BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016A21

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB36954.1|  hypothetical protein B456_006G184000                    327   9e-105   Gossypium raimondii
ref|XP_009628441.1|  PREDICTED: pyruvate decarboxylase 1                324   1e-103   Nicotiana tomentosiformis
gb|KJB36951.1|  hypothetical protein B456_006G183900                    324   1e-103   Gossypium raimondii
ref|XP_006362373.1|  PREDICTED: pyruvate decarboxylase 2-like           323   2e-103   Solanum tuberosum [potatoes]
ref|XP_007026634.1|  Thiamine pyrophosphate dependent pyruvate de...    322   7e-103   
sp|P51851.1|PDC2_PEA  RecName: Full=Pyruvate decarboxylase 2; Sho...    316   8e-103   Pisum sativum [garden pea]
gb|KDP22863.1|  hypothetical protein JCGZ_00450                         322   1e-102   Jatropha curcas
ref|XP_010033739.1|  PREDICTED: pyruvate decarboxylase 1                321   2e-102   Eucalyptus grandis [rose gum]
ref|XP_010033533.1|  PREDICTED: pyruvate decarboxylase 2                320   4e-102   Eucalyptus grandis [rose gum]
gb|KDO56720.1|  hypothetical protein CISIN_1g044559mg                   320   4e-102   Citrus sinensis [apfelsine]
ref|XP_004246778.1|  PREDICTED: pyruvate decarboxylase 1                320   6e-102   Solanum lycopersicum
gb|KCW88160.1|  hypothetical protein EUGRSUZ_A00549                     320   6e-102   Eucalyptus grandis [rose gum]
ref|XP_003604737.1|  Pyruvate decarboxylase isozyme                     320   6e-102   Medicago truncatula
ref|XP_006429440.1|  hypothetical protein CICLE_v10011317mg             319   8e-102   Citrus clementina [clementine]
ref|NP_001055805.1|  Os05g0469800                                       305   1e-101   
ref|XP_009789106.1|  PREDICTED: pyruvate decarboxylase 1                320   1e-101   Nicotiana sylvestris
ref|XP_003623318.1|  Pyruvate decarboxylase isozyme                     319   1e-101   Medicago truncatula
ref|XP_003623316.1|  Pyruvate decarboxylase isozyme                     318   2e-101   
ref|XP_010092799.1|  Pyruvate decarboxylase isozyme 2                   318   2e-101   Morus notabilis
gb|AAO72533.1|  pyruvate decarboxylase 1                                318   3e-101   Lotus corniculatus
ref|XP_003529168.1|  PREDICTED: pyruvate decarboxylase 1                318   3e-101   Glycine max [soybeans]
ref|XP_003552267.1|  PREDICTED: pyruvate decarboxylase 2                318   4e-101   Glycine max [soybeans]
ref|XP_011095042.1|  PREDICTED: pyruvate decarboxylase 1                318   4e-101   Sesamum indicum [beniseed]
ref|XP_002322997.1|  pyruvate decarboxylase family protein              317   5e-101   Populus trichocarpa [western balsam poplar]
emb|CDP06456.1|  unnamed protein product                                317   5e-101   Coffea canephora [robusta coffee]
gb|ACI41984.1|  putative pyruvate decarboxylase 2                       313   5e-101   Diospyros kaki [Japanese persimmon]
gb|AIE47265.1|  pyruvate decarboxylase                                  317   7e-101   Hevea brasiliensis [jebe]
ref|XP_004137700.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    317   9e-101   Cucumis sativus [cucumbers]
ref|XP_004156618.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    317   1e-100   
ref|XP_002530500.1|  pyruvate decarboxylase, putative                   317   1e-100   Ricinus communis
ref|XP_004492473.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    316   1e-100   
gb|AAP96920.1|  pyruvate decarboxylase                                  316   1e-100   Dianthus caryophyllus [carnation]
gb|EYU41928.1|  hypothetical protein MIMGU_mgv1a003147mg                316   1e-100   Erythranthe guttata [common monkey flower]
ref|XP_004492472.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    316   2e-100   Cicer arietinum [garbanzo]
gb|ABE57121.1|  pyruvate decarboxylase                                  301   2e-100   Coix lacryma-jobi
ref|XP_003614223.1|  Pyruvate decarboxylase isozyme                     316   2e-100   Medicago truncatula
ref|XP_011046856.1|  PREDICTED: pyruvate decarboxylase 2                315   3e-100   Populus euphratica
ref|XP_004506726.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    315   3e-100   Cicer arietinum [garbanzo]
ref|XP_010033427.1|  PREDICTED: pyruvate decarboxylase 1-like           315   4e-100   Eucalyptus grandis [rose gum]
gb|AIE47264.1|  pyruvate decarboxylase                                  314   6e-100   Hevea brasiliensis [jebe]
ref|XP_011019081.1|  PREDICTED: pyruvate decarboxylase 2-like           314   7e-100   Populus euphratica
emb|CAA63404.1|  pyruvate decarboxylase                                 300   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253807.1|  PREDICTED: pyruvate decarboxylase 2-like           313   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010676788.1|  PREDICTED: pyruvate decarboxylase 2                313   2e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|AGO61957.1|  pyruvate decarboxylase                                  309   2e-99    Prunus serrulata
gb|KFK27091.1|  hypothetical protein AALP_AA8G333000                    313   3e-99    Arabis alpina [alpine rockcress]
gb|EMT01304.1|  Pyruvate decarboxylase isozyme 2                        300   5e-99    
ref|XP_002308230.1|  pyruvate decarboxylase family protein              312   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_009769363.1|  PREDICTED: pyruvate decarboxylase 1-like           311   9e-99    Nicotiana sylvestris
gb|ACI41985.1|  putative pyruvate decarboxylase 3                       304   1e-98    Diospyros kaki [Japanese persimmon]
gb|AAG22488.1|AF195868_1  pyruvate decarboxylase 1                      310   2e-98    Vitis vinifera
gb|ACL54119.1|  unknown                                                 304   2e-98    Zea mays [maize]
ref|XP_008775408.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     310   2e-98    Phoenix dactylifera
gb|AIL23783.1|  pyruvate decarboxylase                                  310   3e-98    Prunus serrulata
gb|ABZ79223.1|  pyruvate decarboxylase                                  310   3e-98    Prunus armeniaca
ref|XP_009622836.1|  PREDICTED: pyruvate decarboxylase 1-like           310   3e-98    Nicotiana tomentosiformis
ref|XP_002272615.1|  PREDICTED: pyruvate decarboxylase 2                310   3e-98    Vitis vinifera
gb|AGA15797.1|  pyruvate decarboxylase 2                                310   3e-98    Diospyros kaki [Japanese persimmon]
ref|XP_007208309.1|  hypothetical protein PRUPE_ppa003086mg             310   3e-98    Prunus persica
gb|AAY86034.1|  pyruvate decarboxylase                                  296   5e-98    Citrus sinensis [apfelsine]
emb|CAB61763.1|  pyruvate decarboxylase                                 296   7e-98    Saccharum officinarum [noble cane]
ref|XP_003522062.1|  PREDICTED: pyruvate decarboxylase 1-like           308   8e-98    
ref|XP_011071825.1|  PREDICTED: pyruvate decarboxylase 1-like           309   8e-98    Sesamum indicum [beniseed]
gb|ABJ99596.1|  pyruvate decarboxylase                                  309   9e-98    Lycoris aurea [golden hurricane-lily]
ref|XP_003520410.1|  PREDICTED: pyruvate decarboxylase 1-like           308   1e-97    
ref|XP_009399900.1|  PREDICTED: pyruvate decarboxylase 2                309   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007016910.1|  Thiamine pyrophosphate dependent pyruvate de...    309   1e-97    
gb|KJB57435.1|  hypothetical protein B456_009G164100                    302   1e-97    Gossypium raimondii
ref|XP_008243339.1|  PREDICTED: pyruvate decarboxylase 2                308   1e-97    Prunus mume [ume]
ref|XP_002866069.1|  pyruvate decarboxylase-2                           308   1e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_010920798.1|  PREDICTED: pyruvate decarboxylase 1                308   1e-97    Elaeis guineensis
ref|NP_001284421.1|  pyruvate decarboxylase 1                           308   1e-97    Cucumis melo [Oriental melon]
gb|KHN22554.1|  Pyruvate decarboxylase isozyme 2                        308   1e-97    Glycine soja [wild soybean]
ref|XP_010443084.1|  PREDICTED: pyruvate decarboxylase 2-like           308   1e-97    Camelina sativa [gold-of-pleasure]
gb|AAA68290.1|  pyruvate decarboxylase 1                                308   2e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_010529008.1|  PREDICTED: pyruvate decarboxylase 2                308   3e-97    Tarenaya hassleriana [spider flower]
