTG GA V+KR  W G+K  +++ +  +F P ++I G
Sbjct  428  PPEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIKK-LSEEEILKFTPAEYIQG  486

Query  188  DTWIPASGVPY  156
            D WIP  GVPY
Sbjct  487  DAWIPGKGVPY  497



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQ+YRDCT+TGT+DFIFG+  A+FQ+CK+++RKP    G  QSCM
Sbjct  371  CHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGDGVALFQNCKMLVRKP----GDSQSCM  426

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E   I + N  I+  PEY+       ++LGRPW+  AR V++ S+ID  I
Sbjct  427  VTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAYLGRPWKDFARVVVMQSQIDEAI  486

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G+     C+ GE+GN G  AD+++R KW  +K  +T  QA  F P K   G
Sbjct  487  QPEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQRVKWPSLKK-LTADQAATFTPAKLFEG  545

Query  188  DTWIPASGVPY  156
            D WI  SGVPY
Sbjct  546  DRWIKPSGVPY  556



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP++N    Q+C 
Sbjct  372  CKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLN----QACP  427

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I   P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  428  ITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKENSKAYLGRPWKEYSRTIIMNTFIPDFI  487

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GL   +Y E  NTG GA ++KR  W G+K  +++ +   F P ++I G
Sbjct  488  PPEGWQPWLGDFGLNTLFYSEVQNTGPGAPITKRVTWPGIKK-LSEEEILTFTPAQYIQG  546

Query  188  DTWIPASGVPY  156
            D WIP  GVPY
Sbjct  547  DAWIPGKGVPY  557



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H+HRQFYRDCT++GTID+IFG+A + FQ+CK+++RKPM     GQSCM
Sbjct  382  CQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCKMVVRKPM----GGQSCM  437

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  GI + N  I   P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  438  VTAQGRTDKRESTGIILHNCRIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDII  497

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L+   YGE+ N G G+    R KW G+K  ++  QA +F  G+F+ G
Sbjct  498  DPKGWLEWNGNFALDTLEYGEYENNGSGSGQEMRVKWPGIKK-LSARQALQFTAGRFLRG  556

Query  188  DTWIPASGVPYS  153
            +TWIP   VPY+
Sbjct  557  NTWIPRRRVPYT  568



>emb|CDY19737.1| BnaA09g03900D [Brassica napus]
Length=512

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT+TGTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  187  CRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACP  242

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I+   +YL       ++LGRPW+++++T+I+ + I   I
Sbjct  243  ITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFI  302

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGWSP+QG +GL+  +Y E  NTG GA V+ R  W G+K  +++ +  E+ P K+I G
Sbjct  303  PGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEIVEYTPAKYIQG  361

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  362  DDWIPGKGVPYT  373



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 127/193 (66%), Gaps = 9/193 (5%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY   HRQFYRDC ++GTIDFIFG+AAAVFQ+CK+I+RKP    G  QSCM
Sbjct  379  CQIDGYQDTLYTQTHRQFYRDCIISGTIDFIFGDAAAVFQNCKMIVRKP----GPNQSCM  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    EP GI + N  IS    +  A +  +++LGRPW+ ++RT+++ S+ID  I
Sbjct  435  VTAQGRLDKREPTGIVLQNCTISGEKGFDAATT--MAYLGRPWKMYSRTIVMQSQIDNVI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT   E  W+GEF N G GA  ++R KW  +    T  +A  FAPG  +LG
Sbjct  493  NPLGWMEWTGTTNHETSWFGEFSNRGLGAATNQRVKWYKLA---TPEEAGAFAPGSILLG  549

Query  188  DTWIPASGVPYSA  150
            D WI  SGVPY A
Sbjct  550  DKWIMPSGVPYVA  562



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP++N    Q+C 
Sbjct  373  CKFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLLN----QACP  428

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I   P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  429  ITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKEQSKTYLGRPWKEYSRTIIMNTFIPDFV  488

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GL   +Y E  NTG GA ++KR  W G+K  ++  +  +F P ++I G
Sbjct  489  PPEGWQPWLGEFGLNTLFYSEVQNTGPGAAITKRVTWPGIKK-LSDEEILKFTPAQYIQG  547

Query  188  DTWIPASGVPY  156
            D WIP  GVPY
Sbjct  548  DAWIPGKGVPY  558



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQ+TLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP       QSCM
Sbjct  376  CQIDGYQNTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----KRSQSCM  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   EP GI + N  I   P Y+   S   ++LGRPWRQ +RT+I+ + ID  I
Sbjct  432  VTAQGRSDVREPTGIVLHNCHIVGDPAYIPVKSRNKAYLGRPWRQFSRTIIMKTTIDDVI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  +QG   L+  +Y E  N G G++ ++R KW G+K  ++  +A  F   +F+LG
Sbjct  492  DPAGWLLWQGESALKTLFYAEHLNIGPGSNQAQRVKWPGLKK-LSPEEALMFTGNRFLLG  550

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPY+A
Sbjct  551  DTWIPQTHVPYTA  563



>emb|CAN75818.1| hypothetical protein VITISV_005130 [Vitis vinifera]
Length=485

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH++RQF+RDC V GTIDFIFGNAA VFQ+C + +RKPM    + QS M
Sbjct  295  CSFKGYQDTLYVHSNRQFFRDCHVYGTIDFIFGNAAVVFQNCDIYVRKPM----NRQSNM  350

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P+EP GI++  S + ++P + T      SFLGRPW++++RTV + + +D  I
Sbjct  351  ITAQGRDIPEEPTGISVQXSRVLSSPXFTTVKGSFKSFLGRPWKRYSRTVFLETDLDGLI  410

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW+ + G +GL   +YGE+ N+G GA   +R KW G   +     A  F   +FI G
Sbjct  411  DPRGWTEWSGNYGLSTLYYGEYNNSGGGASTKERVKWPGFHVLNGXEDAMPFTVSRFIQG  470

Query  188  DTWIPASGVPYS  153
            + WIPASGVP+S
Sbjct  471  EKWIPASGVPFS  482



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H+HRQFYRDCT++GTID+IFG+A + FQ+C +++RKPM     GQSCM
Sbjct  381  CQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPM----GGQSCM  436

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  GI + N  I+  P Y+       ++LGRPW+Q +RT+I+ + I+  I
Sbjct  437  VTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDII  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L+   Y EF N G G++ + R KW G+K   T  QA EF  GKF+ G
Sbjct  497  DPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQG  555

Query  188  DTWIPASGVPY  156
             TWIP + VPY
Sbjct  556  GTWIPQTQVPY  566



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H+HRQFYRDCT++GTID+IFG+A + FQ+C +++RKPM     GQSCM
Sbjct  394  CQIDGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPM----GGQSCM  449

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  GI + N  I+  P Y+       ++LGRPW+Q +RT+I+ + I+  I
Sbjct  450  VTAQGRTDKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDII  509

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L+   Y EF N G G++ + R KW G+K   T  QA EF  GKF+ G
Sbjct  510  DPKGWLEWNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQG  568

Query  188  DTWIPASGVPY  156
             TWIP + VPY
Sbjct  569  GTWIPQTQVPY  579



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  406  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  462  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  522  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  581

Query  188  DTWIPASGVP  159
            D WI   G P
Sbjct  582  DDWIKPRGHP  591



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 132/194 (68%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLYVH HRQFYRDCT++GTIDFIFG++A++FQ+C ++ RKP+ N    Q  +
Sbjct  360  CRIDGYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCLILARKPLDN----QQNI  415

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    + + I + N  ISA P Y    + + +FLGRPW+ ++RT I+ S+ID  I
Sbjct  416  VTAQGRKMRQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQSQIDDLI  475

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL  C+Y E  N G GAD SKR  W GVK  I  A A +F+  +F+ G
Sbjct  476  HPDGWLPWFGDFGLNTCFYTEVDNRGPGADKSKRVTWKGVKN-IDYAHAKKFSVQQFLHG  534

Query  188  DTWIPASGVPYSAK  147
              W+P +GVP++A+
Sbjct  535  GKWLPRTGVPFTAE  548



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  406  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  462  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  522  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  581

Query  188  DTWIPASGVP  159
            D WI   G P
Sbjct  582  DDWIKPRGHP  591



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  406  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  462  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  522  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  581

Query  188  DTWIPASGVP  159
            D WI   G P
Sbjct  582  DDWIKPRGHP  591



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG++  + Q+CK+++RKPM    +GQSCM
Sbjct  371  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCKIVVRKPM----AGQSCM  426

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   EP GI + N  I   P Y+   +   ++LGRPW++ +RT+++ + +D  I
Sbjct  427  VTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFSRTIVMKTIVDDVI  486

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  N G GA+ ++R KW G+K  +T  QA  +   +F+ G
Sbjct  487  DPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTPEQALSYTGDRFLSG  545

Query  188  DTWIPASGVPYSA  150
            +TWIP + VPY+A
Sbjct  546  NTWIPRTQVPYTA  558



>emb|CDY40719.1| BnaC03g34350D [Brassica napus]
Length=448

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  74   CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  129

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GRS   E  G       I+  P+YL   +   ++LGRPWR+ +RT+I+NS +   +
Sbjct  130  ITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFV  189

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +  +F P +FI G
Sbjct  190  QPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIK-TLSNEEILKFTPDQFIQG  248

Query  188  DTWIPASGVPYS  153
              W+P  GVPY+
Sbjct  249  GIWVPGKGVPYT  260



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 131/194 (68%), Gaps = 6/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H HRQ+YRDCT++GTIDFIFGNA A+ Q+C L++RKP+ N    Q+C+
Sbjct  373  CHIDGYQDTLYAHNHRQYYRDCTISGTIDFIFGNARALIQNCTLLVRKPLDN----QACV  428

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+  +E +   I  S + A PEY      I SFLGRPW+++++T+ + S+I+  I
Sbjct  429  VTANGRTLSNETSAFVIHGSRVVAAPEYPVDDKRIQSFLGRPWKEYSKTIFMASEIEGFI  488

Query  368  APEGWSPFQGTWG-LEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFIL  192
            +PEGWSP+  T   L+ CWY E GN G GAD++ R KW G+K  IT A+A +FAP  ++ 
Sbjct  489  SPEGWSPWDNTADHLDTCWYAEVGNRGPGADLTNRVKWPGIKN-ITMAEAAQFAPTMYMD  547

Query  191  GDTWIPASGVPYSA  150
               WI   G+P+ +
Sbjct  548  SGHWIEGKGIPFDS  561



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY HA RQ+YRDCT+TGTIDFIFG+ +A FQ+CK+I+RKP+ N    Q C+
Sbjct  406  CSMDGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDN----QHCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS I A   Y    + I S+LGRPWR H+RTVI+ + ID  I
Sbjct  462  VTAQGRNVTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G +G+  C+Y E+GN G GA+ + R  W GVK +    +A EF  GKF  G
Sbjct  522  QPQGWLPWEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDG  581

Query  188  DTWIPASGVP  159
            D WI   G P
Sbjct  582  DDWIKPRGHP  591



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 131/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT+TGTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  372  CRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACP  427

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR+ P E  G  +    I+   +YL       ++LGRPW+++++T+I+ + I   I
Sbjct  428  ITAHGRTDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFI  487

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGWSP+QG +GL+  +Y E  NTG GA V+ R  W G+K  +++ +  E+ P K+I G
Sbjct  488  PGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWPGIKK-LSEEEIVEYTPAKYIQG  546

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  547  DDWIPGKGVPYT  558



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 130/194 (67%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H HRQFYR+CT++GTIDFIFGN+A V Q C++++RKP+ N    Q  +
Sbjct  386  CQIDGYQDTLYAHTHRQFYRNCTISGTIDFIFGNSAVVLQKCRIVVRKPLEN----QQNI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR    EP  I + +  I A P      +   S+LGRPW++++RT+I+ + ID  I
Sbjct  442  VTAHGRKDRREPTAIILQSCRIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLI  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVK-GVITKAQADEFAPGKFIL  192
             P+GW P+ G + L+ C+Y E+ N G GA +++R KW G+K  ++T  +A +F  G+FI 
Sbjct  502  NPDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIR  561

Query  191  GDTWIPASGVPYSA  150
            GD+WI  +GVPY +
Sbjct  562  GDSWIKPTGVPYDS  575



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   206 bits (524),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 132/188 (70%), Gaps = 5/188 (3%)
 Frame = -3

Query  719  DAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTA  540
            D YQDTLY H +RQ+YRDCT++GTIDFIFG++  +FQ+C  I+RKPM N    Q+CMVTA
Sbjct  354  DGYQDTLYAHNYRQYYRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDN----QACMVTA  409

Query  539  QGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPE  360
            QGR  P     I I NS I+A P +L+    I ++LGRPW++ +RT+I+ S+ID  I+P+
Sbjct  410  QGRVDPRSVGAIVIQNSHITAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGFISPK  469

Query  359  GWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTW  180
            GWSP+ G + L+  +YGE+ N G G+D++ R  W G++  +T+ +A+E+  G    GD W
Sbjct  470  GWSPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGIQH-MTQQKAEEWTGGAAFRGDEW  528

Query  179  IPASGVPY  156
            I +SGVPY
Sbjct  529  ITSSGVPY  536



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 133/199 (67%), Gaps = 6/199 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DA+QDTLY HAHRQFYRDCT++GTIDFIFG+A AVFQ+C++ ++KP+ N    Q C+
Sbjct  386  CHMDAFQDTLYAHAHRQFYRDCTISGTIDFIFGDALAVFQNCQMFVKKPLEN----QQCI  441

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GRS+    + I + N  ISA P Y    +   ++LGRPW+ ++RT+I+ S+ID  I
Sbjct  442  VTASGRSERRSASAIVLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLI  501

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L  C+Y E+GN G G+  + RAKW G+K +  +   D F P  F  G
Sbjct  502  QPQGWLAWMGNFALNTCFYAEYGNRGAGSATTGRAKWRGIKSMTAQHIVD-FTPKAFFKG  560

Query  188  D-TWIPASGVPYSAK*VSI  135
            D  WI A+GVPYS K +++
Sbjct  561  DDAWITATGVPYSPKLMAV  579



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTL+ H HRQFYRDCT+TGTIDFIFG+AAAVFQ+CK+++RKP+ N    Q+C+
Sbjct  377  CQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLEN----QNCV  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  E  G  + N  I+A PEY        ++LGRPW++++RTV +  +ID  I
Sbjct  433  VTAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G++ L+   Y E+ N G G+    R  W G+K  ++   A  F   KFI G
Sbjct  493  DPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSAQDAAAFTVAKFIGG  551

Query  188  DTWIPASGVPYSA  150
            D WIPA+GV Y++
Sbjct  552  DLWIPATGVSYAS  564



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+ RQFYRDC +TGTIDF+FG+AAAVFQ+CKLI+RKP    G GQ+CM
Sbjct  358  CKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKP----GDGQNCM  413

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P     + + N  I A PE+L    PI +FLGRPW++++RT+I+ S ID  I
Sbjct  414  VTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQSYIDGFI  473

Query  368  APEGWSPFQGT-WGLEDCWYGEFGNTGKGADVSKR-AKWAGVKGVITKAQADEFAPGKFI  195
             P GW+P+  T +G+  CWY E+ N G GA + KR + W G +  I+   A+ F  G FI
Sbjct  474  DPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANSFTAGLFI  533

Query  194  --LGDTWIPASGVPYSA  150
                 +++P + +PY A
Sbjct  534  NPTDSSFLPKADIPYEA  550



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT+TGTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  372  CRFDGYQDTLYAHSHRQFYRDCTITGTIDFLFGDAAAVFQNCTLLVRKPLAN----QACP  427