sp|A2Y5L9.1|PDC1_ORYSI  RecName: Full=Pyruvate decarboxylase 1; S...    308   3e-97    Oryza sativa Indica Group [Indian rice]
dbj|BAC20138.1|  pyruvate decarboxylase                                 308   3e-97    Oryza sativa [red rice]
ref|NP_001055803.1|  Os05g0469600                                       307   3e-97    
gb|KHN18047.1|  Pyruvate decarboxylase isozyme 2                        308   3e-97    Glycine soja [wild soybean]
ref|XP_003516954.1|  PREDICTED: pyruvate decarboxylase 4                307   3e-97    Glycine max [soybeans]
ref|XP_004294304.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    307   4e-97    Fragaria vesca subsp. vesca
gb|EPS58298.1|  pyruvate decarboxylase                                  306   4e-97    Genlisea aurea
gb|AGA15796.1|  pyruvate decarboxylase 1                                301   5e-97    Diospyros kaki [Japanese persimmon]
ref|NP_195752.1|  pyruvate decarboxylase 4                              307   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447294.1|  PREDICTED: pyruvate decarboxylase 1-like           307   5e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010052217.1|  PREDICTED: pyruvate decarboxylase 1                306   6e-97    Eucalyptus grandis [rose gum]
ref|XP_010482907.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     307   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010448857.1|  PREDICTED: pyruvate decarboxylase 2-like           308   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010257091.1|  PREDICTED: pyruvate decarboxylase 1-like           306   6e-97    Nelumbo nucifera [Indian lotus]
gb|ABR17980.1|  unknown                                                 301   7e-97    Picea sitchensis
gb|ABJ99597.1|  pyruvate decarboxylase                                  306   7e-97    Lycoris aurea [golden hurricane-lily]
gb|ACN40470.1|  unknown                                                 300   8e-97    Picea sitchensis
ref|NP_195033.1|  pyruvate decarboxylase 1                              306   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195753.1|  pyruvate decarboxylase-3                              306   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125425.1|  PREDICTED: pyruvate decarboxylase 4                306   8e-97    Brassica rapa
ref|XP_004961783.1|  PREDICTED: pyruvate decarboxylase 1-like           306   8e-97    Setaria italica
ref|XP_007140235.1|  hypothetical protein PHAVU_008G095400g             306   9e-97    Phaseolus vulgaris [French bean]
ref|XP_006401505.1|  hypothetical protein EUTSA_v10013010mg             306   1e-96    Eutrema salsugineum [saltwater cress]
ref|XP_006649916.1|  PREDICTED: pyruvate decarboxylase 2-like           299   1e-96    
ref|XP_006283364.1|  hypothetical protein CARUB_v10004406mg             306   2e-96    Capsella rubella
ref|XP_010432620.1|  PREDICTED: pyruvate decarboxylase 1-like           306   2e-96    Camelina sativa [gold-of-pleasure]
gb|AAO42252.1|  putative pyruvate decarboxylase                         304   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281555.1|  hypothetical protein CARUB_v10027657mg             306   2e-96    Capsella rubella
ref|XP_006363624.1|  PREDICTED: pyruvate decarboxylase 1-like           305   2e-96    Solanum tuberosum [potatoes]
gb|EMT10365.1|  Pyruvate decarboxylase isozyme 2                        300   2e-96    
gb|AEF33613.1|  pyruvate decarboxylase                                  305   2e-96    Salvia miltiorrhiza f. alba
gb|ACI41983.1|  putative pyruvate decarboxylase 1                       301   2e-96    Diospyros kaki [Japanese persimmon]
ref|XP_010922580.1|  PREDICTED: pyruvate decarboxylase 2-like           305   2e-96    Elaeis guineensis
gb|AAG13131.1|AF193791_1  pyruvate decarboxylase                        305   3e-96    Fragaria x ananassa
emb|CDY19880.1|  BnaC09g31460D                                          305   3e-96    Brassica napus [oilseed rape]
ref|XP_009120024.1|  PREDICTED: pyruvate decarboxylase 2                305   3e-96    Brassica rapa
emb|CDY17293.1|  BnaA10g09270D                                          305   3e-96    Brassica napus [oilseed rape]
ref|NP_200307.1|  pyruvate decarboxylase-2                              305   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437810.1|  PREDICTED: pyruvate decarboxylase 1                305   3e-96    Camelina sativa [gold-of-pleasure]
emb|CDY66930.1|  BnaCnng52860D                                          305   3e-96    Brassica napus [oilseed rape]
gb|EAY98380.1|  hypothetical protein OsI_20291                          305   4e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010451999.1|  PREDICTED: pyruvate decarboxylase 4-like           305   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010558370.1|  PREDICTED: pyruvate decarboxylase 1-like           305   4e-96    Tarenaya hassleriana [spider flower]
ref|XP_002867205.1|  hypothetical protein ARALYDRAFT_491381             305   5e-96    
ref|XP_002439941.1|  hypothetical protein SORBIDRAFT_09g023060          305   5e-96    Sorghum bicolor [broomcorn]
ref|XP_009773011.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     304   5e-96    Nicotiana sylvestris
ref|XP_010423945.1|  PREDICTED: pyruvate decarboxylase 4                304   5e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009376417.1|  PREDICTED: pyruvate decarboxylase 2                305   5e-96    
gb|EYU42548.1|  hypothetical protein MIMGU_mgv1a003111mg                304   5e-96    Erythranthe guttata [common monkey flower]
ref|XP_008384777.1|  PREDICTED: pyruvate decarboxylase 1-like iso...    304   5e-96    
ref|XP_002870930.1|  pyruvate decarboxylase-3                           304   5e-96    Arabidopsis lyrata subsp. lyrata
gb|ACR35995.1|  unknown                                                 304   6e-96    Zea mays [maize]
ref|XP_009385546.1|  PREDICTED: pyruvate decarboxylase 1-like           304   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL37492.1|  pyruvate decarboxylase                                  304   7e-96    Fragaria x ananassa
ref|XP_002870931.1|  hypothetical protein ARALYDRAFT_486945             304   7e-96    
gb|EMT10366.1|  Pyruvate decarboxylase isozyme 2                        298   8e-96    
ref|XP_009358206.1|  PREDICTED: pyruvate decarboxylase 1-like           303   8e-96    Pyrus x bretschneideri [bai li]
ref|XP_009594221.1|  PREDICTED: pyruvate decarboxylase 2 isoform X2     303   8e-96    Nicotiana tomentosiformis
ref|XP_006286440.1|  hypothetical protein CARUB_v10003893mg             303   9e-96    Capsella rubella
ref|XP_004302532.1|  PREDICTED: pyruvate decarboxylase 2                303   1e-95    Fragaria vesca subsp. vesca
ref|XP_008350688.1|  PREDICTED: pyruvate decarboxylase 2                300   1e-95    
ref|XP_009369597.1|  PREDICTED: pyruvate decarboxylase 2-like           303   1e-95    Pyrus x bretschneideri [bai li]
ref|XP_009338952.1|  PREDICTED: pyruvate decarboxylase 2-like           303   1e-95    Pyrus x bretschneideri [bai li]
gb|KFK24633.1|  hypothetical protein AALP_AA8G005000                    303   2e-95    Arabis alpina [alpine rockcress]
ref|XP_007134808.1|  hypothetical protein PHAVU_010G078000g             303   2e-95    Phaseolus vulgaris [French bean]
ref|XP_010253808.1|  PREDICTED: pyruvate decarboxylase 1                304   3e-95    Nelumbo nucifera [Indian lotus]
sp|P28516.1|PDC1_MAIZE  RecName: Full=Pyruvate decarboxylase 1; S...    303   3e-95    Zea mays [maize]
gb|KJB57434.1|  hypothetical protein B456_009G164100                    302   3e-95    Gossypium raimondii
gb|ACF87987.1|  unknown                                                 295   3e-95    Zea mays [maize]
ref|XP_006398630.1|  hypothetical protein EUTSA_v10013008mg             302   4e-95    Eutrema salsugineum [saltwater cress]
ref|XP_007207128.1|  hypothetical protein PRUPE_ppa003096mg             302   4e-95    Prunus persica
ref|XP_009391704.1|  PREDICTED: pyruvate decarboxylase 1                302   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21559.1|  hypothetical protein B456_004G001200                    302   4e-95    Gossypium raimondii
ref|XP_008221277.1|  PREDICTED: pyruvate decarboxylase 1-like           302   5e-95    Prunus mume [ume]