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I+   +YL       ++LGRPW+++++T+I+ + I   I
Sbjct  428  ITAHGRKDPRESTGFVLQGCTIAGEADYLAVKETSKAYLGRPWKEYSKTIIMETFIPDFI  487

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGWSP+QG +GL+  +Y E  NTG GA V+ R  W G+K  +++ +  E+ P K+I G
Sbjct  488  PGEGWSPWQGNFGLDTLFYSEVRNTGPGAAVANRVTWQGIKK-LSEEEIVEYTPAKYIQG  546

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  547  DDWIPGKGVPYT  558



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 129/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  377  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFVFGDAAAVFQNCTLLVRKPLPN----QACP  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P EP G       I+  P+YL       ++LGRPW++++RT+I+NS I   +
Sbjct  433  ITAHGRQDPREPTGYVFQGCTIAGEPDYLAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFV  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  N G GA ++ R  WAG+K  ++  +  +FAP +FI  
Sbjct  493  QPQGWQPWLGDFGLKTLFYSEVQNIGPGAALASRVTWAGIK-TLSNEEILKFAPAEFIQS  551

Query  188  DTWIPASGVPY  156
            D W+P  GVPY
Sbjct  552  DAWVPGKGVPY  562



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQ+YRDCTVTGTIDFIFGNA  VFQ+C + +R+ M N    Q  +
Sbjct  364  CQFDGYQDTLYTHTSRQYYRDCTVTGTIDFIFGNAQVVFQNCLIQVRRCMDN----QQNI  419

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR +     G  ILN  I   PE+      + +FLGRPW++++RT+ I S+I   I
Sbjct  420  ITAQGRKEKHSAGGTVILNCTIEPHPEFKEHAGRLRTFLGRPWKEYSRTLYIQSEIGGFI  479

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL  C+Y E  N G G+D+SKRAKW GVK V  +    ++   KFI G
Sbjct  480  DPQGWLPWLGDFGLNTCYYAEVDNHGPGSDMSKRAKWRGVKTVTYQQAQQKYTIEKFIQG  539

Query  188  DTWIPASGVPY  156
             TWIP  GVPY
Sbjct  540  QTWIPKYGVPY  550



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GT+DFIFG+A+A+ Q+C + +RKP     S Q   
Sbjct  3    CSFKGYQDTLYVYSQRQFYRDCNIYGTVDFIFGDASAILQNCNIYVRKP----SSNQINT  58

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQ R  P+E  GI I N  I+A P+         ++LGRPW++++R VI+ S +D  I
Sbjct  59   VTAQSRRDPNENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDGLI  118

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            AP+GW P+ G++GL+  +YGE+ NTG GA    R KW G + + +  +A +F  G F+ G
Sbjct  119  APQGWFPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFLAG  178

Query  188  DTWIPASGVPYSA  150
            D W+P +GVP+ A
Sbjct  179  DAWLPGTGVPFEA  191



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H HRQFYRDCT+TGTIDFIFG+AAAVFQ+CK+++RKP+ N    Q+C+
Sbjct  377  CQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLEN----QNCI  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++  E  G  + N  I+A  EY        ++LGRPW++++RTV +  +ID  I
Sbjct  433  VTAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G++ L+   Y E+ N G G+    R  W G+K  ++   AD F   KFI G
Sbjct  493  DPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSAQDADAFTVAKFIGG  551

Query  188  DTWIPASGVPYSA  150
            D WIP +G+ Y++
Sbjct  552  DLWIPDTGISYAS  564



>ref|XP_010513751.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=358

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+AAAVFQ+C + +R+PM + G+    M
Sbjct  168  CSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----M  223

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P    GI+I +S + A PE+        ++LGRPW++++RTV + + +D  I
Sbjct  224  ITAQGRDDPHATTGISIQHSRVRAAPEFEAVKGRFKNYLGRPWKKYSRTVFLKTDLDGLI  283

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G++ L   +YGEF NTG GA+ ++R  W G   +  + +A  F   +FI G
Sbjct  284  DPRGWREWSGSYALSTLYYGEFMNTGAGAETTRRVNWPGFHVLRGEEEASPFTVSRFIQG  343

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  344  DSWIPITGVPFSA  356



>gb|KJB45338.1| hypothetical protein B456_007G302000 [Gossypium raimondii]
Length=588

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVH+ RQFYRDCTVTGTIDF+FG++A++FQ+C  ++RKP+     GQ   
Sbjct  388  CSMDGYQDTLYVHSKRQFYRDCTVTGTIDFVFGDSASIFQNCTFLVRKPL----DGQQNA  443

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   +P GI + NS I A  E ++  +   ++LGRPW   +RT+I+ + ID  +
Sbjct  444  VTAQGRSDVRQPTGIVLQNSRIMAASELVSLKNKYPTYLGRPWGNFSRTIIMETYIDDLV  503

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFIL-  192
             P+GW+ + G+WGL  C+Y EF N G G++ + R KW G+K   +   A +F PG F + 
Sbjct  504  KPDGWAIWDGSWGLSTCFYAEFNNDGPGSNTTSRVKWPGIKN-FSMENAVDFTPGSFFIG  562

Query  191  GDTWIPASGVPYS  153
            GD+WI A  VPY+
Sbjct  563  GDSWIRARNVPYT  575



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLY H++RQFYR CTV+GTIDFIFGNAAAVFQ+CKL+IRKP+ + G    C+
Sbjct  397  CHINGYQDTLYAHSYRQFYRHCTVSGTIDFIFGNAAAVFQNCKLVIRKPLEDEG----CV  452

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQ R    EP G  + N  I A P Y        +FLG PW++ +RT+I+ S +   I
Sbjct  453  ITAQARQHVREPTGFILQNCTIMADPLYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSI  512

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW P+ GT+G   C++ E+ N G GA +  R KW G+K  IT  QAD F P KF  G
Sbjct  513  APEGWKPWMGTFGQSSCFFSEYENRGPGAALLGRVKWHGIKK-ITPQQADGFTPSKFYQG  571

Query  188  DTWIPASGVPYS  153
            + WI  +GVPY 
Sbjct  572  NHWIIPTGVPYE  583



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQ+YRDCT++GT+DFIFG+  A+FQ+C++++RKP    G  QSCM
Sbjct  377  CYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKP----GDSQSCM  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E   I + N  I+  P+Y+       ++LGRPW+  AR V+I S+ID  I
Sbjct  433  VTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDDAI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+ + G      C+  E GN G GAD+SKR KW  +K  +T  QA  F P +   G
Sbjct  493  APEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLKK-LTPEQAAAFTPARLFEG  551

Query  188  DTWIPASGVPY  156
            D W+  SGVPY
Sbjct  552  DKWVKPSGVPY  562



>emb|CDY57858.1| BnaC08g47740D [Brassica napus]
Length=468

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 128/193 (66%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH HRQFYRDC ++GTIDF+FG+A AVFQ+C+ +IR+PM N    Q C+
Sbjct  280  CHMAGYQDTLYVHTHRQFYRDCRISGTIDFVFGDAKAVFQNCEFVIRRPMDN----QQCI  335

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E  GI I NS I+    Y        +FLGRPW++++RT+I+N+ ID  I
Sbjct  336  VTAQGRKDRRETTGIVIHNSRITGDATYRPVKDKNRAFLGRPWKEYSRTIIMNTDIDDVI  395

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  +  T+ L+  +Y E+ N G+G+  ++R +W G++  I+  QA  FAPG+F+ G
Sbjct  396  DPEGWLKWNETFALKTLFYSEYRNRGRGSGQARRVRWRGIQR-ISARQARGFAPGEFLRG  454

Query  188  DTWIPASGVPYSA  150
            + WI    +PY+A
Sbjct  455  NAWITKRRIPYNA  467



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQFYRD T++GT+DFIFG++ A+FQ+C +++RKPM     GQ CM
Sbjct  380  CQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+    P  I + N  I   P YL   +   ++LGRPW++ ART+++ + I   I
Sbjct  436  VTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW+ + G + L+  +Y E+ N+G G++ ++R KW G++  IT+ QA  FAPG+F+ G
Sbjct  496  DPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQR-ITRPQALGFAPGRFLRG  554

Query  188  DTWIPASGVPY  156
             +WIP +GVPY
Sbjct  555  GSWIPQTGVPY  565



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQF+RDCTV+GT+DFIFG+   V Q+C +++RKPM      QSCM
Sbjct  381  CQIDGYQDTLYVHSHRQFFRDCTVSGTVDFIFGDGIVVLQNCNIVVRKPM----KSQSCM  436

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGRS   E  G+ + N  I+  P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  437  ITAQGRSDKRESTGLVLQNCHITGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +Y E+ N G G++ ++R KW G+K +  K QA  F P +F+ G
Sbjct  497  DPAGWLPWNGDFALNTLYYAEYENNGPGSNQAQRVKWPGIKKLSPK-QALRFTPARFLRG  555

Query  188  DTWIPASGVPY  156
            + WIP + VPY
Sbjct  556  NLWIPPNRVPY  566



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HRQFYRD T++GT+DFIFG++ A+FQ+C +++RKPM     GQ CM
Sbjct  380  CQIDGYQDTLYVHSHRQFYRDSTISGTVDFIFGDSIAIFQNCNIVVRKPM----GGQGCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+    P  I + N  I   P YL   +   ++LGRPW++ ART+++ + I   I
Sbjct  436  VTAQGRTDVRAPTAIVLHNCRIIGEPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW+ + G + L+  +Y E+ N+G G++ ++R KW G++  IT+ QA  FAPG+F+ G
Sbjct  496  DPAGWAAWSGDFALKTLFYAEYENSGPGSNKAQRVKWPGIQR-ITRPQALGFAPGRFLRG  554

Query  188  DTWIPASGVPY  156
             +WIP +GVPY
Sbjct  555  GSWIPQTGVPY  565



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 129/200 (65%), Gaps = 5/200 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVH+ RQFYRDCT+TGTIDF+FG+AAAVFQ+C  ++R P+    +GQ C+
Sbjct  410  CSMDGYQDTLYVHSKRQFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPL----NGQQCI  465

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   +P  I I NS  +A PE +       ++LGRPW   +RT+I+ S +D  I
Sbjct  466  VTAQGRTDARQPTAIVIQNSTFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLI  525

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW+ + G WGL   +Y EF N G G++ + R  W G+K  I++A A  F PGKFI G
Sbjct  526  KPEGWAIWDGPWGLNTSFYSEFNNYGPGSNKTGRVTWRGIKR-ISQATAFGFTPGKFING  584

Query  188  DTWIPASGVPYSAK*VSITS  129
              WI    VPY+    SI S
Sbjct  585  AAWIKPRRVPYTPGFFSINS  604



>gb|KEH15723.1| pectinesterase [Medicago truncatula]
Length=228

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    +QDTLYV+A+RQFYRDC + GTIDFIFGNA  V Q+C + +RKPM N    Q   
Sbjct  38   CAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSN----QQNT  93

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI I N  I+A+ +     + + ++LGRPW++++RTV++ S +D  I
Sbjct  94   VTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLI  153

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW+P+ G + L   +YGE+ N G GA+   R KW G   +   + A +F+ G F+ G
Sbjct  154  NSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAG  213

Query  188  DTWIPASGVPYSA  150
            D+WI  SGVP+ A
Sbjct  214  DSWISGSGVPFDA  226



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYR+C + GT+DFIFG+A  VFQSC + +RKPM    SGQ   
Sbjct  332  CSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGDAVVVFQSCNIYVRKPM----SGQQNT  387

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI+I NS+++A  +         ++LGRPW++++RTV + + +D+ I
Sbjct  388  VTAQGRTDHNENTGISIHNSIVTAASDLRPVQGSFKTYLGRPWQKYSRTVFMKTSLDSLI  447

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G++GL   +Y E+ NTG GAD SKR  W G   + + ++A +F  G F+ G
Sbjct  448  NPAGWLEWSGSFGLSTLYYAEYMNTGAGADTSKRVNWPGYHVIASSSEASKFTVGGFLSG  507

Query  188  DTWIPASGVPYS  153
            D+WIPA+GVP+S
Sbjct  508  DSWIPATGVPFS  519



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  371  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  426

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I   P+YL       S+LGRPW++ +RT+I+N+ I   I
Sbjct  427  ITAHGRKDPRESTGFVLQGCTIVGEPDYLAVKETSKSYLGRPWKEFSRTIIMNTFIPDFI  486

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G +GLE  +Y E  N G G+ ++KR  W G+K  +++ +   F P ++I G
Sbjct  487  PPEGWQPWLGNFGLETLFYSEVRNIGPGSGLTKRVTWPGIKK-LSEEEILTFTPAQYIQG  545

Query  188  DTWIPASGVPY  156
            D WIP  GVPY
Sbjct  546  DAWIPGKGVPY  556



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D +QDTLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQ+CM
Sbjct  373  CQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCM  428

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ +    I+  P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  429  VTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  488

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  NTG G++ ++R KW G+K  +T   A  +   +F+ G
Sbjct  489  DPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRG  547

Query  188  DTWIPASGVPYSAK  147
            DTWIP + VPY+AK
Sbjct  548  DTWIPQTQVPYTAK  561



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D +QDTLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQ+CM
Sbjct  379  CQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCM  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ +    I+  P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  435  VTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  NTG G++ ++R KW G+K  +T   A  +   +F+ G
Sbjct  495  DPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRG  553

Query  188  DTWIPASGVPYSAK  147
            DTWIP + VPY+AK
Sbjct  554  DTWIPQTQVPYTAK  567



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 127/191 (66%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H+ R F+RDCT++GTID+IFGN  ++FQ+CK++IRKPM+N    Q+ +
Sbjct  400  CQMDGYQDTLYAHSGRHFFRDCTISGTIDYIFGNGESIFQNCKMVIRKPMVN----QANI  455

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    E + I +    ISA P  +   +   S+LGRPW++ +RT+I+ + ID  I
Sbjct  456  VTAQGRKTEREVSAIVLQGCTISADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDSI  515

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            +P+GW P+ G +GL+ C+Y EF N G GA ++ R KW G+K  +T  QA E+    +I  
Sbjct  516  SPDGWMPWMGDFGLQTCYYAEFNNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQA  575

Query  188  DTWIPASGVPY  156
            D W+   G+PY
Sbjct  576  DDWVKPLGIPY  586



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D +QDTLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQ+CM
Sbjct  379  CQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQTCM  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ +    I+  P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  435  VTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  NTG G++ ++R KW G+K  +T   A  +   +F+ G
Sbjct  495  DPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRG  553

Query  188  DTWIPASGVPYSAK  147
            DTWIP + VPY+AK
Sbjct  554  DTWIPQTQVPYTAK  567



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG+A  + Q+C +++RKP      GQSCM
Sbjct  380  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKP----KRGQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ + N  I   P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  436  VTAQGRSDVRESTGLVLHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P++G + L+  +Y E  N G G++ + R KW G+K  ++  +A  +  G+F++G
Sbjct  496  DPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVG  554

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPYSA
Sbjct  555  DTWIPQTQVPYSA  567



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  432  ITAHGRKDPREVTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG G+ ++ R  WAG+K  ++     +F P ++I G
Sbjct  492  QPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSDEDILKFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            DTW+P  GVPY+
Sbjct  551  DTWVPGKGVPYT  562



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGNAA VFQSC +  R P       ++  
Sbjct  70   CSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVFQSCNIYARNP-----PNKTNT  124

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI+ILNS ++A  +     S + ++LGRPW++++RTV + + +D  I
Sbjct  125  ITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFLDGLI  184

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +YGE+ NTG G+  +KR  W G   + +  +A +F  G FI G
Sbjct  185  NPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGNFIAG  244

Query  188  DTWIPASGVPYSA  150
             +W+PA+ VP+++
Sbjct  245  SSWLPATNVPFTS  257



>emb|CDX71786.1| BnaC08g30880D [Brassica napus]
Length=522

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+AAAVFQ+C + +R+PM + G+    M
Sbjct  332  CSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----M  387

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P E  GI+I NS + A+PE+        S+LGRPW++++RTV + + +D  I
Sbjct  388  ITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLI  447

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  ++G + L   +YGEF NTG GA  S+R  W G   +    +A  F   +FI G
Sbjct  448  DPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQG  507

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  508  DSWIPITGVPFSA  520



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D +QDTLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQSCM
Sbjct  381  CQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----NKGQSCM  436

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ +    I+  P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  437  VTAQGRSNVRESTGLVLHGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  496

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  NTG G++ ++R KW G+K  +T   A  +   +F+ G
Sbjct  497  DPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRG  555

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPY+A
Sbjct  556  DTWIPQTQVPYTA  568



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  432  ITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG G+ ++ R  WAG+K  +++    +F P ++I G
Sbjct  492  QPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  551  DDWIPGKGVPYT  562



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG+A  + Q+C +++RKP      GQSCM
Sbjct  380  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKP----KRGQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ + N  I   P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  436  VTAQGRSDVRESTGLVLHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P++G + L+  +Y E  N G G++ + R KW G+K  ++  +A  +  G+F++G
Sbjct  496  DPAGWLPWKGDFALKTLYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVG  554

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPYSA
Sbjct  555  DTWIPQTQVPYSA  567



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 129/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYV++ RQFYRDC + GT+DFIFG+AA VFQ+C + +RKPM    SGQ   
Sbjct  325  CSFEGYQDTLYVYSQRQFYRDCNIYGTVDFIFGDAAVVFQNCDMYVRKPM----SGQKNT  380

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI+I +S ++A  +         ++LGRPW++++RTV + + +D+ I
Sbjct  381  VTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFQTYLGRPWQKYSRTVYMKTSLDSLI  440

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ NTG GAD S+R  W G   + + A A +F  G F+ G
Sbjct  441  DPAGWLEWNGDFALSTLYYGEYMNTGAGADTSRRVNWPGYHVITSAAVASQFTVGNFLSG  500

Query  188  DTWIPASGVPYSA  150
             +WIPA+GVPY++
Sbjct  501  GSWIPATGVPYTS  513



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 128/191 (67%), Gaps = 7/191 (4%)
 Frame = -3

Query  725  QXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCMV  546
              D YQDTLY HA+RQFYRDC +TGTIDFIFG+A A+FQ C+L++R+PM +    Q+CMV
Sbjct  394  HMDGYQDTLYAHAYRQFYRDCQITGTIDFIFGDAVAIFQKCRLVVRQPMDD----QACMV  449

Query  545  TAQGRSQPDEPNGIAILNSV-ISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            TAQGR +     G+ +L    I A P +L    P+ ++LGRPW++++RT+++ S ID  I
Sbjct  450  TAQGR-KDQRSVGVTVLQGCDIVADPAFLAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFI  508

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGWSP+ G + L   +YGE+ N G G+ +S R  W G+K  IT A A  F PG     
Sbjct  509  APEGWSPWMGNYALSTLYYGEYQNRGAGSGLSGRVTWKGIKK-ITPAIAQSFTPGVVYKN  567

Query  188  DTWIPASGVPY  156
            DTW+  SG+PY
Sbjct  568  DTWVSTSGIPY  578



>emb|CDX80933.1| BnaC03g01870D [Brassica napus]
Length=352

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 125/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GTIDFIFGNAAAVFQ+C +  RKPM      Q   
Sbjct  159  CSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAVFQNCNIYARKPM----EHQKNA  214

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  215  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  274

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W+G   ++  AQA  F    F LG
Sbjct  275  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGYS-LLNLAQAMNFTVYNFTLG  333

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  334  DTWLPQTDIPF  344



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  DAYQDTLY   +RQ+YRDCT++GT+DFIFG+  A+FQ+C++++RKP    G  QSCM
Sbjct  378  CYIDAYQDTLYTQTYRQYYRDCTISGTVDFIFGDGVAMFQNCRMVVRKP----GDSQSCM  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E   I + N  I+  P+Y+       ++LGRPW+  AR V+I S+ID  I
Sbjct  434  VTAQGRTDKNEITAIVLQNCTITGEPDYMAVKDKNKAYLGRPWKGFARVVVIQSQIDNAI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            APEGW+ + G      C+  E GN G GAD+SKR KW  +   +T  QA  F P +   G
Sbjct  494  APEGWTEWTGEKFHTSCFVAESGNRGAGADMSKRVKWQTLMK-LTPEQAAAFTPARLFEG  552

Query  188  DTWIPASGVPY  156
            D W+  SGVPY
Sbjct  553  DKWVKPSGVPY  563



>gb|KJB38562.1| hypothetical protein B456_006G260800 [Gossypium raimondii]
Length=561

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY H  RQ Y +C +TGT+DFIFG+AA++FQ+C L++RKP    G GQ+CM
Sbjct  368  CHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAASIFQNCMLVVRKP----GPGQNCM  423

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+     + I + N  IS  P+Y+       ++LGRPW+Q AR++I+ S+ID  I
Sbjct  424  VTAQGRNDLGTNSAIVLQNCTISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSRIDDII  483

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEG++P  GT G++  +  EFGN G GAD S+R  W G+K  I   +A+++ P  F+  
Sbjct  484  QPEGYAPMTGTIGIDTSFIAEFGNRGPGADTSRRVAWKGIKK-IDINEANKWTPRVFLES  542

Query  188  DTWIPASGVPYS  153
            +TWIP+SG+PYS
Sbjct  543  ETWIPSSGIPYS  554



>ref|XP_006402549.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
 gb|ESQ44002.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
Length=519

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+A AVFQ+C + +R+PM + G+    M
Sbjct  329  CSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDAVAVFQNCDIFVRRPMDHQGN----M  384

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P E  GI+I +S + A PE+        S+LGRPW++++RTV + ++ID  I
Sbjct  385  ITAQGRDNPHENTGISIQHSRVRAAPEFEAVKGRFKSYLGRPWKKYSRTVFLKTEIDGLI  444

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  ++G + L   +YGEF NTG GA  S+R  W G   +  + +A  F   +FI G
Sbjct  445  DPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVNWPGFHLLHGEEEASPFTVSRFIQG  504

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  505  DSWIPITGVPFSA  517



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  374  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  429

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    I+   +YL       ++LGRPW+++++T+I+N+ I   +
Sbjct  430  ITAHGRKDPRESTGFVLQGCRIAGESDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFV  489

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              +GW P+QG +GL+  +Y E  NTG GA V+ R  W G+K  +++ +  EF P ++I G
Sbjct  490  PAQGWQPWQGNFGLDTLFYSEVRNTGPGAPVTNRVTWPGIKK-LSEEEVLEFTPSRYIQG  548

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  549  DAWIPGKGVPYT  560



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 128/193 (66%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C V GT+DF+FGNAA V Q+C ++ RKP  N    Q  M
Sbjct  393  CTFEGYQDTLYVHSLRQFYRECDVYGTVDFVFGNAAVVLQNCNIMARKPSAN----QKIM  448

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGR  P++  GI+I N  +SAT + + A S    +LGRPW+Q++RTVI+ S +D  I
Sbjct  449  YTAQGREDPNQNTGISIQNCRLSATSDLVAAKSSFQVYLGRPWKQYSRTVILQSHLDDLI  508

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ N G GA  + R KW G + + + ++A++F   +F+ G
Sbjct  509  HPAGWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHRVITSSSEANQFTVNQFLQG  568

Query  188  DTWIPASGVPYSA  150
            D+W+PA+GV Y+A
Sbjct  569  DSWLPATGVQYTA  581



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 130/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGN+A V Q+C +  RKPM     GQ C+
Sbjct  241  CGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPM----QGQQCV  296

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I NS + AT +       + ++LGRPW++++RTV + S +D+ +
Sbjct  297  VTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLV  356

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGEF N+G G+  + R KW G + + + ++A +F  G FI G
Sbjct  357  NPAGWLEWSGNFALNTLYYGEFKNSGLGSSTANRVKWKGYRVITSASEAAKFTVGSFISG  416

Query  188  DTWIPASGVPYSA  150
            ++W+P +GVP++A
Sbjct  417  NSWLPGTGVPFTA  429



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVHA RQFYRDCT++GTIDF+FGNA +VFQ+CK ++RKPM    S Q C+
Sbjct  378  CSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPM----SDQQCI  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +   P+ I I    I A PE+        S+L RPW+  +RT+I+++ ID  I
Sbjct  434  VTAQGRKERTAPSAIVIEGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLI  493

Query  368  APEGWSPF---QGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
             P+G+ P+   +G   ++ C+Y E+ N G G+D SKR KWAG+  + TKA A +FAP KF
Sbjct  494  HPDGFLPWHTEEGPINMDTCYYAEYHNYGPGSDKSKRVKWAGIYNINTKA-AQKFAPSKF  552

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  553  FHGGDWIKDTGIPY  566



>emb|CDY41145.1| BnaA09g38700D [Brassica napus]
Length=521

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+A+AVFQ+C + +R+PM + G+    M
Sbjct  331  CSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDASAVFQNCDIFVRRPMDHQGN----M  386

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P E  GI+I NS + A+PE+        S+LGRPW++++RTV + + +D  I
Sbjct  387  ITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLI  446

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  ++G + L   +YGEF NTG GA  S+R  W G   +    +A  F   +FI G
Sbjct  447  DPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQG  506

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  507  DSWIPITGVPFSA  519



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H +RQFYRDC +TGTIDFIFG+AA  FQ+C  ++RKP+ N    Q+C+
Sbjct  406  CHFDGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKPLEN----QNCI  461

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P GI I NS   A P+Y    +   ++LGRPW+++++T+I+ S+I   I
Sbjct  462  VTAQGRMERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIMESEIGDLI  521

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P++G +GL+  +YGE+ N G GA ++ R KW GVK ++ + +A++F P      
Sbjct  522  QPEGWLPWEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVKTIV-RTRAEKFMPPILYEN  580

Query  188  DTWIPASGVPY  156
            D WI  SG+PY
Sbjct  581  DDWIRDSGIPY  591



>ref|XP_009116752.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Brassica rapa]
Length=521

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+A+AVFQ+C + +R+PM + G+    M
Sbjct  331  CSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDASAVFQNCDIFVRRPMDHQGN----M  386

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P E  GI+I NS + A+PE+        S+LGRPW++++RTV + + +D  I
Sbjct  387  ITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSYLGRPWKKYSRTVFLKTDLDGLI  446

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  ++G + L   +YGEF NTG GA  S+R  W G   +    +A  F   +FI G
Sbjct  447  DPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWPGFHVLHGADEASPFTVSRFIQG  506

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  507  DSWIPITGVPFSA  519



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 124/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY+H+ RQF+R C + GT+DFIFGNAAAV Q C + +R+P  N    Q  M
Sbjct  376  CDILGYQDTLYLHSLRQFFRGCLIQGTVDFIFGNAAAVLQDCDIQVRRPNPN----QKNM  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR  P+EP GI I  S I+A P+         ++LGRPW+++ARTVI+ S+I   I
Sbjct  432  VTASGRDDPNEPTGIVIHRSRITAAPDLAPVQGSFRTYLGRPWKEYARTVIMESEISDVI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + GT+ L+  +YGE+ NTG GA    R +W G K + + A+A EF PG FI G
Sbjct  492  EPEGWHEWSGTFALDTLYYGEYRNTGAGAGTGSRVQWKGYKVITSAAEAAEFTPGSFIAG  551

Query  188  DTWIPASGVPYS  153
             +W+ A+G PYS
Sbjct  552  SSWLEATGFPYS  563



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  432  ITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  W G+K  ++  +  +F P ++I G
Sbjct  492  QPQGWQPWLGNFGLDTLFYSEVQNTGPGAALASRVTWPGIK-TLSNDEILKFTPDQYIQG  550

Query  188  DTWIPASGVPYS  153
            + W+P  GVPY+
Sbjct  551  NVWVPGKGVPYT  562



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GRS   E  G       I+  P+YL   +   ++LGRPWR+ +RT+I+NS +   +
Sbjct  432  ITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +  +F P +FI G
Sbjct  492  QPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKK-LSNEEILKFTPDQFIQG  550

Query  188  DTWIPASGVPYS  153
              W+P  GVPY+
Sbjct  551  GIWVPGKGVPYT  562



>gb|KEH29120.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=489

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 122/190 (64%), Gaps = 4/190 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQDTLYVH++RQFYRDC + GTIDFIFG+AA V Q+C + IRKPM    S QS  
Sbjct  299  CSFKAYQDTLYVHSNRQFYRDCHIYGTIDFIFGDAAVVLQNCDIFIRKPM----SHQSNF  354

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P++P GI+I N  +    ++      I SFLGRPW++++RTV I S +D  I
Sbjct  355  ITAQGRDDPNKPTGISIQNCRVRPDSDFSMVKDSIKSFLGRPWKKYSRTVFIKSDLDGLI  414

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  ++G + L   +YGE+ NTG GA    R  W G   + +  +A +F   +F+ G
Sbjct  415  HPKGWGEWEGNFALSTLYYGEYMNTGNGASTQNRVNWPGFHVLKSSDEASQFTVSRFLQG  474

Query  188  DTWIPASGVP  159
            + WI ASGVP
Sbjct  475  EHWISASGVP  484



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 130/194 (67%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVH  RQFYRDCT++GTIDF+FGNA AVFQ+C  ++RKPM N    Q C+
Sbjct  377  CSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMKN----QQCI  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+GI I    I + PE+ +      ++L RPW+ ++RT+I+++ ID  I
Sbjct  433  VTAQGRKEKQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTNIDDLI  492

Query  368  APEGWSPFQ---GTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
              +G+ P+Q   G  G++ C+Y E+ NTG G+D SKR  W+G+  + +KA A  F+P KF
Sbjct  493  HADGYLPWQGPEGPTGMDTCFYAEYHNTGPGSDKSKRVNWSGIWNLNSKA-AHSFSPSKF  551

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  552  FHGTNWIQVTGIPY  565



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GRS   E  G       I+  P+YL   +   ++LGRPWR+ +RT+I+NS +   +
Sbjct  432  ITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +  +F P +FI G
Sbjct  492  QPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKK-LSNEEILKFTPDQFIQG  550

Query  188  DTWIPASGVPYS  153
              W+P  GVPY+
Sbjct  551  GIWVPGKGVPYT  562



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GRS   E  G       I+  P+YL   +   ++LGRPWR+ +RT+I+NS +   +
Sbjct  432  ITAHGRSDAREATGFVFQGCTIAGEPDYLAVKATSKAYLGRPWREFSRTIIMNSFLPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +  +F P +FI G
Sbjct  492  QPQGWMPWMGNFGLDTLFYSEAQNTGPGAGLANRVTWAGIKK-LSNEEILKFTPDQFIQG  550

Query  188  DTWIPASGVPYS  153
              W+P  GVPY+
Sbjct  551  GIWVPGKGVPYT  562



>ref|XP_006361902.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=564

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ + YQDTLYVH+ RQFYRDC + GT+DFIFGNAAA+FQ+C L  RKPM +    Q  +
Sbjct  375  CRFEGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNI  430