ref|XP_004485877.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    301   5e-95    Cicer arietinum [garbanzo]
ref|XP_007025437.1|  Pyruvate decarboxylase-2 isoform 1                 301   5e-95    
ref|XP_007025438.1|  Pyruvate decarboxylase-2 isoform 2                 301   5e-95    
ref|XP_008344771.1|  PREDICTED: pyruvate decarboxylase 1-like           301   6e-95    
ref|XP_008362250.1|  PREDICTED: pyruvate decarboxylase 2-like           301   6e-95    
ref|XP_011096418.1|  PREDICTED: pyruvate decarboxylase 1                301   6e-95    Sesamum indicum [beniseed]
ref|XP_010264586.1|  PREDICTED: pyruvate decarboxylase 2                301   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008372585.1|  PREDICTED: pyruvate decarboxylase 2                298   7e-95    
emb|CDY10495.1|  BnaCnng03960D                                          301   8e-95    Brassica napus [oilseed rape]
ref|XP_010277737.1|  PREDICTED: pyruvate decarboxylase 1                301   8e-95    Nelumbo nucifera [Indian lotus]
ref|XP_004249069.1|  PREDICTED: pyruvate decarboxylase 1-like           301   1e-94    Solanum lycopersicum
ref|XP_008391462.1|  PREDICTED: pyruvate decarboxylase 2-like           298   1e-94    
ref|XP_011460964.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    301   1e-94    Fragaria vesca subsp. vesca
emb|CBI15925.3|  unnamed protein product                                300   1e-94    Vitis vinifera
ref|XP_002275486.1|  PREDICTED: pyruvate decarboxylase 1                299   2e-94    Vitis vinifera
gb|KJB69604.1|  hypothetical protein B456_011G033400                    292   2e-94    Gossypium raimondii
ref|XP_010279076.1|  PREDICTED: pyruvate decarboxylase 1-like           300   2e-94    Nelumbo nucifera [Indian lotus]
emb|CDO99368.1|  unnamed protein product                                300   2e-94    Coffea canephora [robusta coffee]
dbj|BAC23043.1|  pyruvate decarboxylase                                 300   2e-94    Solanum tuberosum [potatoes]
ref|XP_002465414.1|  hypothetical protein SORBIDRAFT_01g038360          300   2e-94    Sorghum bicolor [broomcorn]
ref|NP_001105422.1|  pyruvate decarboxylase 1                           300   2e-94    
gb|AAX33299.1|  pyruvate decarboxylase 2                                300   3e-94    Petunia x hybrida [garden petunia]
ref|XP_004984863.1|  PREDICTED: pyruvate decarboxylase 2-like           300   3e-94    Setaria italica
ref|XP_008356242.1|  PREDICTED: pyruvate decarboxylase 2                296   3e-94    
dbj|BAK04101.1|  predicted protein                                      300   3e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958794.1|  PREDICTED: pyruvate decarboxylase 2-like           300   3e-94    Setaria italica
ref|XP_006363625.1|  PREDICTED: pyruvate decarboxylase 1-like           300   3e-94    Solanum tuberosum [potatoes]
ref|XP_002276535.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     300   4e-94    Vitis vinifera
emb|CDO96745.1|  unnamed protein product                                298   5e-94    Coffea canephora [robusta coffee]
gb|AAB16855.1|  pyruvate decarboxylase                                  299   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779927.1|  PREDICTED: pyruvate decarboxylase 1-like           288   7e-94    Phoenix dactylifera
sp|P51850.1|PDC1_PEA  RecName: Full=Pyruvate decarboxylase 1; Sho...    298   7e-94    Pisum sativum [garden pea]
ref|XP_010323135.1|  PREDICTED: pyruvate decarboxylase 2                298   7e-94    Solanum lycopersicum
ref|XP_008654188.1|  PREDICTED: pyruvate decarboxylase 3-like           299   7e-94    Zea mays [maize]
gb|ACG29583.1|  pyruvate decarboxylase isozyme 1                        299   8e-94    Zea mays [maize]
ref|XP_011094440.1|  PREDICTED: pyruvate decarboxylase 1-like           298   1e-93    Sesamum indicum [beniseed]
ref|XP_008384776.1|  PREDICTED: pyruvate decarboxylase 2-like iso...    298   2e-93    
ref|XP_006449474.1|  hypothetical protein CICLE_v10014703mg             297   2e-93    Citrus clementina [clementine]
gb|KDO77804.1|  hypothetical protein CISIN_1g007800mg                   297   2e-93    Citrus sinensis [apfelsine]
gb|EMT15339.1|  hypothetical protein F775_43983                         298   2e-93    
gb|EMS61021.1|  Pyruvate decarboxylase isozyme 2                        297   2e-93    Triticum urartu
dbj|BAJ94428.1|  predicted protein                                      298   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009773010.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     298   2e-93    Nicotiana sylvestris
ref|XP_008362261.1|  PREDICTED: pyruvate decarboxylase 2-like           298   2e-93    
sp|A2XFI3.2|PDC2_ORYSI  RecName: Full=Pyruvate decarboxylase 2; S...    298   2e-93    Oryza sativa Indica Group [Indian rice]
gb|AAA90948.1|  pyruvate decarboxylase 2                                297   2e-93    Oryza sativa Indica Group [Indian rice]
gb|ABR25487.1|  pyruvate decarboxylase isozyme 3                        284   3e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_008775407.1|  PREDICTED: pyruvate decarboxylase 2-like           297   3e-93    Phoenix dactylifera
sp|P51846.1|PDC2_TOBAC  RecName: Full=Pyruvate decarboxylase 2; S...    297   3e-93    Nicotiana tabacum [American tobacco]
ref|XP_009594220.1|  PREDICTED: pyruvate decarboxylase 2 isoform X1     297   4e-93    Nicotiana tomentosiformis
ref|XP_003542972.1|  PREDICTED: pyruvate decarboxylase 1-like           296   5e-93    Glycine max [soybeans]
ref|XP_008457351.1|  PREDICTED: pyruvate decarboxylase 2-like           296   6e-93    Cucumis melo [Oriental melon]
ref|XP_003558149.1|  PREDICTED: pyruvate decarboxylase 2                296   6e-93    Brachypodium distachyon [annual false brome]
ref|XP_008653674.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    288   6e-93    
ref|XP_002305755.2|  pyruvate decarboxylase family protein              296   7e-93    
ref|NP_001275795.1|  pyruvate decarboxylase                             296   8e-93    Citrus sinensis [apfelsine]
ref|NP_001105052.1|  pyruvate decarboxylase 3                           295   1e-92    Zea mays [maize]
gb|AAL99745.1|  pyruvate decarboxylase                                  295   1e-92    Zea mays [maize]
ref|XP_003593734.1|  Pyruvate decarboxylase                             295   2e-92    Medicago truncatula
ref|XP_007148065.1|  hypothetical protein PHAVU_006G177600g             295   2e-92    Phaseolus vulgaris [French bean]
ref|XP_009123548.1|  PREDICTED: pyruvate decarboxylase 1-like           295   2e-92    Brassica rapa
ref|XP_002317431.1|  pyruvate decarboxylase family protein              295   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002522545.1|  pyruvate decarboxylase, putative                   294   2e-92    Ricinus communis
ref|XP_009384923.1|  PREDICTED: pyruvate decarboxylase 1-like           295   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145248.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    295   3e-92    Cucumis sativus [cucumbers]
sp|Q05327.1|PDC3_MAIZE  RecName: Full=Pyruvate decarboxylase 3; S...    281   4e-92    Zea mays [maize]
ref|XP_010108431.1|  Pyruvate decarboxylase isozyme 1                   294   4e-92    Morus notabilis
gb|AIE47262.1|  pyruvate decarboxylase                                  293   5e-92    Hevea brasiliensis [jebe]
ref|XP_010924891.1|  PREDICTED: pyruvate decarboxylase 1-like           293   5e-92    Elaeis guineensis
ref|XP_006350849.1|  PREDICTED: pyruvate decarboxylase 2-like           294   6e-92    Solanum tuberosum [potatoes]
gb|KCW52500.1|  hypothetical protein EUGRSUZ_J01896                     294   6e-92    Eucalyptus grandis [rose gum]
ref|XP_010034573.1|  PREDICTED: pyruvate decarboxylase 1-like           294   7e-92    Eucalyptus grandis [rose gum]
gb|EYU28059.1|  hypothetical protein MIMGU_mgv1a003736mg                293   7e-92    Erythranthe guttata [common monkey flower]
ref|XP_010912563.1|  PREDICTED: pyruvate decarboxylase 1                293   8e-92    Elaeis guineensis
ref|XP_009386639.1|  PREDICTED: pyruvate decarboxylase 1-like           293   9e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968281.1|  PREDICTED: pyruvate decarboxylase 2-like           293   1e-91    Setaria italica
ref|XP_004165846.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    293   1e-91    