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGRS P++  GI+I N  I A P+    P+  +SFLGRPW  ++RTVI+ S I   I
Sbjct  431  FTAQGRSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYIGDVI  490

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+GL+  +YGEF N G GA+ + R +W G   ++   QA  F    F +G
Sbjct  491  TPVGWLEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNALQAMNFTVYNFTMG  549

Query  188  DTWIPASGVPYS  153
            DTW+P + VP+S
Sbjct  550  DTWLPYTNVPFS  561



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG++AAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  432  ITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +   F P ++I G
Sbjct  492  QPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            D W+P  GVPY+
Sbjct  551  DIWVPGKGVPYT  562



>ref|XP_002876579.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+A AVFQ+C + +R+PM + G+    M
Sbjct  330  CSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDATAVFQNCDIFVRRPMDHQGN----M  385

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P   +GI+I +S I A PE+        S+LGRPW++++RTV++ + ID  I
Sbjct  386  ITAQGRDDPHSNSGISIQHSRIRAAPEFEAVKGRFKSYLGRPWKKYSRTVLLKTDIDELI  445

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G++ L   +YGEF NTG GA  S+R  W G   +  + +A  F   +FI G
Sbjct  446  DPRGWREWSGSYALSTLYYGEFMNTGAGAGTSRRVNWPGFHVLRGQEEASPFTVSRFIQG  505

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  506  DSWIPITGVPFSA  518



>ref|XP_009142158.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Brassica rapa]
 emb|CDY30378.1| BnaA04g24790D [Brassica napus]
Length=516

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 129/193 (67%), Gaps = 13/193 (7%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQD+LY H+ RQFYRD  +TGT+D+IFGN+AAVFQSC ++ RKP+    SGQ+  
Sbjct  333  CSIEGYQDSLYTHSKRQFYRDTDITGTVDYIFGNSAAVFQSCNIVARKPL----SGQTNF  388

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS P +  GI+I N  I+A            ++LGRPW++++RTV++ S +D  I
Sbjct  389  VTAQGRSNPGQNTGISIQNCKITAQS---------TTYLGRPWKEYSRTVVMQSFLDGSI  439

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWSP+ G +GL+  +YGEFGN+G G+ VS R KWAG    +T  +A+ F    FI G
Sbjct  440  HPSGWSPWSGGFGLKTLFYGEFGNSGPGSSVSGRVKWAGYHSSLTVKEAEGFTVANFIGG  499

Query  188  DTWIPASGVPYSA  150
              W+P++GV + +
Sbjct  500  TMWLPSTGVSFDS  512



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQ+TLY H+HRQF+RDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQNTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   +
Sbjct  432  ITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFV  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG G+ ++ R  WAG+K  +++    +F P ++I G
Sbjct  492  QPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIK-TLSEEDILKFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  551  DDWIPGKGVPYT  562



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = -3

Query  719  DAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTA  540
            D +QDTLY HAHRQFYR+C ++GTIDF+FGNA ++FQ+C+ I+RKPM N    Q+CMVTA
Sbjct  350  DGFQDTLYAHAHRQFYRNCRISGTIDFVFGNALSIFQNCQFIVRKPMAN----QACMVTA  405

Query  539  QGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPE  360
            QGR Q +    I I N  I A   ++ A   + ++LGRPW+Q + T+I++S I   I+P+
Sbjct  406  QGRDQRNSNGAIVIQNGEIRAEQAFINAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQ  465

Query  359  GWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTW  180
            GW+P+ G++ L+ C+Y E+ N G G++ S+R KW G+K +  +  A  +APGK    D W
Sbjct  466  GWAPWAGSFALDTCYYAEYRNRGPGSNTSQRVKWKGIKHIDPQTAA-RYAPGKAYGDDQW  524

Query  179  IPASGVPY  156
            I  +GVPY
Sbjct  525  IRRAGVPY  532



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 130/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG+A  + Q+CK+++RK       GQSCM
Sbjct  380  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKA----KRGQSCM  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ + N  I   P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  436  VTAQGRSDVRESTGLVLHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P++G + L+  +Y E  N G G++ + R KW G+K  ++  +A  +  G+F++G
Sbjct  496  DPAGWLPWKGDFALKTLYYAEHLNAGAGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVG  554

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPY+A
Sbjct  555  DTWIPQTQVPYTA  567



>ref|XP_006361900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25-like 
[Solanum tuberosum]
Length=566

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ + YQDTLYVH+ RQFYRDC + GT+DFIFGNAAA+FQ+C L  RKPM +    Q  +
Sbjct  377  CRFEGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNI  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGRS P++  GI+I N  I A P+    P+  +SFLGRPW  ++RTVI+ S I   I
Sbjct  433  FTAQGRSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYIGDVI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+GL+  +YGEF N G GA+ + R +W G   ++   QA  F    F +G
Sbjct  493  TPVGWLEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNALQAMNFTVYNFTMG  551

Query  188  DTWIPASGVPYS  153
            DTW+P + VP+S
Sbjct  552  DTWLPYTNVPFS  563



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 127/189 (67%), Gaps = 5/189 (3%)
 Frame = -3

Query  719  DAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTA  540
            D YQDTLY H +RQ+YRD T++GTIDFIFG++ A FQ+CK I+RKPM N    Q+CMVTA
Sbjct  395  DGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMEN----QACMVTA  450

Query  539  QGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPE  360
            QGR  P     I I N  I+A P +L    PI ++LGRPW++ +RT+I+ + I   IAPE
Sbjct  451  QGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPE  510

Query  359  GWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTW  180
            GWSP+ G + L+ C+YGE+ N G G+ ++KR  W G+K  IT   A  +  G    GD W
Sbjct  511  GWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDDW  569

Query  179  IPASGVPYS  153
            I +SGVPY+
Sbjct  570  IKSSGVPYN  578



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    +QDTLYV+A+RQFYRDC + GTIDFIFGNA  V Q+C + +RKPM N    Q   
Sbjct  182  CAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPMSN----QQNT  237

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI I N  I+A+ +     + + ++LGRPW++++RTV++ S +D  I
Sbjct  238  VTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLI  297

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW+P+ G + L   +YGE+ N G GA+   R KW G   +   + A +F+ G F+ G
Sbjct  298  NSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAG  357

Query  188  DTWIPASGVPYSA  150
            D+WI  SGVP+ A
Sbjct  358  DSWISGSGVPFDA  370



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 132/193 (68%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  +AYQDTLYVH+ RQFY++C + GTIDFIFGNAAAV Q CK+  R+PM+     Q  +
Sbjct  340  CSFEAYQDTLYVHSQRQFYKECDIYGTIDFIFGNAAAVLQDCKIYARRPMVK----QKNV  395

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I NS + A+P+ +       SFLGRPW+ ++RTV + + ID+ I
Sbjct  396  VTAQGRTDPNQNTGISIHNSRVMASPDLVPVLGSFRSFLGRPWKLYSRTVYMQTYIDSLI  455

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G++ L+  +YGE+ N+G G++ ++R  W+G + +   ++A  F    FI G
Sbjct  456  DPVGWLEWDGSFALDTLYYGEYRNSGPGSNTTRRVNWSGYRVITNASEASTFTVANFIAG  515

Query  188  DTWIPASGVPYSA  150
             +W+PA+GVP++A
Sbjct  516  QSWLPATGVPFTA  528



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 6/195 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH +RQFYRDCT+TGT+DFIFGN  AV Q+CK+I+RKP  N    QSCM
Sbjct  179  CQIDGYQDTLYVHTYRQFYRDCTITGTVDFIFGNGEAVLQNCKVIVRKPAQN----QSCM  234

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++P +   I + N  I    +Y +   P  ++LGRPW++++RT+I+ S ID  I
Sbjct  235  VTAQGRTEPIQKGAIVLQNCEIKPDTDYFSLSPPSKTYLGRPWKEYSRTIIMQSYIDKFI  294

Query  368  APEGWSPFQGT-WGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFIL  192
             PEGW+P+  T +G +  +Y E+ N G GA + KR  W G +   T   A +F  G +I 
Sbjct  295  EPEGWAPWNITNFGRDTSYYAEYQNRGPGAALDKRITWKGFQKGFTGEAAQKFTAGVYIN  354

Query  191  GD-TWIPASGVPYSA  150
             D  W+  + VPY A
Sbjct  355  NDENWLQKANVPYEA  369



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVHA RQFYRDCT++GTIDF+FGNA +VFQ+CK ++RKPM    S Q C+
Sbjct  383  CSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPM----SNQQCI  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +   P+ I I    I A PE+        S+L RPW+  +RT+I+++ ID  I
Sbjct  439  VTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLI  498

Query  368  APEGWSPF---QGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
             P+G+ P+   +G   ++ C+Y E+ N G G+D SKR KWAG+  + TKA A +FAP KF
Sbjct  499  HPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGIYNINTKA-AQKFAPSKF  557

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  558  FHGGDWIKDTGIPY  571



>emb|CDX70179.1| BnaA10g25280D [Brassica napus]
Length=598

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGNAAAVFQ+C +  RKPM+N    Q   
Sbjct  405  CSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMVN----QKNA  460

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  461  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  520

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W G   ++  AQA  F    F LG
Sbjct  521  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWVGY-SLLNLAQAMNFTVYNFTLG  579

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  580  DTWLPQTDIPF  590



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 130/192 (68%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ +QFYR+C + GTIDFIFG+A  VFQ+C + +RKPM    +GQ   
Sbjct  325  CSFEGYQDTLYVHSKQQFYRNCNIYGTIDFIFGDATVVFQNCNIYVRKPM----TGQKNT  380

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+      GI+I +SV++A P+     S   ++LGRPW++++RTV + + +D+ I
Sbjct  381  VTAQGRTDERTDTGISIHDSVVTAAPDLKPVQSSFQTYLGRPWKKYSRTVYMKTFLDSLI  440

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L+  +YGE+ NTG GAD S+R  W G   + + A+A +F  G F+ G
Sbjct  441  DPAGWLEWDGDFALKTLYYGEYMNTGAGADTSQRVTWPGYHVITSAAEASQFTVGNFLSG  500

Query  188  DTWIPASGVPYS  153
            ++WIPA+GVPY+
Sbjct  501  NSWIPATGVPYT  512



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 130/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGN+A V Q+C +  RKPM     GQ C+
Sbjct  330  CGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNSAVVLQNCMIYARKPM----QGQQCV  385

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I NS + AT +       + ++LGRPW++++RTV + S +D+ +
Sbjct  386  VTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSLV  445

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGEF N+G G+  + R KW G + + + ++A +F  G FI G
Sbjct  446  NPAGWLEWSGNFALNTLYYGEFKNSGPGSSTANRVKWKGYRVITSASEAAKFTVGSFIAG  505

Query  188  DTWIPASGVPYSA  150
            ++W+P +GVP++A
Sbjct  506  NSWLPGTGVPFTA  518



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQD+LYVH++RQF+  C V GT+DFIFGNAA V Q+C +  RKP     SGQ  M
Sbjct  43   CDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAVVLQNCDIHARKP----NSGQKNM  98

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI I  S I AT +   +     +FLGRPW++++RTVI+ S I   I
Sbjct  99   LTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSRTVIMQSSITDII  158

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+ L   +YGE+ NTG GA  SKR  W G K + +  +A  + PG+FI G
Sbjct  159  DPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTEAQAYTPGRFIAG  218

Query  188  DTWIPASGVPYS  153
             +W+ ++G P++
Sbjct  219  GSWLSSTGFPFA  230



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   205 bits (521),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 127/193 (66%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVH +RQFY+DC ++GT+DFIFG++AAVFQ C L++RKPM N    Q C+
Sbjct  356  CHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPMDN----QQCI  411

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR    +P GI I N    A PE       I+S+LGRPW++++RT+I+ S +D  I
Sbjct  412  VTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLDDFI  471

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  +  T+ LE  +Y EF N G  A   KR KW GVK  +  ++   F PG+F+ G
Sbjct  472  QPDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVKE-LPPSRVQRFTPGEFLDG  530

Query  188  DTWIPASGVPYSA  150
            + WIP + VPY+A
Sbjct  531  NRWIPPTQVPYAA  543



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG++AAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW+++++T+I+N+ I   I
Sbjct  432  ITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +   F P ++I G
Sbjct  492  QPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            D W+P  GVPY+
Sbjct  551  DIWVPGKGVPYT  562



>ref|XP_009122545.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Brassica rapa]
Length=640

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGNAAAVFQ+C +  RKPM+N    Q   
Sbjct  447  CSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMVN----QKNA  502

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  503  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  562

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W G   ++  AQA  F    F LG
Sbjct  563  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWVGY-SLLNLAQAMNFTVYNFTLG  621

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  622  DTWLPQTDIPF  632



>ref|NP_191632.2| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
 sp|Q84R10.2|PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: 
Full=Pectin methylesterase inhibitor 36; Includes: RecName: 
Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin 
methylesterase 36; Short=AtPME36; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE80101.1| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
Length=519

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+AAAVFQ+C + +R+PM + G+    M
Sbjct  329  CSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----M  384

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P   +GI+I +S I A PE+        S+LGRPW++++RTV + + ID  I
Sbjct  385  ITAQGRDDPHTNSGISIQHSRIRAAPEFEAVKGRFKSYLGRPWKKYSRTVFLKTDIDELI  444

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G++ L   +YGEF NTG GA   +R  W G   +  + +A  F   +FI G
Sbjct  445  DPRGWREWSGSYALSTLYYGEFMNTGAGAGTGRRVNWPGFHVLRGEEEASPFTVSRFIQG  504

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  505  DSWIPITGVPFSA  517



>ref|XP_003630894.1| Pectinesterase [Medicago truncatula]
Length=326

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 126/194 (65%), Gaps = 4/194 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    +QDTLYV+A+RQFYRDC + GTIDFIFGNA  V Q+C + +RKPM    S Q   
Sbjct  119  CAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPM----SNQQNT  174

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI I N  I+A+ +     + + ++LGRPW++++RTV++ S +D  I
Sbjct  175  VTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLI  234

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW+P+ G + L   +YGE+ N G GA+   R KW G   +   + A +F+ G F+ G
Sbjct  235  NSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAG  294

Query  188  DTWIPASGVPYSAK  147
            D+WI  SGVP+ A+
Sbjct  295  DSWISGSGVPFDAE  308



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+ RQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQSCM
Sbjct  377  CQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKP----KGGQSCM  432

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  G+ + N  I   P Y+   S   ++LGRPW++ +RT+I+ + ID  I
Sbjct  433  VTAQGRTDVRESTGLVLHNCHIVGEPAYIPVKSVNKAYLGRPWKKFSRTIIMKTTIDDVI  492

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P++G + LE  +Y E  N G G++ ++R  W G+K  ++  +A  +  G+F+ G
Sbjct  493  DPAGWLPWRGDFALETLYYAEHLNIGPGSNQAQRVNWPGIKK-LSPEEALLYTGGRFLHG  551

Query  188  DTWIPASGVPYSA  150
            DTWIP + VPY A
Sbjct  552  DTWIPQTQVPYIA  564



>ref|XP_009628695.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana tomentosiformis]
Length=490

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 123/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL VH+ RQFYRDC + GTIDFIFG+AAAVFQ+C + +++PM      QS M
Sbjct  302  CSFRGYQDTLLVHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVKRPM----DHQSNM  357

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR   +E  GI ILNS ++ + E+       +++LGRPW++++RTV I + +D  I
Sbjct  358  ITAQGRDDSNENTGIVILNSRVAPSSEFSAVKGSFMNYLGRPWKKYSRTVFIKTDLDGLI  417