ref|XP_004134669.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    293   1e-91    Cucumis sativus [cucumbers]
ref|XP_010650884.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     293   1e-91    Vitis vinifera
ref|XP_009402387.1|  PREDICTED: pyruvate decarboxylase 1-like           293   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011045902.1|  PREDICTED: pyruvate decarboxylase 1                292   1e-91    Populus euphratica
gb|KHG03537.1|  Pyruvate decarboxylase isozyme 1                        293   2e-91    Gossypium arboreum [tree cotton]
gb|EEE58866.1|  hypothetical protein OsJ_10464                          291   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009352809.1|  PREDICTED: pyruvate decarboxylase 1                292   2e-91    Pyrus x bretschneideri [bai li]
ref|XP_006658999.1|  PREDICTED: pyruvate decarboxylase 3-like           290   2e-91    
ref|XP_001763233.1|  predicted protein                                  291   2e-91    
ref|XP_008805101.1|  PREDICTED: pyruvate decarboxylase 1-like           292   3e-91    Phoenix dactylifera
gb|EEC82735.1|  hypothetical protein OsI_27437                          287   3e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_008805886.1|  PREDICTED: pyruvate decarboxylase 1                291   3e-91    Phoenix dactylifera
ref|XP_010686333.1|  PREDICTED: pyruvate decarboxylase 1                291   3e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004293926.1|  PREDICTED: pyruvate decarboxylase 1                291   3e-91    Fragaria vesca subsp. vesca
ref|NP_001049811.1|  Os03g0293500                                       292   3e-91    
ref|XP_007026635.1|  Thiamine pyrophosphate dependent pyruvate de...    292   3e-91    
ref|XP_009801931.1|  PREDICTED: pyruvate decarboxylase 1 isoform X1     291   4e-91    Nicotiana sylvestris
ref|XP_010543216.1|  PREDICTED: pyruvate decarboxylase 1                291   4e-91    Tarenaya hassleriana [spider flower]
ref|XP_004232952.1|  PREDICTED: pyruvate decarboxylase 1                291   5e-91    Solanum lycopersicum
ref|XP_008225205.1|  PREDICTED: pyruvate decarboxylase 1                290   9e-91    Prunus mume [ume]
ref|XP_007213938.1|  hypothetical protein PRUPE_ppa003458mg             290   9e-91    Prunus persica
ref|XP_011027712.1|  PREDICTED: pyruvate decarboxylase 1-like           290   1e-90    Populus euphratica
gb|AIE47263.1|  pyruvate decarboxylase                                  290   1e-90    Hevea brasiliensis [jebe]
ref|XP_009607456.1|  PREDICTED: pyruvate decarboxylase 1                290   1e-90    Nicotiana tomentosiformis
ref|XP_002455158.1|  hypothetical protein SORBIDRAFT_03g005240          289   2e-90    Sorghum bicolor [broomcorn]
ref|NP_001284406.1|  pyruvate decarboxylase                             289   3e-90    Cucumis melo [Oriental melon]
ref|XP_010553236.1|  PREDICTED: pyruvate decarboxylase 2-like           289   3e-90    Tarenaya hassleriana [spider flower]
ref|XP_002986100.1|  hypothetical protein SELMODRAFT_157772             288   4e-90    Selaginella moellendorffii
ref|XP_002989648.1|  hypothetical protein SELMODRAFT_160305             288   5e-90    Selaginella moellendorffii
gb|KDP21067.1|  hypothetical protein JCGZ_21538                         288   6e-90    Jatropha curcas
ref|XP_002963708.1|  hypothetical protein SELMODRAFT_80644              288   7e-90    
ref|XP_002974798.1|  hypothetical protein SELMODRAFT_101858             286   3e-89    
sp|A2YQ76.2|PDC3_ORYSI  RecName: Full=Pyruvate decarboxylase 3; S...    286   3e-89    Oryza sativa Indica Group [Indian rice]
ref|NP_001060727.1|  Os07g0693100                                       286   4e-89    
emb|CAG30578.1|  pyruvate decarboxylase isozyme 1                       285   6e-89    Lotus japonicus
ref|XP_010279075.1|  PREDICTED: pyruvate decarboxylase 1-like           285   1e-88    Nelumbo nucifera [Indian lotus]
dbj|BAK02798.1|  predicted protein                                      285   1e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO77805.1|  hypothetical protein CISIN_1g007800mg                   285   1e-88    Citrus sinensis [apfelsine]
ref|XP_003569007.1|  PREDICTED: pyruvate decarboxylase 1-like           285   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_011046076.1|  PREDICTED: pyruvate decarboxylase 1-like           284   2e-88    Populus euphratica
ref|XP_006372352.1|  hypothetical protein POPTR_0017s00800g             284   3e-88    Populus trichocarpa [western balsam poplar]
gb|AAA68289.1|  pyruvate decarboxylase                                  283   3e-88    Oryza sativa Indica Group [Indian rice]
gb|EMS61276.1|  Pyruvate decarboxylase isozyme 2                        275   4e-88    Triticum urartu
gb|EMS46913.1|  Pyruvate decarboxylase isozyme 2                        280   5e-88    Triticum urartu
ref|XP_006643782.1|  PREDICTED: pyruvate decarboxylase 1-like           280   6e-88    Oryza brachyantha
emb|CDM81546.1|  unnamed protein product                                281   1e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008244071.1|  PREDICTED: pyruvate decarboxylase 2-like           281   3e-87    Prunus mume [ume]
ref|XP_006843656.1|  hypothetical protein AMTR_s00007p00179930          281   5e-87    Amborella trichopoda
gb|ACR37828.1|  unknown                                                 273   8e-87    Zea mays [maize]
gb|EAY72634.1|  hypothetical protein OsI_00500                          280   8e-87    Oryza sativa Indica Group [Indian rice]
ref|NP_001042088.1|  Os01g0160100                                       279   3e-86    
ref|XP_010037690.1|  PREDICTED: pyruvate decarboxylase 1-like           279   6e-86    Eucalyptus grandis [rose gum]
ref|XP_010088247.1|  Pyruvate decarboxylase isozyme 2                   271   1e-85    
ref|XP_010040428.1|  PREDICTED: pyruvate decarboxylase 1-like           277   1e-85    
gb|KCW49436.1|  hypothetical protein EUGRSUZ_K02968                     276   4e-85    
gb|ACG41852.1|  pyruvate decarboxylase isozyme 1                        275   7e-85    
ref|XP_010039167.1|  PREDICTED: pyruvate decarboxylase 1-like           276   1e-84    
gb|ACL54539.1|  unknown                                                 275   1e-84    
ref|NP_001105645.1|  pyruvate decarboxylase                             275   1e-84    
gb|AFW80093.1|  pyruvate decarboxylase2                                 275   2e-84    
ref|XP_010089789.1|  Pyruvate decarboxylase isozyme 2                   271   1e-83    
gb|AAB16854.1|  pyruvate decarboxylase                                  270   9e-83    
ref|XP_001773989.1|  predicted protein                                  269   1e-82    
gb|KCW45223.1|  hypothetical protein EUGRSUZ_L01137                     263   1e-82    
gb|KHN26768.1|  Pyruvate decarboxylase isozyme 2                        268   7e-82    
ref|XP_010040424.1|  PREDICTED: pyruvate decarboxylase 1-like           268   8e-82    
ref|XP_010040426.1|  PREDICTED: pyruvate decarboxylase 1-like           263   5e-81    
ref|XP_003532957.2|  PREDICTED: pyruvate decarboxylase 2-like           265   1e-80    
gb|AAM18119.1|  pyruvate decarboxylase                                  253   2e-80    
gb|KCW45222.1|  hypothetical protein EUGRSUZ_L01136                     264   5e-80    
gb|EMT03835.1|  Pyruvate decarboxylase isozyme 1                        255   1e-79    
ref|XP_001756932.1|  predicted protein                                  259   4e-79    
gb|KCW88159.1|  hypothetical protein EUGRSUZ_A00548                     256   4e-78    
ref|XP_001782896.1|  predicted protein                                  257   4e-78    
ref|XP_007214497.1|  hypothetical protein PRUPE_ppa019548mg             256   6e-78    
gb|KCW45220.1|  hypothetical protein EUGRSUZ_L01136                     256   3e-77    
ref|XP_002514646.1|  pyruvate decarboxylase, putative                   254   1e-76    
ref|XP_009402769.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    244   3e-76    
gb|KGN54394.1|  hypothetical protein Csa_4G312270                       245   7e-76    
ref|XP_008464266.1|  PREDICTED: pyruvate decarboxylase 1-like           252   1e-75    
ref|XP_006379124.1|  hypothetical protein POPTR_0009s07780g             239   2e-75    
ref|XP_004167935.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    250   3e-75    