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L   +YGE+ NTG GAD+  R  W G   +    +A  F    FI G
Sbjct  418  HPKGWKEWSGNFALSTLYYGEYMNTGSGADIGNRVNWPGFHVLRDANEASPFTVRNFIQG  477

Query  188  DTWIPASGVPY  156
            ++WIPASGVPY
Sbjct  478  ESWIPASGVPY  488



>gb|KHN04166.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=394

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H  RQFYRDCT++GTIDF+FGNA AVFQ+C  ++RKPM N    Q C+
Sbjct  188  CSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMEN----QQCI  243

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+GI I    I + PE+ +      ++L RPW+ ++RT+I+++ ID  I
Sbjct  244  VTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLI  303

Query  368  APEGWSPFQGTW---GLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
              +G+ P+QG     G++ C+Y E+ N G G+D SKR KWAG+  + +KA A  F+P KF
Sbjct  304  DADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGIWNLNSKA-ARWFSPSKF  362

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  363  FHGTDWIEVTGIPY  376



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 129/193 (67%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D +QDTLYVH+HRQFYRDCTV+GT+DFIFG+A  + Q+CK+++RKP      GQSCM
Sbjct  379  CQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPK----KGQSCM  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS   E  G+ + N  I+    Y+   S   ++LGRPW++ +RT+++ + ID  I
Sbjct  435  VTAQGRSNVRESTGLVLHNCHITGDSAYIPVKSESKAYLGRPWKEFSRTIVMKTAIDDVI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L+  +Y E  NTG G++ + R KW G+K  +T   A  +   KF+ G
Sbjct  495  DPAGWLPWSGDFALKTLYYAEHLNTGPGSNQAHRVKWPGIKK-LTPQDALLYTGDKFLGG  553

Query  188  DTWIPASGVPYSA  150
            +TWIP + VPY+A
Sbjct  554  ETWIPQTQVPYTA  566



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 126/189 (67%), Gaps = 5/189 (3%)
 Frame = -3

Query  719  DAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCMVTA  540
            D YQDTLY H +RQ+YRD T++GTIDFIFG++ A FQ+CK I+RKPM N    Q+CMVTA
Sbjct  378  DGYQDTLYAHNYRQYYRDSTISGTIDFIFGDSLAYFQNCKFIVRKPMDN----QACMVTA  433

Query  539  QGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPIAPE  360
            QGR  P     I I N  I+A P +L    PI ++LGRPW++ +RT+I+ + I   IAPE
Sbjct  434  QGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYLGRPWKELSRTIIMQTNIGGFIAPE  493

Query  359  GWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILGDTW  180
            GWSP+ G + L+ C+YGE+ N G G+ ++KR  W G+K  IT   A  +  G    GD W
Sbjct  494  GWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIKK-ITPEIALSWTAGLAFKGDDW  552

Query  179  IPASGVPYS  153
            I  +GVPY+
Sbjct  553  IKTAGVPYN  561



>gb|KJB38563.1| hypothetical protein B456_006G260900 [Gossypium raimondii]
Length=561

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C     QDTLY H  RQ Y +C +TGT+DFIFG+AA++FQ+C L++RKP    G GQ+CM
Sbjct  368  CHFTGCQDTLYAHRERQLYSNCLITGTVDFIFGDAASIFQNCMLVVRKP----GPGQNCM  423

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+     + I + N  IS  P+Y+       ++LGRPW+Q AR++I+ S+ID  I
Sbjct  424  VTAQGRNDLGTNSAIVLQNCTISGAPDYIPVKDTNKAYLGRPWKQFARSIIMQSRIDDII  483

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEG++P  GT G++  +  EFGN G GAD S+R  W G+K  I   +A+++ P  F+  
Sbjct  484  QPEGYAPMTGTIGIDTSFIAEFGNRGPGADTSRRVAWKGIKK-IDINEANKWTPRVFLES  542

Query  188  DTWIPASGVPYS  153
            +TWIP+SGVPYS
Sbjct  543  ETWIPSSGVPYS  554



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 130/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLYVH+HR F+RDCTV+GT+DFIFG+A  + Q+CK+++RKP +    GQSCM
Sbjct  376  CQFDGYQDTLYVHSHRHFFRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKL----GQSCM  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+   E  G+ + N  I+  P Y+   S   S+LGRPW+Q +RT+++ + ID  I
Sbjct  432  VTAQGRTDVRESTGLVLHNCHITGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L+  +Y E+ NTG G++ ++R KW G++  IT   A  +   +F+ G
Sbjct  492  DPAGWLEWSGDFALKTLYYAEYLNTGPGSNQAQRVKWPGIRK-ITPQDALSYTGDRFLGG  550

Query  188  DTWIPASGVPYS  153
            +TWIP + VPY+
Sbjct  551  NTWIPQTQVPYT  562



>ref|XP_009764218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana sylvestris]
Length=491

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL VH+ RQFYRDC + GT+DFIFG+AAAVFQ+C + +++PM      QS M
Sbjct  301  CSFRGYQDTLLVHSLRQFYRDCHIYGTVDFIFGDAAAVFQNCDIFVKRPM----GHQSNM  356

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR   +E  GIAILNS +S + E+        ++LGRPW++++RTV I + +D  I
Sbjct  357  ITAQGRDDSNENTGIAILNSRVSPSSEFSAVKGSFQNYLGRPWKKYSRTVFIKTDLDGLI  416

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G + L   +YGE+ NTG GAD   R  W G   +    +A  F    FI G
Sbjct  417  HPQGWKEWSGNFALSTLYYGEYMNTGSGADTGNRVNWPGFHVLRDANEASPFTVRNFIQG  476

Query  188  DTWIPASGVPY  156
            ++WIPASGVPY
Sbjct  477  ESWIPASGVPY  487



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 125/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            CQ D YQDTLY H  RQFYRDCT+TGTIDFIFG++A++FQ+C + +RKP+ N    Q C+
Sbjct  391  CQMDGYQDTLYCHTKRQFYRDCTITGTIDFIFGDSASIFQNCLIKVRKPLAN----QQCI  446

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR    E   I + N  ISA  EYL       S+LGRPW+ ++RT+I+ S+ID  I
Sbjct  447  VTASGRKDRREATAIILHNCTISADSEYLPFHIQNPSYLGRPWKPYSRTIIMQSQIDEFI  506

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+ G  GL  C+Y E  N G GA+V+KR  W G K  I  + A +F   +FI G
Sbjct  507  HPEGWLPWLGDVGLHTCFYAEVDNHGLGANVTKRVTWRGYKK-IDSSHAQQFTVQRFIQG  565

Query  188  DTWIPASGVPY  156
            ++W+  +GVPY
Sbjct  566  NSWLRPTGVPY  576



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H++RQFYRD  +TGT+DFIFGNAA VFQ+CKL+ RKPM    +GQ  M
Sbjct  354  CRMDAYQDTLYTHSNRQFYRDSLITGTVDFIFGNAAVVFQNCKLVARKPM----NGQKNM  409

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR  P++  G +I    I A+ +     S + S+LGRPW++++RTV++ S I   I
Sbjct  410  VTAQGRIDPNQNTGTSIQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRTVVMQSNIADHI  469

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS ++G + L+  +YGE+ N G GA  SKR KWAG + + +  +A +F   + I G
Sbjct  470  DPAGWSIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWAGYRVITSATEAQKFTVAELIQG  529

Query  188  DTWIPASGVPYS  153
              W+ ++GV ++
Sbjct  530  GVWLKSTGVAFT  541



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQF+RDCT++GTIDF+FG++AAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G       I+  P+YL       ++LGRPW+++++T+I+N+ I   I
Sbjct  432  ITAHGRIDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSKTIIMNTFIPDFI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  WAG+K  ++  +   F P ++I G
Sbjct  492  QPQGWLPWLGDFGLKTLFYSEVKNTGPGAGLANRVTWAGIK-TLSDEEVLMFTPAQYIQG  550

Query  188  DTWIPASGVPYS  153
            D W+P  GVPY+
Sbjct  551  DIWVPGKGVPYT  562



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 131/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GT+DFIFG+A AV Q+C + +RKPM    SGQ   
Sbjct  342  CSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKPM----SGQRNT  397

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P+E  GI+I NS ++A  +         ++LGRPW++++RTV + + +D+ I
Sbjct  398  LTAQGRTDPNENTGISIHNSRVTAASDLRPLQGSFKTYLGRPWQKYSRTVFMKTSLDSLI  457

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + G++ L   +YGE+ NTG GA  S+R KW G   V++ + A +F  G F+ G
Sbjct  458  DPDGWLEWSGSFALSTLYYGEYMNTGVGASTSQRVKWPGFH-VMSASDAGKFTVGNFLGG  516

Query  188  DTWIPASGVPYSA  150
            DTWIPA+GVP+++
Sbjct  517  DTWIPATGVPFTS  529



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H++RQFYRD  +TGT+DFIFGNAA VFQ+CKL+ RKPM    +GQ+ M
Sbjct  365  CRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCKLVARKPM----TGQNNM  420

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR  P++  G +I    I A+ +       I S+LGRPW++++RTV++ SKI   I
Sbjct  421  VTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHI  480

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +YGE+ N+G GA  SKR KWAG   + +  +A  F   + I G
Sbjct  481  DPSGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQTFTVAQLIQG  540

Query  188  DTWIPASGVPYS  153
             +W+ ++GV Y+
Sbjct  541  GSWLKSTGVAYT  552



>emb|CDX98808.1| BnaC09g50270D [Brassica napus]
Length=578

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGNAAAVFQ+C +  RKPM+N    Q   
Sbjct  385  CSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAVFQNCNIYARKPMVN----QKNA  440

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  441  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  500

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W G   ++  AQA  F    F LG
Sbjct  501  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWPGY-SLLNLAQAMIFTVYNFTLG  559

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  560  DTWLPQTDIPF  570



>ref|XP_009130852.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Brassica rapa]
Length=593

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GTIDFIFGNAAAVFQ+C +  RKPM      Q   
Sbjct  400  CSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAVFQNCNIYARKPM----EHQKNA  455

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  456  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  515

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + GT GL+   YGE+ N G GA+ SKR +W+G   ++  AQA  F    F LG
Sbjct  516  QPDGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGY-SLLNLAQAMNFTVYNFTLG  574

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  575  DTWLPQTDIPF  585



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C V GT+DFIFGNAA V Q+C +  R P       ++  
Sbjct  336  CSFEGYQDTLYVHSDRQFYRECDVYGTVDFIFGNAAVVLQNCNIFARDP-----PNKTNT  390

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I N  I+A  +   + + + ++LGRPW+Q++RTV++ + +D+ I
Sbjct  391  VTAQGRTDPNQNTGISIHNCRITAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLI  450

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ GT+ L+  +YGE+ NTG G+  + R KW G + + + A+A +F P  FI G
Sbjct  451  QPDGWMPWSGTFALKTLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAG  510

Query  188  DTWIPASGVPYSA  150
            ++W+PA+ VP+++
Sbjct  511  NSWLPATNVPFTS  523



>ref|XP_004231267.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Solanum lycopersicum]
Length=560

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYRDC + GT+DFIFGNAAA+FQ+C L  RKPM +    Q  +
Sbjct  371  CCFEGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAAIFQNCNLFARKPMPD----QKNI  426

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGRS P++  GI+I N  I A P+    P+  +SFLGRPW  ++RTVI+ S +   I
Sbjct  427  FTAQGRSDPNQNTGISIQNCTIQAAPDLAQDPNLTLSFLGRPWHNYSRTVIMQSYLGDVI  486

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+GL+  +YGEF N G GA+ + R +W G   ++  +QA  F    F +G
Sbjct  487  TPVGWLEWNGTYGLDTLYYGEFENYGPGANTTMRVQWPGY-SLMNASQAMNFTVYNFTMG  545

Query  188  DTWIPASGVPYS  153
            DTW+P + VP+S
Sbjct  546  DTWLPYTNVPFS  557



>ref|XP_011046483.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 25 
[Populus euphratica]
Length=569

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C V GT+DFIFGNAAAVFQ+C L  RKPM+N    Q   
Sbjct  379  CSFEGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVFQNCNLYARKPMLN----QKNA  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGR+ P++  GI+I N  I A P+     +  ++FLGRPW++++RTVI+ S I   I
Sbjct  435  FTAQGRTDPNQNTGISIHNCTIEAAPDLAMDRNSTLNFLGRPWKEYSRTVIMQSYIGELI  494

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+  +YGEF N G GA+ S+R +W G   ++   QA  F    F +G
Sbjct  495  QPVGWLEWNGTVGLDTIYYGEFQNYGPGANTSRRVQWPGFN-LMNTTQAVNFTVYNFTMG  553

Query  188  DTWIPASGVPYS  153
            DTW+P + VP+S
Sbjct  554  DTWLPYTDVPFS  565



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 121/193 (63%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GT+DFIFGNA  VFQ+C + +RKPM    SGQ   
Sbjct  353  CSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGNAVVVFQNCNIYVRKPM----SGQKNT  408

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQ R+ P+E  GI I NS ++A  +         S+LGRPW++++RTVI+ S +D  I
Sbjct  409  VTAQARTDPNENTGIIIHNSRVTAASDLRPVQGSFKSYLGRPWQEYSRTVILKSNLDGLI  468

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +Y E+ N+G GA    R KW G   +     A +F  G F+ G
Sbjct  469  DPAGWLPWSGNFALSTLYYAEYMNSGSGASTGDRVKWPGYHVITKVTDAGKFTVGNFLAG  528

Query  188  DTWIPASGVPYSA  150
            D+WIPA+GVP+ +
Sbjct  529  DSWIPATGVPFDS  541



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 129/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLY H+ RQFY+DC V GT+DFIFGNAA V Q+C +  RKPM    SGQ   
Sbjct  329  CSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGNAAVVLQNCMIYARKPM----SGQKNT  384

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI+I +S + A P++ ++   + +FLGRPW++++RTV + S +D  +
Sbjct  385  ITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLV  444

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L+  +YGE+ N G GA  S+R KW G + + + ++A +F    FI G
Sbjct  445  DPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWGGYRVITSSSEASKFTVNNFIAG  504

Query  188  DTWIPASGVPYSA  150
             +W+PA+ VP++A
Sbjct  505  SSWLPATNVPFTA  517



>emb|CDY11323.1| BnaA03g01590D [Brassica napus]
Length=593

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 126/191 (66%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GTIDFIFGNAAAVFQ+C +  RKPM      Q   
Sbjct  400  CSFEGYQDTLYVHSLRQFYRECDIFGTIDFIFGNAAAVFQNCNIYARKPM----EHQKNA  455

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  456  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  515

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + GT GL+   YGE+ N G GA+ SKR +W+G   ++  AQA  F    F LG
Sbjct  516  QPDGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGY-SLLNLAQAMNFTVYNFTLG  574

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  575  DTWLPQTDIPF  585



>gb|KFK37147.1| hypothetical protein AALP_AA4G219300 [Arabis alpina]
Length=489

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 128/193 (66%), Gaps = 13/193 (7%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQD+LY H +RQFYR+  +TGT+DFIFGNAA VFQSC ++ RKP+     GQ   
Sbjct  306  CSVEGYQDSLYTHKNRQFYRETDITGTVDFIFGNAAVVFQSCNMVARKPL----PGQKNF  361

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR  P +  GI+I+N  I+A  E LT       +LGRPW+ ++RTV++ S +   I
Sbjct  362  VTAQGRVDPGQNTGISIINCRITA--ETLT-------YLGRPWKAYSRTVVMQSYLGGEI  412