ref|XP_004148631.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    250   3e-75    
gb|KGN54392.1|  hypothetical protein Csa_4G312250                       250   7e-75    
ref|XP_004485602.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    248   2e-74    
ref|XP_008464214.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    249   2e-74    
ref|XP_010054593.1|  PREDICTED: pyruvate decarboxylase 1-like           249   3e-74    
gb|AES63495.2|  pyruvate decarboxylase                                  248   3e-74    
ref|XP_004148630.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    246   1e-73    
ref|XP_002514645.1|  pyruvate decarboxylase, putative                   244   2e-73    
ref|XP_008464213.1|  PREDICTED: pyruvate decarboxylase 1-like           246   3e-73    
ref|XP_004148632.1|  PREDICTED: pyruvate decarboxylase isozyme 1-...    245   5e-73    
ref|XP_004486250.1|  PREDICTED: pyruvate decarboxylase isozyme 2-...    244   6e-73    
gb|KGN54391.1|  hypothetical protein Csa_4G312240                       245   1e-72    
gb|KCW76960.1|  hypothetical protein EUGRSUZ_D01319                     239   1e-71    
ref|XP_003593244.1|  Pyruvate decarboxylase isozyme                     240   2e-71    
ref|XP_008775409.1|  PREDICTED: pyruvate decarboxylase 1 isoform X2     239   5e-71    
gb|KCW44313.1|  hypothetical protein EUGRSUZ_L02239                     234   2e-69    
ref|XP_002461271.1|  hypothetical protein SORBIDRAFT_02g043900          233   2e-69    
dbj|BAO02555.1|  predicted pyruvate decarboxylase ortholog              219   8e-69    
ref|XP_008244082.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    220   2e-68    
ref|XP_006488692.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    229   7e-68    
gb|AFJ91675.1|  pyruvate decarboxylase                                  213   1e-66    
ref|XP_001703530.1|  mitochondrial pyruvate dehydrogenase complex...    227   1e-66    
gb|AAM14096.1|  putative pyruvate decarboxylase                         213   2e-66    
ref|XP_010066058.1|  PREDICTED: pyruvate decarboxylase 2                209   4e-65    
gb|KJB36955.1|  hypothetical protein B456_006G184000                    218   2e-63    
dbj|BAD94479.1|  pyruvate decarboxylase                                 205   2e-63    
gb|KJB57437.1|  hypothetical protein B456_009G164100                    212   2e-61    
gb|KJB57436.1|  hypothetical protein B456_009G164100                    212   3e-61    
gb|KDO77806.1|  hypothetical protein CISIN_1g007800mg                   204   2e-58    
ref|XP_011397126.1|  Pyruvate decarboxylase 2                           205   2e-58    
ref|XP_006449473.1|  hypothetical protein CICLE_v10014703mg             204   2e-58    
gb|EYU28061.1|  hypothetical protein MIMGU_mgv11b014990mg               200   1e-57    
ref|XP_007208149.1|  hypothetical protein PRUPE_ppa023325mg             197   4e-56    
gb|EWM28626.1|  pyruvate decarboxylase                                  197   6e-56    
ref|WP_002648470.1|  pyruvate decarboxylase                             198   7e-56    
ref|XP_005854872.1|  pyruvate decarboxylase                             197   2e-55    
ref|WP_028378501.1|  pyruvate decarboxylase                             192   1e-53    
ref|WP_014841393.1|  pyruvate decarboxylase                             192   1e-53    
ref|WP_011213511.1|  pyruvate decarboxylase                             192   1e-53    
ref|WP_027226213.1|  pyruvate decarboxylase                             192   1e-53    
ref|WP_027220769.1|  pyruvate decarboxylase                             192   1e-53    
ref|WP_010946889.1|  pyruvate decarboxylase                             192   2e-53    
ref|WP_020414286.1|  hypothetical protein                               191   2e-53    
ref|WP_027265760.1|  pyruvate decarboxylase                             190   5e-53    
ref|WP_027268181.1|  pyruvate decarboxylase                             190   6e-53    
ref|WP_027224144.1|  pyruvate decarboxylase                             190   6e-53    
ref|WP_011215259.1|  pyruvate decarboxylase                             190   8e-53    
ref|WP_027221397.1|  pyruvate decarboxylase                             190   8e-53    
ref|XP_005847311.1|  hypothetical protein CHLNCDRAFT_52583              184   1e-50    
sp|Q05326.1|PDC2_MAIZE  RecName: Full=Pyruvate decarboxylase 2; S...    172   1e-50    
ref|WP_010654974.1|  pyruvate decarboxylase                             184   1e-50    
gb|EMT18459.1|  Pyruvate decarboxylase isozyme 2                        185   1e-50    
ref|WP_031564015.1|  pyruvate decarboxylase                             183   3e-50    
ref|WP_028382550.1|  pyruvate decarboxylase                             183   3e-50    
ref|WP_019235242.1|  pyruvate decarboxylase                             181   1e-49    
emb|CDH18139.1|  related to pyruvate decarboxylase                      172   2e-49    
ref|XP_005643654.1|  pyruvate decarboxylase                             180   5e-49    
emb|CDF92100.1|  ZYBA0S27-00166g1_1                                     174   7e-47    
gb|KFY67400.1|  hypothetical protein V496_01591                         172   9e-46    
gb|KFZ19401.1|  hypothetical protein V501_00673                         170   1e-45    
gb|KDO66946.1|  hypothetical protein CISIN_1g0386511mg                  163   2e-45    
ref|XP_009159300.1|  pyruvate decarboxylase                             169   4e-45    
ref|XP_002552742.1|  KLTH0D00418p                                       169   4e-45    
ref|WP_012386294.1|  pyruvate decarboxylase                             167   1e-44    
ref|WP_019085054.1|  pyruvate decarboxylase                             166   3e-44    
gb|EPY50138.1|  pyruvate decarboxylase                                  166   3e-44    
ref|WP_010509054.1|  pyruvate decarboxylase                             166   3e-44    
ref|WP_019090978.1|  pyruvate decarboxylase                             166   3e-44    
gb|KIW34410.1|  hypothetical protein PV07_01188                         166   6e-44    
ref|WP_025439431.1|  pyruvate decarboxylase                             165   9e-44    
ref|WP_039736366.1|  pyruvate decarboxylase                             164   2e-43    
ref|WP_010515737.1|  pyruvate decarboxylase                             164   2e-43    
gb|KIZ01863.1|  pyruvate decarboxylase                                  164   2e-43    
ref|WP_006559524.1|  pyruvate decarboxylase                             164   3e-43    
ref|WP_003622049.1|  pyruvate decarboxylase                             164   3e-43    
ref|WP_026398917.1|  pyruvate decarboxylase                             164   3e-43    
ref|WP_007397706.1|  MULTISPECIES: pyruvate decarboxylase               164   4e-43    
ref|WP_029606093.1|  pyruvate decarboxylase                             163   5e-43    
ref|WP_018389274.1|  hypothetical protein                               163   5e-43    
ref|WP_014105323.1|  pyruvate decarboxylase                             163   6e-43    
ref|XP_003682037.1|  hypothetical protein TDEL_0F00150                  162   8e-43    
gb|EPX73372.1|  pyruvate decarboxylase                                  162   9e-43    
ref|XP_003680802.1|  hypothetical protein TDEL_0C07020                  162   1e-42    
ref|WP_025859940.1|  pyruvate decarboxylase                             160   7e-42    
ref|WP_043549626.1|  pyruvate decarboxylase                             160   7e-42    
gb|ADK13058.1|  pyruvate decarboxylase                                  157   4e-41    
dbj|BAF76067.1|  pyruvate decarboxylase                                 157   6e-41    
ref|WP_000122735.1|  MULTISPECIES: pyruvate decarboxylase               157   6e-41    
sp|Q92345.3|PDC2_SCHPO  RecName: Full=Probable pyruvate decarboxy...    157   6e-41    
prf||1811220A  pyruvate decarboxylase                                   157   6e-41 
ref|WP_011241152.1|  pyruvate decarboxylase                             157   6e-41    
ref|WP_015740422.1|  pyruvate decarboxylase                             157   9e-41    
ref|NP_595027.1|  pyruvate decarboxylase (predicted)                    156   1e-40    
pdb|3OE1|A  Chain A, Pyruvate Decarboxylase Variant Glu473asp Fro...    156   2e-40    
gb|AIG13066.1|  pyruvate decarboxylase                                  156   2e-40    
gb|AAA27685.1|  pyruvate decarboxylase (EC 4.1.1.1)                     155   2e-40    
pdb|1ZPD|A  Chain A, Pyruvate Decarboxylase From Zymomonas Mobilis      155   2e-40    
ref|WP_014849477.1|  pyruvate decarboxylase                             155   2e-40    
ref|XP_753176.1|  pyruvate decarboxylase                                155   3e-40    
gb|EFH79954.1|  thiamine pyrophosphate protein TPP binding domain...    155   4e-40    
ref|WP_040448710.1|  pyruvate decarboxylase                             155   4e-40    
ref|WP_026398870.1|  pyruvate decarboxylase                             155   5e-40    
ref|XP_003351329.1|  hypothetical protein SMAC_03633                    154   7e-40    
ref|NP_592796.3|  pyruvate decarboxylase (predicted)                    154   8e-40    
ref|WP_013573096.1|  pyruvate decarboxylase                             154   8e-40    
gb|AAM28635.1|  pyruvate decarboxylase protein                          143   9e-40    
ref|XP_007918504.1|  putative pyruvate decarboxylase protein            154   1e-39    
ref|WP_002764831.1|  pyruvate decarboxylase                             154   1e-39    
ref|XP_009261127.1|  hypothetical protein FPSE_09735                    154   1e-39    
dbj|BAF63473.1|  pyruvate decarboxylase                                 142   3e-39    
gb|KHN33548.1|  Pentatricopeptide repeat-containing protein, mito...    152   3e-39    
gb|EHK26559.1|  hypothetical protein TRIVIDRAFT_52525                   152   5e-39    
ref|WP_002787689.1|  pyruvate decarboxylase                             152   5e-39    
ref|XP_009853563.1|  Pyruvate decarboxylase                             152   5e-39    
ref|WP_013934975.1|  pyruvate decarboxylase                             152   5e-39    
ref|XP_011395109.1|  pyruvate decarboxylase                             152   5e-39    
ref|WP_026707173.1|  pyruvate decarboxylase                             151   7e-39    
ref|XP_002951658.1|  hypothetical protein VOLCADRAFT_105183             151   1e-38    
emb|CDM34749.1|  Probable pyruvate decarboxylase C186.09                150   2e-38    
gb|KEY84000.1|  pyruvate decarboxylase                                  150   3e-38    
gb|EYB31391.1|  hypothetical protein FG05_10446                         149   4e-38    
ref|XP_011319423.1|  pyruvate decarboxylase                             149   5e-38    
ref|XP_001904289.1|  hypothetical protein                               148   1e-37    
ref|XP_008388854.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate dec...    147   1e-37    
gb|EWG48616.1|  pyruvate decarboxylase                                  147   2e-37    
ref|WP_008853550.1|  pyruvate decarboxylase                             147   2e-37    
gb|EXL39445.1|  pyruvate decarboxylase                                  146   5e-37    
gb|ENH64114.1|  Pyruvate decarboxylase                                  146   6e-37    
ref|XP_005847437.1|  hypothetical protein CHLNCDRAFT_35601              146   6e-37    
gb|KEZ43627.1|  hypothetical protein SAPIO_CDS4223                      148   7e-37    
ref|WP_027705353.1|  pyruvate decarboxylase                             145   9e-37    
ref|WP_012222411.1|  pyruvate decarboxylase                             145   9e-37    
gb|AAM49566.1|AF474145_1  pyruvate decarboxylase                        145   1e-36    
gb|EWZ32985.1|  pyruvate decarboxylase                                  145   1e-36    
ref|WP_012554212.1|  pyruvate decarboxylase                             145   1e-36    
gb|KIL90039.1|  hypothetical protein FAVG1_06777                        145   1e-36    
ref|XP_007821434.2|  pyruvate decarboxylase                             145   1e-36    
gb|EXM18877.1|  pyruvate decarboxylase                                  145   2e-36    
gb|KFG87240.1|  pyruvate decarboxylase                                  145   2e-36    
gb|EGU80932.1|  hypothetical protein FOXB_08558                         144   3e-36    
gb|EXK27669.1|  pyruvate decarboxylase                                  144   3e-36    
ref|WP_019088123.1|  pyruvate decarboxylase                             144   3e-36    
ref|WP_035366029.1|  pyruvate decarboxylase                             144   3e-36    
ref|WP_020944449.1|  pyruvate decarboxylase                             144   3e-36    
dbj|GAB31399.1|  pyruvate decarboxylase                                 144   3e-36    
gb|EWY83184.1|  pyruvate decarboxylase                                  144   3e-36    
dbj|GAB28165.1|  pyruvate decarboxylase                                 144   3e-36    
ref|WP_006115789.1|  pyruvate decarboxylase                             144   3e-36    
gb|EMT71688.1|  Pyruvate decarboxylase                                  144   4e-36    
ref|WP_042788399.1|  pyruvate decarboxylase                             143   4e-36    
sp|P51845.1|PDC1_TOBAC  RecName: Full=Pyruvate decarboxylase 1; S...    142   5e-36    
gb|EXM13256.1|  pyruvate decarboxylase                                  143   5e-36    
gb|KFA46881.1|  hypothetical protein S40293_03627                       143   7e-36    
gb|KEY68865.1|  hypothetical protein S7711_03801                        143   7e-36    
gb|KID98030.1|  pyruvate decarboxylase                                  142   8e-36    
gb|KID83275.1|  pyruvate decarboxylase                                  142   9e-36    
ref|WP_014457473.1|  pyruvate decarboxylase                             142   1e-35    
ref|WP_029604671.1|  pyruvate decarboxylase                             142   1e-35    
gb|KFA74022.1|  hypothetical protein S40288_05168                       142   2e-35    
gb|KID78811.1|  pyruvate decarboxylase                                  139   1e-34    
ref|WP_042060334.1|  pyruvate decarboxylase                             138   3e-34    
ref|WP_008852112.1|  pyruvate decarboxylase                             137   6e-34    
pdb|2VBI|A  Chain A, Holostructure Of Pyruvate Decarboxylase From...    137   1e-33    
ref|WP_010505240.1|  pyruvate decarboxylase                             136   2e-33    
gb|AAM21208.1|AF368435_1  pyruvate decarboxylase                        136   2e-33    
dbj|BAF63471.1|  pyruvate decarboxylase                                 129   2e-33    
ref|WP_041111546.1|  pyruvate decarboxylase                             136   2e-33    
gb|AHB37780.1|  pyruvate decarboxylase                                  135   3e-33    
ref|XP_002965355.1|  hypothetical protein SELMODRAFT_406669             136   5e-33    
ref|WP_023941876.1|  pyruvate decarboxylase                             135   6e-33    
ref|WP_011252642.1|  pyruvate decarboxylase                             134   6e-33    
ref|WP_025828656.1|  pyruvate decarboxylase                             134   7e-33    
ref|WP_007283613.1|  pyruvate decarboxylase                             131   7e-32    
ref|WP_015073497.1|  pyruvate decarboxylase                             131   8e-32    
ref|WP_010667855.1|  pyruvate decarboxylase                             131   1e-31    
ref|XP_002977199.1|  hypothetical protein SELMODRAFT_417069             125   4e-31    
dbj|BAA13925.1|  unnamed protein product                                129   6e-31    
ref|XP_002381806.1|  pyruvate decarboxylase, putative                   128   1e-30    
ref|WP_034336516.1|  pyruvate decarboxylase                             127   3e-30    
dbj|BAE63978.1|  unnamed protein product                                127   3e-30    
gb|EIT83109.1|  thiamine pyrophosphate-requiring enzyme                 125   1e-29    
ref|WP_038612918.1|  pyruvate decarboxylase                             125   1e-29    
ref|XP_011395110.1|  pyruvate decarboxylase, variant                    125   2e-29    
gb|EHA27462.1|  pyruvate decarboxylase                                  125   2e-29    
emb|CAK41728.1|  unnamed protein product                                125   2e-29    
ref|WP_000274650.1|  pyruvate decarboxylase                             119   3e-29    
ref|WP_003278263.1|  preprotein translocase subunit Tim44               120   6e-29    
ref|XP_001217746.1|  predicted protein                                  124   7e-29    
ref|WP_040954812.1|  pyruvate decarboxylase                             123   8e-29    
gb|KIP29624.1|  hypothetical protein BG10_5894                          120   9e-29    
ref|XP_001396467.2|  pyruvate decarboxylase                             125   1e-28    