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWSP+ G +GL   +YGEF NTG G+ VS R KW+G    +T  +A++F   KFI G
Sbjct  413  HPSGWSPWSGGFGLNTLFYGEFMNTGPGSSVSGRVKWSGYHSALTVTEAEKFTVAKFIDG  472

Query  188  DTWIPASGVPYSA  150
            DTW+P++G+ + +
Sbjct  473  DTWLPSTGISFDS  485



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 6/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+    QDTLY    RQFYRDCTV+GTIDFIFG+A AVFQ+CKL++RKP    G  Q CM
Sbjct  390  CRFTGNQDTLYALRGRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKP----GPNQQCM  445

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR++   P         +S+ P Y    +   ++LGRPW+++++T+ + S ID  I
Sbjct  446  VTAQGRTEEKGPGAFIFEGCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTI  505

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGK-FIL  192
            AP+GW+ +QG + L+  +Y EF N G GAD S+R KW G+K  ++  +AD F P K F+ 
Sbjct  506  APKGWTEWQGNFALDTLYYAEFENKGAGADKSQRVKWKGIK-TLSAQEADGFTPAKLFVS  564

Query  191  GDTWIPASGVPYS  153
            GD WIP SGVPY+
Sbjct  565  GDKWIPESGVPYA  577



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 132/193 (68%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GT+DFIFGNAA V Q+C +  R P       ++  
Sbjct  360  CSFEGYQDTLYVHSDRQFYRECDIYGTVDFIFGNAAVVLQNCNIFARDP-----PNKTNT  414

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS P++  GI+I N  ++A  +   + + + ++LGRPW+Q++RTV++ + +D+ I
Sbjct  415  VTAQGRSDPNQNTGISIHNCRVTAASDLKASKNSVKTYLGRPWKQYSRTVVMKTFLDSLI  474

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ GT+ L+  +YGE+ NTG G+  + R KW G + + + A+A +F P  FI G
Sbjct  475  QPDGWMPWSGTFALKTLYYGEYLNTGPGSSTANRVKWGGYRVITSAAEASKFTPANFIAG  534

Query  188  DTWIPASGVPYSA  150
            ++W+PA+ VP+++
Sbjct  535  NSWLPATNVPFTS  547



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 127/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  378  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR    E  G       IS  P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  434  ITAHGRKDVRESTGFVFQGCTISGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  W G+K  ++  +  +F P ++I G
Sbjct  494  QPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIK-TLSNEEILKFTPDQYIQG  552

Query  188  DTWIPASGVPYS  153
            D W+   GVPY+
Sbjct  553  DVWVHGKGVPYT  564



>gb|KJB30790.1| hypothetical protein B456_005G160000 [Gossypium raimondii]
Length=528

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GT+DFIFG+A AVFQSC + IR+PM    SGQ   
Sbjct  339  CSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVFQSCNIYIRRPM----SGQKNT  394

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI I NS ++A+ +         S+LGRPW++++RTV + S +D  I
Sbjct  395  VTAQGRTDQNENTGIVIHNSRVTASSDMKAVQGSFKSYLGRPWQKYSRTVFMRSTLDGLI  454

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW P+ G + L   +Y E+ NTG GAD S R KW G   VI   +A +F  G F+ G
Sbjct  455  DREGWLPWSGNFALSTLYYAEYMNTGAGADTSGRVKWGGYH-VIGATEAAKFTVGNFLAG  513

Query  188  DTWIPASGVPY  156
            ++WIP +GVP+
Sbjct  514  NSWIPGTGVPF  524



>ref|XP_006369079.1| pectinesterase family protein, partial [Populus trichocarpa]
 gb|ERP65648.1| pectinesterase family protein, partial [Populus trichocarpa]
Length=229

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 122/192 (64%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQDTLY H++RQF+ +C + GT+DFIFGNAAAVFQ C +  R+P     SGQ  M
Sbjct  39   CDMLAYQDTLYAHSNRQFFINCLIAGTVDFIFGNAAAVFQDCDIHARRP----DSGQKNM  94

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI I  S I AT + L   S   ++LGRPW++++RTVI+ S I   I
Sbjct  95   VTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSRTVIMQSSITDVI  154

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+ L   +Y E+ N+G GA  S R  W G K + +  +A  FAPG FI G
Sbjct  155  QPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWEGYKVITSATEAQAFAPGNFIAG  214

Query  188  DTWIPASGVPYS  153
             +W+ ++  P+S
Sbjct  215  SSWLGSTSFPFS  226



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C  ++RKP+ N    Q+C 
Sbjct  375  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTFLVRKPLPN----QACP  430

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR  P E  G  +    IS   +YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  431  ITAHGRKDPRETTGFVLQGCTISGETDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  490

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW P+   +GLE  +Y E  NTG GA    R  W G+K  + + +  +F P ++I G
Sbjct  491  PPEGWQPWLDNFGLETLFYSEVRNTGPGAPAMNRVTWPGIKK-LGEEEILKFTPAQYIQG  549

Query  188  DTWIPASGVPYS  153
            D WIP  GVPY+
Sbjct  550  DAWIPGKGVPYT  561



>ref|XP_006292970.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
 gb|EOA25868.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
Length=527

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTL+ H+ RQFYRDC + GTIDFIFG+AAAVFQ+C + +R+PM + G+    M
Sbjct  337  CSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGN----M  392

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P    GI+I +S + A PE+        ++LGRPW++++RTV + + +D  I
Sbjct  393  ITAQGRDDPHANTGISIQHSRVRAAPEFEAVKGQFKNYLGRPWKKYSRTVFLKTDLDGLI  452

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGEF NTG GA  S+R  W G   +  + +A  F+  +FI G
Sbjct  453  DPRGWREWSGGYALSTLYYGEFMNTGTGAGTSRRVNWPGFHVLRDEGEASPFSVSRFIQG  512

Query  188  DTWIPASGVPYSA  150
            D+WIP +GVP+SA
Sbjct  513  DSWIPITGVPFSA  525



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 132/197 (67%), Gaps = 9/197 (5%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+ RQFYRDC ++GTIDF+FG+AAAVFQ+CKLI+RKP+      Q+CM
Sbjct  359  CKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLIVRKPL----DSQNCM  414

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+       I I N  I A PE+L AP    ++LGRPW++++RT+I+ S ID  I
Sbjct  415  VTAQGRTTSGSKGAIVIQNCEIKADPEFLAAPRK-PAYLGRPWKEYSRTIIMQSFIDGFI  473

Query  368  APEGWSPFQGT-WGLEDCWYGEFGNTGKGADVSKR-AKWAGVKGVITKAQADEFAPGKFI  195
             P GWSP+  T +GL  CWY E+ N G GA + KR + W G +  I+   A+ F  G+FI
Sbjct  474  DPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGDVANSFTAGQFI  533

Query  194  --LGDTWIPASGVPYSA  150
               G +++P + +PY A
Sbjct  534  NPSGSSFLPKADIPYEA  550



>ref|XP_006853048.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
 gb|ERN14515.1| hypothetical protein AMTR_s00038p00046180 [Amborella trichopoda]
Length=532

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 124/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLY H+ RQFYR+C + GTIDFIFGNAA VFQ+C L  R PM    + Q+ +
Sbjct  340  CSVEGYQDTLYTHSLRQFYRECDIYGTIDFIFGNAAVVFQNCNLYARMPM----ASQNNV  395

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGR+ P++  G +ILN  ++A+ ++    S + S+LGRPW++++RTV + S ID+ I
Sbjct  396  FTAQGRTDPNQNTGTSILNCSVTASSDFAWNSSSVNSYLGRPWKEYSRTVYMKSFIDSLI  455

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
               GW P+ G + L   +YGEF N+G GAD SKR  W G   ++    A  F    FI+G
Sbjct  456  DSSGWLPWSGDFALNTLYYGEFNNSGPGADTSKRVSWPGYHAIMNVTDAGNFTVSNFIMG  515

Query  188  DTWIPASGVPYSA  150
            D W+PA+ V + A
Sbjct  516  DVWLPATSVEFHA  528



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H  RQFYRD  +TGT+DFIFGNA  VFQ+C L+ RKPM    SGQS M
Sbjct  359  CRIDAYQDTLYTHTSRQFYRDSYITGTVDFIFGNAGVVFQNCNLVARKPM----SGQSNM  414

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I +  ++A+ + +     I S+LGRPW++++RTV++ S I   I
Sbjct  415  VTAQGRTDPNQNTGISIQSCNMTASSDLVPVKGSIKSYLGRPWKEYSRTVVMQSNIGDHI  474

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +YGE+ N G GA  SKR  W G   + +  +A +F   + I G
Sbjct  475  DPTGWSVWSGDFALKTLYYGEYMNKGPGAGTSKRVNWPGYHVITSATEAKKFTVAELIQG  534

Query  188  DTWIPASGVPYS  153
             TW+ +SGV Y+
Sbjct  535  GTWLKSSGVSYT  546



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 122/191 (64%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H  RQ+YRDC VTGTIDFIFGNA  VFQ+C + +RK M N    Q  +
Sbjct  364  CRFDGYQDTLYTHTSRQYYRDCVVTGTIDFIFGNAQVVFQNCLIQVRKCMDN----QQNI  419

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +     G  I N  +   PE+ ++   + ++LGRPW++H+RT+ I S+I   +
Sbjct  420  VTAQGRKERRSAGGTVIHNCTVEPHPEFESSAGRLKTYLGRPWKEHSRTLYIQSEIGGFV  479

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL  C+Y E  N G GAD SKRAKW GVK +  +    ++   +FI G
Sbjct  480  DPQGWLPWLGDFGLSTCYYAEVENHGPGADTSKRAKWKGVKNITYQQAQQKYTVERFIQG  539

Query  188  DTWIPASGVPY  156
             TW+P  GVP+
Sbjct  540  QTWLPKLGVPF  550



>gb|KFK24938.1| hypothetical protein AALP_AA8G044700 [Arabis alpina]
Length=602

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 125/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GTIDFIFGNAAAVFQ C +  RKPM N    Q   
Sbjct  409  CSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAVFQKCNIYARKPMAN----QKNA  464

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   +
Sbjct  465  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDVV  524

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W+G   ++  AQA  F    F LG
Sbjct  525  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGY-SLLNLAQAMNFTVYNFTLG  583

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  584  DTWLPQTDIPF  594



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 128/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVHA RQFYRDCT++GTIDF+FGNA +VFQ+CK ++RKPM    S Q C+
Sbjct  365  CSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPM----SNQQCI  420

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +   P+ I I    I A PE+        S+L  PW+  +RT+I+++ ID  I
Sbjct  421  VTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPWKNFSRTIIMDTFIDDLI  480

Query  368  APEGWSPF---QGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
             P+G+ P+   +G   ++ C+Y E+ N G G+D SKR KWAG+  + TKA A +FAP KF
Sbjct  481  HPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGIYNINTKA-AQKFAPSKF  539

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  540  FHGGDWIKDTGIPY  553



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 128/193 (66%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQ Y++C + GT+DFIFGNAA V Q+C +  R+PM N    Q+ +
Sbjct  337  CGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDN----QNNV  392

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  GI+I NS I A+ + +   S   +FLGRPW+Q++RTV + S ID  +
Sbjct  393  VTAQGRTDPNQNTGISIHNSRIMASSDLVPVLSSFKTFLGRPWKQYSRTVYLTSYIDTLV  452

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L+  +YGE+ N G G+  + R  W G + +   ++A +F  GKFI G
Sbjct  453  DPAGWMEWSGNFALDTLYYGEYKNYGPGSSTANRVNWGGYRVITKSSEASQFTVGKFISG  512

Query  188  DTWIPASGVPYSA  150
            D+W+PA+GVP+ +
Sbjct  513  DSWLPATGVPFKS  525



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 124/193 (64%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GT+DFIFG+A AV Q+C + IRKPM    S Q   
Sbjct  331  CSFKGYQDTLYVYSQRQFYRDCDIYGTLDFIFGDAVAVLQNCNIYIRKPM----SNQRNT  386

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+  +E  GI I NS ++A+ +         S+LGRPW++++RTV + S +D  I
Sbjct  387  VTAQGRTDANENTGIIIHNSRVTASSDLRGVQGSFKSYLGRPWQKYSRTVFMKSVLDGVI  446

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW P+ G++ L   +Y E  NTG GAD S R KW G   VI+ A+A +F  G F+ G
Sbjct  447  TAEGWLPWSGSFALSTLYYAEHMNTGAGADTSGRVKWGGYH-VISAAEAGKFTVGNFLAG  505

Query  188  DTWIPASGVPYSA  150
            D WIP +GVP+ A
Sbjct  506  DAWIPGTGVPFDA  518



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 127/193 (66%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH++RQFYR+C + GT+DFIFGNAA VFQ+C +  RKP           
Sbjct  327  CGFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGNAAVVFQNCNMFARKP-----KNSIVT  381

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS P++  GI I NS I+A  +     S + ++LGRPWRQ++RTV++ + +D+ I
Sbjct  382  VTAQGRSDPNQNTGIVIHNSRITAASDLKPVQSSVKTYLGRPWRQYSRTVVLKTFLDSLI  441

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G++ L   +YGE+ NTG G+  + R KW G   + +  +A +F  G FI+G
Sbjct  442  QPAGWLPWSGSFALSTLYYGEYQNTGPGSSTANRVKWGGYHVITSVTEASKFTVGSFIVG  501

Query  188  DTWIPASGVPYSA  150
              W+PA+ VP+++
Sbjct  502  GAWLPATNVPFTS  514



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 126/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  376  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR    E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  432  ITAHGRKDARESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  491

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  N G GA ++ R  W G+K  ++  +   F P ++I G
Sbjct  492  QPQGWQPWLGNFGLDTLFYSEVQNIGPGAALAGRVTWPGIK-TLSDEEILSFTPDQYIQG  550

Query  188  DTWIPASGVPYS  153
            D W+P  GVPY+
Sbjct  551  DVWVPGKGVPYT  562



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH++RQFYR+C + GT+DFI+G+A AV Q+C + +RKPM    SGQ   
Sbjct  343  CSFKGYQDTLYVHSNRQFYRNCDIYGTVDFIWGDAVAVLQNCNIYVRKPM----SGQKNT  398

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI+I NS+++AT +         ++LGRPW++++RTV + + +D+ I
Sbjct  399  VTAQGRTDPNENTGISIHNSLVTATSDLKAVQGSFKTYLGRPWQKYSRTVFMKTSLDSLI  458

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEGW  + G + L   +YGEF NTG GA  S R KWAG   V+ KA A +F    F+ G
Sbjct  459  DPEGWLEWSGNFALSTLYYGEFLNTGPGASTSGRVKWAGFH-VMNKADAQKFTVESFLGG  517

Query  188  DTWIPASGVPYS  153
             +WI A+GVP++
Sbjct  518  SSWIAAAGVPFT  529



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 132/196 (67%), Gaps = 7/196 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+ RQFYRDCT+TGT+DFIFG+A+AVFQ+CKLI+RKP    G+ Q+CM
Sbjct  356  CKIDGYQDTLYAHSFRQFYRDCTITGTVDFIFGDASAVFQNCKLIVRKP----GNAQACM  411

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P    G  I N  I A P + +   PI ++LGRPW+++++T+I+ S IDA I
Sbjct  412  ITAQGRTVPTSFGGFVIQNCDIKADPAFTSTTPPIKAYLGRPWKEYSKTIIMQSNIDAFI  471