>gb|KJB36954.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
 gb|KJB36956.1| hypothetical protein B456_006G184000 [Gossypium raimondii]
Length=605

 Score =   327 bits (838),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ +I
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTVI  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWTAKVF EEEL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTAKVFCEEELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_009628441.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana tomentosiformis]
Length=603

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STMLRCGQR I
Sbjct  442  QGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVIACIGDGSFQVTAQDISTMLRCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV+ EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVYCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  NGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|KJB36951.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
 gb|KJB36953.1| hypothetical protein B456_006G183900 [Gossypium raimondii]
Length=605

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KVF E+EL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVFCEKELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_006362373.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=603

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STMLRCGQR I
Sbjct  442  QGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVIACIGDGSFQVTAQDISTMLRCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV+ EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVYCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  NGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>ref|XP_007026634.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07136.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   322 bits (825),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEG CWT KVF EEEL+EAIE A
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGNCWTTKVFCEEELIEAIEMA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>sp|P51851.1|PDC2_PEA RecName: Full=Pyruvate decarboxylase 2; Short=PDC, partial [Pisum 
sativum]
 emb|CAA91445.1| pyruvate decarboxylase [Pisum sativum]
Length=405

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  244  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  303

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEELVEAI  A
Sbjct  304  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVFCEEELVEAIAKA  363

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  364  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  405



>gb|KDP22863.1| hypothetical protein JCGZ_00450 [Jatropha curcas]
Length=605

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STMLRCGQR I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDISTMLRCGQRTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTTKVLCEEELIEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG+KKDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGSKKDCLCFIEVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_010033739.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW88158.1| hypothetical protein EUGRSUZ_A00547 [Eucalyptus grandis]
Length=606

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKR+I+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  445  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRIIACIGDGSFQVTAQDVSTMLRCGQNTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEGKCWTAKVFYEEEL++AI+TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAIHNGEGKCWTAKVFYEEELIKAIKTA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>ref|XP_010033533.1| PREDICTED: pyruvate decarboxylase 2 [Eucalyptus grandis]
 gb|KCW88161.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=606

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  445  QGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEGKCWT KVFYEEEL+EAI+TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAIHNGEGKCWTTKVFYEEELIEAIQTA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|KDO56720.1| hypothetical protein CISIN_1g044559mg [Citrus sinensis]
Length=585

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  424  KGCGYEFQMQYGSIGWSVGATLGYAQSVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  483

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEEL+EAIE A
Sbjct  484  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVFCEEELIEAIENA  543

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  544  TGPKKDCLCFIEVLVHKDDTSKELLEWGSRVSAANSRPPNPQ  585



>ref|XP_004246778.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=600

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQ+TAQD+STMLRCGQR I
Sbjct  439  QGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVIACIGDGSFQMTAQDISTMLRCGQRTI  498

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV+ EEELVEAIETA
Sbjct  499  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVYCEEELVEAIETA  558

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLCFIEVIVHK DTSKELLEWGSRVSAANSRPPNPQ
Sbjct  559  NGAKKDCLCFIEVIVHKHDTSKELLEWGSRVSAANSRPPNPQ  600



>gb|KCW88160.1| hypothetical protein EUGRSUZ_A00549 [Eucalyptus grandis]
Length=614

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  445  QGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEGKCWT KVFYEEEL+EAI+TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAIHNGEGKCWTTKVFYEEELIEAIQTA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>ref|XP_003604737.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES86934.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+G CWT KVF EEELVEAIETA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGHCWTTKVFCEEELVEAIETA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  566  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSSANSRPPNPQ  607



>ref|XP_006429440.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
 ref|XP_006481076.1| PREDICTED: pyruvate decarboxylase 1-like [Citrus sinensis]
 gb|ESR42680.1| hypothetical protein CICLE_v10011317mg [Citrus clementina]
Length=606

 Score =   319 bits (818),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  445  KGCGYEFQMQYGSIGWSVGATLGYAQSVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEEL+EAIE A
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVFCEEELIEAIENA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TGPKKDCLCFIEVLVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>ref|NP_001055805.1| Os05g0469800 [Oryza sativa Japonica Group]
 dbj|BAF17719.1| Os05g0469800, partial [Oryza sativa Japonica Group]
Length=196

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  35   EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSI  94

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  95   IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  154

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  155  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  196



>ref|XP_009789106.1| PREDICTED: pyruvate decarboxylase 1 [Nicotiana sylvestris]
Length=625

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STMLRCGQR I
Sbjct  464  QGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVIACIGDGSFQVTAQDISTMLRCGQRTI  523

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEELVEAIETA
Sbjct  524  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGDGKCWTTKVRCEEELVEAIETA  583

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLC IEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  584  NGAKKDCLCLIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  625



>ref|XP_003623318.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79536.1| pyruvate decarboxylase [Medicago truncatula]
Length=605

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEELVEAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTTKVFCEEELVEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_003623316.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES79534.1| pyruvate decarboxylase [Medicago truncatula]
Length=575

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  414  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  473

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEELVEAI TA
Sbjct  474  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTTKVFCEEELVEAIATA  533

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  534  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  575



>ref|XP_010092799.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
 gb|EXB52385.1| Pyruvate decarboxylase isozyme 2 [Morus notabilis]
Length=606

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLR GQR I
Sbjct  445  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRNGQRTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFL+NNGGYTIEVEIHDGPYNVIKNWNYTA +DA HNGEGKCWTAKV YE+EL+EAIETA
Sbjct  505  IFLLNNGGYTIEVEIHDGPYNVIKNWNYTALVDAFHNGEGKCWTAKVQYEDELIEAIETA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TGAKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|AAO72533.1| pyruvate decarboxylase 1 [Lotus corniculatus]
Length=606

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  445  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEGKCWT+KVF EEELVEAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIEAIHNGEGKCWTSKVFCEEELVEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  565  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  606



>ref|XP_003529168.1| PREDICTED: pyruvate decarboxylase 1 [Glycine max]
Length=607

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFL+NNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKVF EEELVEAI TA
Sbjct  506  IFLVNNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTAKVFCEEELVEAIATA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K+D LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TGHKRDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_003552267.1| PREDICTED: pyruvate decarboxylase 2 [Glycine max]
Length=608

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  447  KACGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  506

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKVF EEELVEAI TA
Sbjct  507  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTAKVFCEEELVEAIATA  566

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  567  TGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  608



>ref|XP_011095042.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=605

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGY QA P KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  444  QGCGYEFQMQYGSIGWSVGATLGYGQAVPNKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEG CWT KV  EEEL+EAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGNCWTTKVRCEEELIEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKK+CLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKECLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_002322997.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEF04758.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVIS IGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISFIGDGSFQVTAQDVSTMLRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKVF EE+LVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVFCEEDLVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG+KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGSKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>emb|CDP06456.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQR II
Sbjct  443  GCGYEFQMQYGSIGWSVGATLGYAQAAQQKRVIACIGDGSFQVTAQDVSTMLRCGQRTII  502

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETAT
Sbjct  503  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAT  562

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  563  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|ACI41984.1| putative pyruvate decarboxylase 2 [Diospyros kaki]
Length=482

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STMLRCGQR I
Sbjct  321  KGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMLRCGQRTI  380

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EE+LVEAIETA
Sbjct  381  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVCTEEDLVEAIETA  440

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  441  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  482



>gb|AIE47265.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
             GCGYEFQMQYGSIGWSVGATLGYAQ+ PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  427  MGCGYEFQMQYGSIGWSVGATLGYAQSVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNSI  486

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL+EAIE A
Sbjct  487  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTAKVQCEEELIEAIENA  546

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  547  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  588



>ref|XP_004137700.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN58736.1| hypothetical protein Csa_3G730980 [Cucumis sativus]
Length=605

 Score =   317 bits (811),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDISTMIRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KV  EEELVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVQCEEELVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TDAKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_004156618.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
Length=605

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDISTMIRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KV  EEELVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVQCEEELVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TDAKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_002530500.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF31884.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=607

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL+EAIETA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVQCEEELIEAIETA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T +KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TESKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_004492473.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X2 [Cicer 
arietinum]
Length=603

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  442  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINN GYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI TA
Sbjct  502  IFLINNCGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTTKVMCEEELVEAIATA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TGPKKDCLCFIEVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|AAP96920.1| pyruvate decarboxylase [Dianthus caryophyllus]
Length=605

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMLRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWTAKVF EEELV AI+TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALIDAIHNGEGKCWTAKVFCEEELVNAIKTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K DCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGPKADCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|EYU41928.1| hypothetical protein MIMGU_mgv1a003147mg [Erythranthe guttata]
Length=605

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVT QDVSTMLRCGQ+ I
Sbjct  444  QGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTVQDVSTMLRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINN GYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEG CWT KV  EEEL+EAIETA
Sbjct  504  IFLINNCGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGNCWTTKVRCEEELIEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  564  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  605



>ref|XP_004492472.1| PREDICTED: pyruvate decarboxylase isozyme 2-like isoform X1 [Cicer 
arietinum]
Length=603

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  442  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINN GYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI TA
Sbjct  502  IFLINNCGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGKCWTTKVVCEEELVEAIATA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TGPKKDCLCFIEVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|ABE57121.1| pyruvate decarboxylase [Coix lacryma-jobi]
Length=162

 Score =   301 bits (770),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  1    EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  60

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN +G CWT KV  EE+L EAI TA
Sbjct  61   IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLINAIHNSDGNCWTMKVRTEEQLKEAIATA  120

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  121  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  162