Query  368  APEGWSPFQGT-WGLEDCWYGEFGNTGKGADVSKR-AKWAGVKGVITKAQADEFAPGKFI  195
             P GW+P+  T +GL  C+Y E+ N G GA + KR + W G +  I+    +++  GKFI
Sbjct  472  DPTGWAPWNSTDFGLHTCFYAEYQNRGPGAALGKRVSTWRGYQKGISGDAINKYTAGKFI  531

Query  194  -LGDTWIPASGVPYSA  150
                 W+P   +PY A
Sbjct  532  NTQQPWLPKFDIPYDA  547



>ref|XP_002511680.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50349.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=472

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 127/191 (66%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQDTL+V + RQFYRDC + GTIDFIFG+A  VFQ+C + +R+PM +    Q+  
Sbjct  282  CSFKAYQDTLFVLSLRQFYRDCHIYGTIDFIFGDAPVVFQNCDIFVRRPMDH----QANF  337

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P+E  GI+I  S + A+P+++ A + I SFLGRPW++++RTV + + +D  I
Sbjct  338  ITAQGRDDPNENTGISIQRSRVRASPDFMVAKNKIRSFLGRPWKKYSRTVFMQTDLDGLI  397

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +Y E+ NTG GA  S+R KW G   + +  QA  F   +FI G
Sbjct  398  DPMGWGAWHGDFALSTLFYAEYMNTGNGASTSRRVKWPGFHVLSSPQQASPFTVTRFIQG  457

Query  188  DTWIPASGVPY  156
            ++WIPA+GVP+
Sbjct  458  ESWIPATGVPF  468



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV+A+RQFYRDC + GT+DFIFG+A +V Q+C + +RKPM N    Q   
Sbjct  328  CSFKGYQDTLYVYANRQFYRDCDIYGTVDFIFGDAVSVLQNCNIYVRKPMSN----QQNS  383

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI I N VI+A  +         ++LGRPW++++RTV++ S +D  I
Sbjct  384  VTAQGRTDPNENTGIIIHNCVITAAGDLKAVQGSFRTYLGRPWQKYSRTVVMKSALDGLI  443

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L   +YGE+ NTG GA    R KW G + V++ + A +F  G+F+ G
Sbjct  444  NPAGWSEWSGNFALSTLYYGEYANTGAGASTGGRVKWGGFR-VMSSSDAVKFTVGEFLAG  502

Query  188  DTWIPASGVPYSA  150
             +WIP SGVP+ A
Sbjct  503  GSWIPGSGVPFDA  515



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H++RQFYRD  +TGT+DFIFGNAA VFQ+C+L+ RKPM    +GQ+ M
Sbjct  365  CRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCQLVARKPM----TGQNNM  420

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR  P++  G +I    I A+ +       I S+LGRPW++++RTV++ SKI   I
Sbjct  421  VTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGDHI  480

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +YGE+ N+G GA  SKR KWAG   + +  +A  F   + I G
Sbjct  481  DPTGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQNFTVAQLIQG  540

Query  188  DTWIPASGVPYS  153
             +W+ ++GV Y+
Sbjct  541  GSWLKSTGVAYT  552



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 129/193 (67%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYR+C + GT+DFIFG+AA V Q+C + +RKPM    SGQ   
Sbjct  326  CSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGDAAVVLQNCNMHVRKPM----SGQKNT  381

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI+I +S ++A  +         ++LGRPW++++RTV + + +D+ I
Sbjct  382  VTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFETYLGRPWQEYSRTVFMKTSLDSLI  441

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ NTG GAD S+R KW G   + + A+A +F  G F+ G
Sbjct  442  DPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWPGYHVITSAAEASKFTVGNFLSG  501

Query  188  DTWIPASGVPYSA  150
            ++WIPA+ VP+++
Sbjct  502  NSWIPATEVPFTS  514



>ref|XP_008344546.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 47 
[Malus domestica]
Length=241

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 123/191 (64%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFY++C + GT+DFIFGNAAAVFQSC L  RKPM N    Q   
Sbjct  46   CSFEGYQDTLYVHSLRQFYKECDIYGTVDFIFGNAAAVFQSCNLYARKPMPN----QKNA  101

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGR+ P++  GI+I N  I A P+     +  ++FLGRPW+  +RTVI+ S I + I
Sbjct  102  FTAQGRTDPNQNTGISIHNCTIEAAPDLAADLNSTLNFLGRPWKVFSRTVIMQSYIGSLI  161

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            +  GW  + GT GL+  +YGEF N G GA+ +KR +W G   ++   QA  F    F LG
Sbjct  162  SSVGWLEWNGTVGLDTLFYGEFQNHGPGANTTKRVQWPGYS-LMNATQALNFTVSNFTLG  220

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  221  DTWLPDTDIPF  231



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 127/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  378  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR    E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  434  ITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  W G+K  ++  +  +F P ++I G
Sbjct  494  QPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIK-TLSNEEILKFTPDQYIQG  552

Query  188  DTWIPASGVPYS  153
            D W+   GVPY+
Sbjct  553  DVWVHGKGVPYT  564



>ref|XP_008800483.1| PREDICTED: pectinesterase 3-like isoform X2 [Phoenix dactylifera]
Length=262

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 120/192 (63%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY+H+ R F+R C + GT+DFIFGNAA V Q C + +R+P  N    Q  M
Sbjct  70   CDIIGYQDTLYLHSLRHFFRSCLIQGTVDFIFGNAATVLQDCDIQVRRPNAN----QKNM  125

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR  P+EP GIAI  S I+A P+     S   S+LGRPW++++R VI+ S+I   I
Sbjct  126  VTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRSYLGRPWKEYSRAVIMESEISDVI  185

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G +GL+  +YGE+ NTG GA  + R KW G + +    +A +FAPG  + G
Sbjct  186  DPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYRVLTDVQEAKQFAPGNLLGG  245

Query  188  DTWIPASGVPYS  153
              W+ ++G PYS
Sbjct  246  SNWLDSTGFPYS  257



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 127/192 (66%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+HRQFYRDCT++GTIDF+FG+AAAVFQ+C L++RKP+ N    Q+C 
Sbjct  378  CRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPN----QACP  433

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TA GR    E  G       I+  P+YL       ++LGRPW++++RT+I+N+ I   I
Sbjct  434  ITAHGRKDVRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRTIIMNTFIPDFI  493

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P+ G +GL+  +Y E  NTG GA ++ R  W G+K  ++  +  +F P ++I G
Sbjct  494  QPQGWQPWLGNFGLDTLFYSEVQNTGPGAALANRVTWPGIK-TLSNEEILKFTPDQYIQG  552

Query  188  DTWIPASGVPYS  153
            D W+   GVPY+
Sbjct  553  DVWVHGKGVPYT  564



>ref|XP_010548770.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=572

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  +AYQDTLYVH+ RQFY++C + GT+DF+FGNAAAVFQSC +  R P+     GQ   
Sbjct  380  CSFEAYQDTLYVHSLRQFYKECEIFGTVDFVFGNAAAVFQSCNIFPRLPL----QGQFNA  435

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI+I N  I  + E ++   P+ ++LGRPW++++RTV + + +D  I
Sbjct  436  ITAQGRTDPNQNTGISIQNCTIKPSTELVSGNFPVQTYLGRPWKEYSRTVYLQNFMDGLI  495

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW+ + G + L+  +Y EF NTG G+D + R  W G   ++ + +A+ F   KFI+G
Sbjct  496  DPKGWTEWMGDFALKTLYYAEFKNTGPGSDTTNRVTWPGYHVIVNEDEAESFTVSKFIVG  555

Query  188  DTWIPASGVPY  156
            D+W+P +GVP+
Sbjct  556  DSWLPVTGVPF  566



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 127/194 (65%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVHA RQFYRDCT++GTIDF+FGNA +VFQ+CK ++RKPM    S Q C+
Sbjct  383  CSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPM----SNQQCI  438

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +   P+ I I    I A PE+        S+L RPW+  +RT+I+++ ID  I
Sbjct  439  VTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLI  498

Query  368  APEGWSPFQ---GTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
             P+G+ P+    G   ++ C+Y E+ N G G++ SKR KWAG+  + +KA A  FAP KF
Sbjct  499  HPDGFFPWHTEVGPINMDTCFYAEYHNYGPGSNKSKRVKWAGIYNINSKA-AHRFAPSKF  557

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  558  FHGGDWIKDTGIPY  571



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 131/197 (66%), Gaps = 8/197 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTLY H+ RQFYRDC ++GTIDF+FG+AAAVFQ+CKLI+R+P    G GQ+CM
Sbjct  358  CKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLIVRRP----GDGQNCM  413

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+         I N  I A PE+L A   + +FLGRPW++++RT+I+ S ID  I
Sbjct  414  VTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRTIIMQSFIDGFI  473

Query  368  APEGWSPFQGT-WGLEDCWYGEFGNTGKGADVSKR-AKWAGVKGVITKAQADEFAPGKFI  195
             P GW+P+  T +G+  CWY E+ N G GA + KR + W G +  I+   A+ F  G FI
Sbjct  474  DPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGDVANSFTAGVFI  533

Query  194  --LGDTWIPASGVPYSA  150
                ++++P + +PY A
Sbjct  534  NPTDNSFLPKADIPYEA  550



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    +QDTLYV+A+RQFYRDC + GTIDFIFGNA  V Q+C + +RKPM    S Q   
Sbjct  351  CAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGNAVTVLQNCNIFVRKPM----SNQKNT  406

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI I N  I+A+ +     + + ++LGRPW++++RTV++ S +D  I
Sbjct  407  VTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTYLGRPWQKYSRTVVMKSNLDGLI  466

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              EGW+P+ G + L   +YGE+ N G GA+   R KW G   +   + A +F+ G F+ G
Sbjct  467  NSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWPGFHVITNPSDAVKFSVGNFLAG  526

Query  188  DTWIPASGVPYSA  150
            D+WI  SGVP+ A
Sbjct  527  DSWISGSGVPFDA  539



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 128/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLYVHA RQFYRDCT++GTIDF+FGNA +VFQ+CK ++RKPM    S Q C+
Sbjct  365  CSMDGYQDTLYVHAMRQFYRDCTISGTIDFVFGNAESVFQNCKFVVRKPM----SNQQCI  420

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +   P+ I I    I A PE+        S+L  PW+  +RT+I+++ ID  I
Sbjct  421  VTAQGRKEITAPSAIVIQGGSIVADPEFYPVRFDHKSYLACPWKNFSRTIIMDTFIDDLI  480

Query  368  APEGWSPF---QGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
             P+G+ P+   +G   ++ C+Y E+ N G G+D SKR KWAG+  + TKA A +FAP KF
Sbjct  481  HPDGFLPWHTEEGPINMDTCYYVEYHNYGPGSDKSKRVKWAGIYNINTKA-AQKFAPSKF  539

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  540  FHGGDWIKDTGIPY  553



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY H  RQ Y +C +TGT+DFIFG+AA++FQ+C LI+RKP    G GQ+CM
Sbjct  352  CHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAASIFQNCMLIVRKP----GPGQNCM  407

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+     + I + N  IS  P+Y++      ++LGRPW+Q AR++I+ S+ID  I
Sbjct  408  VTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAYLGRPWKQFARSIIMQSQIDDII  467

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEG++P  GT G++  +  EFGN G GAD ++R  W G+K  I   +A+++ P  ++  
Sbjct  468  QPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES  526

Query  188  DTWIPASGVPYS  153
            +TWI +S VPYS
Sbjct  527  ETWISSSDVPYS  538



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 128/193 (66%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLY H+ RQFY+DC V GT+DFIFGNAA V Q+C +  RKPM    SGQ   
Sbjct  329  CSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGNAAVVLQNCMIYARKPM----SGQKNT  384

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI+I +S + A P++ ++   + +FLGRPW++++RTV + S +D  +
Sbjct  385  ITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTFLGRPWKEYSRTVFMQSFLDTLV  444

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L+  +YGE+ N G GA  S R KW G + + + ++A +F    FI G
Sbjct  445  DPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKWGGYRVITSSSEASKFTVNNFIAG  504

Query  188  DTWIPASGVPYSA  150
             +W+PA+ VP++A
Sbjct  505  SSWLPATNVPFTA  517



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH+ RQF+R+C + GTIDF+FGN+A V QSC L  R+P+    + QS +
Sbjct  36   CSFVGYQDTLYVHSLRQFFRECDIYGTIDFVFGNSAVVLQSCNLYARRPL----ASQSNI  91

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             TAQGR+ P++  GI+I    ++A  +     +   ++LGRPW+Q++RTV + S++D+ +
Sbjct  92   YTAQGRTDPNQNTGISIQKCKVAAASDLAAVQTSFRTYLGRPWKQYSRTVYLQSELDSVV  151

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW  + GT+ L+  +YGE+ NTG GA  S R KW G + + + ++A  F  G FI G
Sbjct  152  DPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWKGYRVISSSSEASTFTVGSFIDG  211

Query  188  DTWIPASGVPYS  153
            D W+  + +P+S
Sbjct  212  DVWLAGTSIPFS  223



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY H  RQ Y +C +TGT+DFIFG+AA++FQ+C LI+RKP    G GQ+CM
Sbjct  368  CHFTGYQDTLYAHRERQLYSNCLITGTVDFIFGDAASIFQNCMLIVRKP----GPGQNCM  423

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+     + I + N  IS  P+Y++      ++LGRPW+Q AR++I+ S+ID  I
Sbjct  424  VTAQGRNDLGTNSAIVLQNCTISGAPDYISVKDTNKAYLGRPWKQFARSIIMQSQIDDII  483

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             PEG++P  GT G++  +  EFGN G GAD ++R  W G+K  I   +A+++ P  ++  
Sbjct  484  QPEGYAPMTGTIGIDTSFIAEFGNRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES  542

Query  188  DTWIPASGVPYS  153
            +TWI +S VPYS
Sbjct  543  ETWISSSDVPYS  554



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 127/193 (66%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLY+++ RQFYR+C V GT+DFIFG+AA V Q+C + +RKPM    SGQ   
Sbjct  325  CSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCSMYVRKPM----SGQKNT  380

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P+E  GI+I +S ++A  E         ++LGRPW++++RTV + + +D  I
Sbjct  381  VTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTYLGRPWKKYSRTVFMKTSLDCLI  440

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ NTG GAD S+R KW G   + +  +A +F    F+ G
Sbjct  441  DPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWPGYHVITSATEASKFTVANFLSG  500

Query  188  DTWIPASGVPYSA  150
            ++WIPA+GV +++
Sbjct  501  NSWIPATGVAFTS  513



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 123/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYVH+ RQFYRDC + GT+DFIFG+A AV Q+C + +R+PM    S Q+  
Sbjct  341  CSFKGYQDTLYVHSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRRPM----SKQTNT  396

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ PDE  GI I NS + A P+         S+LGRPW++++RTV + S ID  I
Sbjct  397  VTAQGRTDPDENTGIVIHNSRVMAAPDLRPVQGSFKSYLGRPWKKYSRTVFLKSNIDGLI  456

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P++G + L   +YGE+ +TG GA    R KW G   + +  +A +F    F+ G
Sbjct  457  DPAGWLPWKGDFALSTLYYGEYMSTGSGASTKGRVKWPGYHTITSPLEAGKFTVENFLAG  516

Query  188  DTWIPASGVPYSA  150
            ++WI A+GVP+ +
Sbjct  517  NSWISAAGVPFES  529



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 129/194 (66%), Gaps = 8/194 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H  RQFYRDCT++GTIDF+FGNA AVFQ+C  ++RKPM N    Q C+
Sbjct  376  CSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMEN----QQCI  431

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+GI I    I + PE+ +      ++L RPW+ ++RT+I+++ ID  I
Sbjct  432  VTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLI  491

Query  368  APEGWSPFQGTW---GLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
              +G+ P+QG     G++ C+Y E+ N G G+D SKR KWAG+  + +KA A  F+P KF
Sbjct  492  DADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGIWNLNSKA-ARWFSPSKF  550

Query  197  ILGDTWIPASGVPY  156
              G  WI  +G+PY
Sbjct  551  FHGTDWIEVTGIPY  564



>emb|CDY56347.1| BnaCnng30140D [Brassica napus]
Length=517

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 127/193 (66%), Gaps = 13/193 (7%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQD+LY H+ RQFYRD  +TGT+D+IFGN+AAV QSC ++ RKP+    SGQ+  
Sbjct  334  CSIEGYQDSLYTHSKRQFYRDTDITGTVDYIFGNSAAVLQSCNIVARKPL----SGQTNF  389

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGRS P +  GI+I N  I+A            ++LGRPW++++RTV++ S +D  I
Sbjct  390  VTAQGRSNPGQNTGISIQNCKITAQS---------TTYLGRPWKEYSRTVVMQSFLDGSI  440

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWSP+ G +GL+  +Y EFGN+G G+ VS R KWAG    +T  +A+ F    FI G
Sbjct  441  HPSGWSPWSGGFGLKTLFYAEFGNSGPGSSVSGRVKWAGYHSSLTVKEAEGFTVANFIGG  500

Query  188  DTWIPASGVPYSA  150
              W+P++GV + +
Sbjct  501  TMWLPSTGVSFDS  513



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 128/193 (66%), Gaps = 8/193 (4%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  D YQDTLY H  RQFYRDCT++GTIDF+FGNA AVFQ+C  ++RKPM N    Q C+
Sbjct  255  CSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALAVFQNCTFVVRKPMEN----QQCI  310

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR +  +P+GI I    I + PE+ +      ++L RPW+ ++RT+I+++ ID  I
Sbjct  311  VTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNYSRTIIMDTYIDDLI  370

Query  368  APEGWSPFQGTW---GLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKF  198
              +G+ P+QG     G++ C+Y E+ N G G+D SKR KWAG+  + +KA A  F+P KF
Sbjct  371  DADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWAGIWNLNSKA-ARWFSPSKF  429

Query  197  ILGDTWIPASGVP  159
              G  WI  +G+P
Sbjct  430  FHGTDWIEVTGIP  442



>gb|KHN35621.1| Putative pectinesterase/pectinesterase inhibitor 36 [Glycine 
soja]
Length=490

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 123/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQDTLYVH++RQFYRDC V GTIDFIFG+A  V Q+C + +RKPM    S QS  
Sbjct  300  CSFRAYQDTLYVHSNRQFYRDCYVYGTIDFIFGDATVVLQNCDIFVRKPM----SHQSNF  355

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P++  GI+I +  +    E+LT      +FLGRPWR+++RTV + + +D  +
Sbjct  356  ITAQGRDDPNKNTGISIQSCRVRPDSEFLTLKESFKTFLGRPWRKYSRTVFLKTDLDGLV  415

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ NTG GA    R  W G   + + ++A  F   +F+ G
Sbjct  416  HPRGWGEWSGEFALSTLYYGEYLNTGYGASTQNRVNWPGFHVLRSASEATPFTVNQFLQG  475

Query  188  DTWIPASGVPYSA  150
            + WIPA+GVP+S+
Sbjct  476  ERWIPATGVPFSS  488



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 125/194 (64%), Gaps = 6/194 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLYV++ RQFYRDC + GTIDFIFG+A AV Q+C + +R+PM    +GQ   
Sbjct  339  CSFKGYQDTLYVYSQRQFYRDCDIYGTIDFIFGDAVAVLQNCNIYVRRPM----NGQKNT  394

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR  P+E  GI I NS + AT +         ++LGRPW++++RT+ + S +D  I
Sbjct  395  VTAQGRKDPNENTGIVIHNSNVMATSDMRPVQGSFKTYLGRPWQKYSRTLFMKSNLDGLI  454

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKA-QADEFAPGKFIL  192
             P GW P+ G + L   +YGE+ NTG GA  ++R  W G   VITKA  A +F  G F+ 
Sbjct  455  DPAGWLPWSGNFALSTLYYGEYMNTGSGASTARRVNWPGYH-VITKATDAGKFTVGNFLA  513

Query  191  GDTWIPASGVPYSA  150
            GD+WIP +GVP+ +
Sbjct  514  GDSWIPGTGVPFDS  527



>ref|XP_002315399.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
 gb|EEF01570.2| hypothetical protein POPTR_0010s25400g [Populus trichocarpa]
Length=574

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 128/197 (65%), Gaps = 10/197 (5%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  +AYQDTLYVH+ RQFYR+C V GT+DFIFGNAAAVFQ+C L  RKPM+N    Q   
Sbjct  379  CSFEAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVFQNCNLYARKPMLN----QKNA  434

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYL-----TAPSPIVSFLGRPWRQHARTVIINSK  384
             TAQGR+ P++  GI+I N  I A P+       T  +  ++FLGRPW++++RTVI+ S 
Sbjct  435  FTAQGRTDPNQNTGISIHNCTIEAAPDLAMDRNSTDSNLTLNFLGRPWKEYSRTVIMQSY  494

Query  383  IDAPIAPEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPG  204
            I   I P GW  + GT GL+  +YGEF N G GA+ S+R +W G   ++   QA  F   
Sbjct  495  IGELIQPVGWLEWNGTVGLDTIYYGEFQNYGPGANTSRRVQWPGFN-LMNATQAVNFTVY  553

Query  203  KFILGDTWIPASGVPYS  153
             F +GDTW+P + VP+S
Sbjct  554  NFTMGDTWLPYTDVPFS  570



>ref|XP_003521962.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Glycine max]
Length=490

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 123/193 (64%), Gaps = 4/193 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQDTLYVH++RQFYRDC V GTIDFIFG+A  V Q+C + +RKPM    S QS  
Sbjct  300  CSFRAYQDTLYVHSNRQFYRDCYVYGTIDFIFGDATVVLQNCDIFVRKPM----SHQSNF  355

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR  P++  GI+I +  +    E+LT      +FLGRPWR+++RTV + + +D  +
Sbjct  356  ITAQGRDDPNKNTGISIQSCRVRPDSEFLTLKESFKTFLGRPWRKYSRTVFLKTDLDGLV  415

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + G + L   +YGE+ NTG GA    R  W G   + + ++A  F   +F+ G
Sbjct  416  HPRGWGEWSGEFALSTLYYGEYLNTGYGASTQNRVNWPGFHVLRSASEATPFTVNQFLQG  475

Query  188  DTWIPASGVPYSA  150
            + WIPA+GVP+S+
Sbjct  476  ERWIPATGVPFSS  488



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 126/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H +RQFYRDC +TGT+DFIFGNAA VFQ+CKL+ RKPM      Q+ M
Sbjct  338  CRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVFQNCKLVARKPM----DKQANM  393

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P +  G +I N  I A+ +       I S+LGRPW++++R V++ S I   I
Sbjct  394  VTAQGRTNPYQNTGTSIQNCNIIASSDLEPVKGTIKSYLGRPWKEYSRAVVLQSYIGDHI  453

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +YGE+ N G GA  SKR KW G + + + A+A  F   + I G
Sbjct  454  DPAGWSVWDGEFALKTLYYGEYVNRGPGAGTSKRVKWPGYRVITSPAEARNFTVAELIQG  513

Query  188  DTWIPASGVPYS  153
             TW+ ++GV Y+
Sbjct  514  GTWLESTGVAYT  525



>dbj|BAK06157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1147

 Score =   202 bits (513),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 94/190 (49%), Positives = 125/190 (66%), Gaps = 5/190 (3%)
 Frame = -3

Query  728   CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
             C+ + YQDTLYVHA+RQF+R+C V GTIDFIFGN+AAVFQ+C + +RKPM N G+    M
Sbjct  956   CRFEGYQDTLYVHANRQFFRNCEVLGTIDFIFGNSAAVFQNCLMTVRKPMDNQGN----M  1011

Query  548   VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
             VTA GR+ P+ P GI +    I          + I S+LGRPW+++ARTV++ S I   I
Sbjct  1012  VTAHGRTDPNMPTGIVLQGCKIVPEDALFPVRTTIPSYLGRPWKEYARTVVMESTIGDLI  1071

Query  368   APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
              PEGWS + G  GL+  +Y E+ NTG GA  SKR  W G + VI +A+A +F  G FI G
Sbjct  1072  KPEGWSEWMGDLGLKTLYYAEYANTGPGAGTSKRVAWPGYR-VIGQAEATKFTAGVFIDG  1130

Query  188   DTWIPASGVP  159
              +W+  +G P
Sbjct  1131  MSWLKNTGTP  1140



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
             + DAYQDTLY H+ RQFYRD  +TGT+DFIFGNAA V Q+CKL+ RKPM    SGQ  M
Sbjct  137  SRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPRKPM----SGQKNM  192

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P++  G +I    I A+ +     S   SFLGRPW++++RTV++ S I   I
Sbjct  193  VTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTVVMQSNIGDLI  252

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWS + G + L+  +YGE+ N G GA  SKR  WAG   + +  +A +F   + I G
Sbjct  253  DPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAKKFTVAELIQG  312

Query  188  DTWIPASGVPYS  153
              W+ ++GV Y+
Sbjct  313  GVWLKSTGVSYT  324



>ref|XP_010040919.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Eucalyptus grandis]
Length=230

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 126/194 (65%), Gaps = 4/194 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C    YQDTLY H+ RQFYR+  + GT+DFIFGN+A V Q C +  RKP+    SGQ   
Sbjct  38   CSILGYQDTLYAHSKRQFYRETDIYGTVDFIFGNSAVVLQKCNIYARKPL----SGQHNF  93

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTAQGR+ P +  GI+I +  I A  + +   S   +FLGRPW+Q++RTV++ S +D  I
Sbjct  94   VTAQGRTSPYQNTGISIHDCKIGAASDSVPLESKPTTFLGRPWKQYSRTVVMQSLLDGSI  153

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GWSP+ G + L+  +YGE+ N+G GA +++R +WA   G +T AQA  F   +FI G
Sbjct  154  HPLGWSPWSGDFALKTLFYGEYRNSGPGAPITRRVQWASYHGSLTPAQAQPFTVAQFISG  213

Query  188  DTWIPASGVPYSAK  147
            + W+P++GV + ++
Sbjct  214  NLWLPSTGVSFDSR  227



>emb|CDY08030.1| BnaC03g34930D [Brassica napus]
Length=239

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 126/193 (65%), Gaps = 5/193 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ D YQDTL+VH+ RQFYRDCTVTGTIDF+FG+A  + Q+  ++ RKP      GQ+C+
Sbjct  50   CKFDGYQDTLFVHSQRQFYRDCTVTGTIDFVFGDAKCILQNSVIVFRKPK----KGQTCV  105

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            V AQGRS   E  G+   N  ++   EY+       SFLGRPW++ +RT+++ S +D  I
Sbjct  106  VAAQGRSDRHESTGLVFQNCHVTGDEEYMAIRPAKKSFLGRPWKRFSRTIMLMSALDDVI  165

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P+GW P++G + L+  +Y E+ + G GA+ S R KW GVK  IT  +A  +  G+F+ G
Sbjct  166  DPDGWLPWKGEFALKTLYYAEYLSGGFGANDSLRVKWPGVKN-ITAEEAQLYTGGRFLGG  224

Query  188  DTWIPASGVPYSA  150
            D+WIP + VPY A
Sbjct  225  DSWIPHTQVPYIA  237



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 120/192 (63%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C   AYQD+LYVH++RQF+  C + GT+DFIFGNAA V Q+C +  RKP     SGQ  M
Sbjct  19   CDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGNAAVVLQNCDIHARKP----NSGQKNM  74

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI I  S I AT +         ++LGRPW++++RTVI+ S I   I
Sbjct  75   LTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITDII  134

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT+ L+  +Y E+ NTG GA  S R  W G K + +  +A  F PG FI G
Sbjct  135  DPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFIAG  194

Query  188  DTWIPASGVPYS  153
             +W+ A+G P++
Sbjct  195  GSWLSATGFPFT  206



>ref|XP_006398954.1| hypothetical protein EUTSA_v10013020mg [Eutrema salsugineum]
 gb|ESQ40407.1| hypothetical protein EUTSA_v10013020mg [Eutrema salsugineum]
Length=602

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 125/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C + GTIDFIFGNAAA+FQ+C +  RKPM      Q   
Sbjct  409  CSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAIFQNCNIYARKPM----PKQKNA  464

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            VTA GR+ P++  GI+I+N  I A P+    P+P ++FLGRPW+ ++RTV I S I   I
Sbjct  465  VTAHGRTDPNQKTGISIINCTIGAAPDLAADPNPAMTFLGRPWKPYSRTVYIQSYISDAI  524

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW  + GT GL+   YGE+ N G GA+ SKR +W+G   ++  AQA  F    F LG
Sbjct  525  QPVGWLEWNGTTGLDTISYGEYDNFGPGANTSKRVQWSGY-SLLNLAQAMNFTVYNFTLG  583

Query  188  DTWIPASGVPY  156
            DTW+P + +P+
Sbjct  584  DTWLPQTDIPF  594



>gb|AAF16637.1|AC011661_15 T23J18.24 [Arabidopsis thaliana]
Length=223

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C+ DAYQDTLY H  RQFYRD  +TGT+DFIFGN+A VFQ+C ++ R P    G+GQ  M
Sbjct  33   CRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNP----GAGQKNM  88

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR   ++   I+I    I+A+ +       + +FLGRPW+ ++RTVI+ S ID  I
Sbjct  89   LTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHI  148

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
             P GW P+ G + L   +YGE+ NTG GAD SKR  W G K +    +A++F   K I G
Sbjct  149  DPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLIQG  208

Query  188  DTWIPASGVPY  156
              W+  +GV +
Sbjct  209  GLWLKPTGVTF  219



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query  728  CQXDAYQDTLYVHAHRQFYRDCTVTGTIDFIFGNAAAVFQSCKLIIRKPMINNGSGQSCM  549
            C  + YQDTLYVH+ RQFYR+C V GT+DFIFGNAA VFQSC + +R+PM    S Q   
Sbjct  270  CSFEGYQDTLYVHSLRQFYRECEVYGTVDFIFGNAAVVFQSCNIYVRRPM----SQQKNT  325

Query  548  VTAQGRSQPDEPNGIAILNSVISATPEYLTAPSPIVSFLGRPWRQHARTVIINSKIDAPI  369
            +TAQGR+ P++  GI+I    + A  +   A S   +FLGRPW++++RTV + + +D  I
Sbjct  326  ITAQGRTDPNQNTGISIQYCRVRAAKDLRPAQSSFETFLGRPWKENSRTVYMETYMDDLI  385

Query  368  APEGWSPFQGTWGLEDCWYGEFGNTGKGADVSKRAKWAGVKGVITKAQADEFAPGKFILG  189
            +P GW  + G + LE  +YGEF NTG G++ SKR KW G   +   + A EF     I G
Sbjct  386  SPAGWLEWSGGFALETLFYGEFRNTGPGSNTSKRVKWGGYHVITDPSAASEFTARNLIAG  445

Query  188  DTWIPASGVPYS  153
            + W+P++GVP++
Sbjct  446  EMWLPSTGVPFT  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470