>ref|XP_003614223.1| Pyruvate decarboxylase isozyme [Medicago truncatula]
 gb|AES97181.1| pyruvate decarboxylase [Medicago truncatula]
Length=607

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+G CWT KVF EEELVEAIETA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGHCWTTKVFCEEELVEAIETA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  K+CLCFIEVIVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  566  TGPMKNCLCFIEVIVHKDDTSKELLEWGSRVSSANSRPPNPQ  607



>ref|XP_011046856.1| PREDICTED: pyruvate decarboxylase 2 [Populus euphratica]
Length=605

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVIS IGDGSFQVT QDVSTMLRCGQ+ I
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISFIGDGSFQVTVQDVSTMLRCGQKNI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKVF EE+LVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVFCEEDLVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG+KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGSKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_004506726.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cicer arietinum]
Length=605

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMMRCGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEG CWT KV  EEELVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGNCWTTKVTCEEELVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVI HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  564  TGPKKDCLCFIEVICHKDDTSKELLEWGSRVSSANSRPPNPQ  605



>ref|XP_010033427.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
 gb|KCW88157.1| hypothetical protein EUGRSUZ_A00546 [Eucalyptus grandis]
Length=607

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  446  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHN EGKCWTAKV YEEEL+EAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAIHNSEGKCWTAKVLYEEELMEAIQTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPN  221
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPN
Sbjct  566  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPN  605



>gb|AIE47264.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=588

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  427  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  486

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DA+HNGEG CWTAKV  EEELVEAI+ A
Sbjct  487  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAMHNGEGNCWTAKVHCEEELVEAIDNA  546

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  547  TGPKKDCLCFIEVIVHKDDTSKELLEWGSRVFAANSRPPNPQ  588



>ref|XP_011019081.1| PREDICTED: pyruvate decarboxylase 2-like [Populus euphratica]
Length=605

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRC Q+ I
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCRQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT+ +DAIHNGEGKCWTAKVF EEELVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTSLVDAIHNGEGKCWTAKVFCEEELVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEVIVHKDDTSKELLEWGSRVSAANSR PNPQ
Sbjct  564  TGPEKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRQPNPQ  605



>emb|CAA63404.1| pyruvate decarboxylase [Oryza sativa Japonica Group]
Length=196

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRV+SCIGDGSFQ+TAQ+V TMLRCGQ+ I
Sbjct  35   EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVMSCIGDGSFQMTAQEVYTMLRCGQKSI  94

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  95   IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  154

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  155  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  196



>ref|XP_010253807.1| PREDICTED: pyruvate decarboxylase 2-like [Nelumbo nucifera]
Length=605

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  444  EDCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEG CWT+KV YEEELVEAI+TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNGEGNCWTSKVRYEEELVEAIKTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGDKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_010676788.1| PREDICTED: pyruvate decarboxylase 2 [Beta vulgaris subsp. vulgaris]
Length=607

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTMLRC Q+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMLRCEQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AIHNG+GKCWTAKVF EE+LVEAIETA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIHNGDGKCWTAKVFDEEQLVEAIETA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDC CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TGPKKDCFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>gb|AGO61957.1| pyruvate decarboxylase, partial [Prunus serrulata]
Length=476

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  316  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMIRNGQRTII  375

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL+EAIETAT
Sbjct  376  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELIEAIETAT  435

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  436  GDKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  476



>gb|KFK27091.1| hypothetical protein AALP_AA8G333000 [Arabis alpina]
Length=607

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVISCIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAIPNKRVISCIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  E+ELVEAI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEDELVEAISTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T A+K+ LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNAEKESLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>gb|EMT01304.1| Pyruvate decarboxylase isozyme 2 [Aegilops tauschii]
Length=239

 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRCGQ  II
Sbjct  79   GCGYEFQMQYGSIGWSVGALLGYAQGATDKRVIACIGDGSFQVTAQDVSTMLRCGQNSII  138

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  EEEL  AIETAT
Sbjct  139  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLIDAIHNGEGNCWTAKVTCEEELTAAIETAT  198

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEV+ HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  199  GDKKDCLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ  239



>ref|XP_002308230.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE91753.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=605

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCRQNTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT+ +DAIHNGEGKCWTAKVF E+ELVEAIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTSLVDAIHNGEGKCWTAKVFCEDELVEAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEVIVHKDDTSKELLEWGSRVSAANSR PNPQ
Sbjct  564  TGPEKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRQPNPQ  605



>ref|XP_009769363.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana sylvestris]
Length=603

 Score =   311 bits (798),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVTAQD+STMLRCGQR I
Sbjct  442  EGCGYEFQMQYGSIGWSVGATLGYAQAAREKRVIAFIGDGSFQVTAQDISTMLRCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVHCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TEAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|ACI41985.1| putative pyruvate decarboxylase 3 [Diospyros kaki]
Length=384

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQD+STMLRCGQ  I
Sbjct  223  EGCGYEFQMQYGSIGWSVGATLGYAQAGKNKRVIACIGDGSFQVTAQDISTMLRCGQNTI  282

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EE+L+EAI+TA
Sbjct  283  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTIKVHCEEDLIEAIDTA  342

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLCFIEVIVHKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  343  IGAKKDCLCFIEVIVHKDDTSKELLEWGSRVFAANSRPPNPQ  384



>gb|AAG22488.1|AF195868_1 pyruvate decarboxylase 1 [Vitis vinifera]
Length=575

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVISCIGDGSFQVTAQDVSTM+RC QR I
Sbjct  414  KGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVISCIGDGSFQVTAQDVSTMIRCEQRTI  473

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EE+L+ AIETA
Sbjct  474  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVVCEEDLINAIETA  533

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG+KKDC CFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  534  TGSKKDCFCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  575



>gb|ACL54119.1| unknown [Zea mays]
Length=381

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  220  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  279

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN EG CWT KV  EE+L EAI TA
Sbjct  280  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSEGNCWTMKVRTEEQLKEAIATA  339

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  381



>ref|XP_008775408.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Phoenix dactylifera]
Length=605

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAARGKRVIACIGDGSFQVTAQDVSTMLRCGQNSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFL+NNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWT+KV  EEEL EAI+TA
Sbjct  504  IFLVNNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTSKVRCEEELKEAIDTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDC CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  MGPKKDCFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|AIL23783.1| pyruvate decarboxylase [Prunus serrulata]
Length=605

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GDKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|ABZ79223.1| pyruvate decarboxylase [Prunus armeniaca]
Length=605

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GDKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_009622836.1| PREDICTED: pyruvate decarboxylase 1-like [Nicotiana tomentosiformis]
Length=603

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ   EKRVI+ IGDGSFQVTAQD+STMLRCGQR I
Sbjct  442  EGCGYEFQMQYGSIGWSVGATLGYAQTAREKRVIAFIGDGSFQVTAQDISTMLRCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVHCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TEAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>ref|XP_002272615.1| PREDICTED: pyruvate decarboxylase 2 [Vitis vinifera]
 emb|CBI18254.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVISCIGDGSFQVTAQDVSTM+RC QR I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVISCIGDGSFQVTAQDVSTMIRCEQRTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EE+L+ AIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVVCEEDLINAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG+KKDC CFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGSKKDCFCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|AGA15797.1| pyruvate decarboxylase 2 [Diospyros kaki]
Length=607

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQD+STMLRCGQ  I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAGKNKRVIACIGDGSFQVTAQDISTMLRCGQNTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EE+L+EAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVHCEEDLIEAIDTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_007208309.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
 gb|AEA06512.1| pyruvate decarboxylase [Prunus dulcis x Prunus persica]
 gb|AEA06513.1| pyruvate decarboxylase [Prunus cerasifera]
 gb|EMJ09508.1| hypothetical protein PRUPE_ppa003086mg [Prunus persica]
Length=605

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GDKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|AAY86034.1| pyruvate decarboxylase, partial [Citrus sinensis]
Length=199

 Score =   296 bits (758),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STM+RCGQR I
Sbjct  38   ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSI  97

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL EA++TA
Sbjct  98   IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTA  157

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  158  TGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  199



>emb|CAB61763.1| pyruvate decarboxylase [Saccharum officinarum]
Length=212

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ    KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  51   EGCGYEFQMQYGSIGWSVGALLGYAQGANNKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  110

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL  AIETA
Sbjct  111  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTAAIETA  170

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  171  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  212



>ref|XP_003522062.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Glycine max]
Length=583

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLR  Q+ I
Sbjct  422  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRNEQKSI  481

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI+TA
Sbjct  482  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELVEAIQTA  541

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AAN RPPNPQ
Sbjct  542  TGVKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANGRPPNPQ  583



>ref|XP_011071825.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=605

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RCGQR I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCGQRTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV+ EEEL+ AIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVYCEEELIAAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K+DCLCFIE+IVHKDDTS+ELLEWGSRV +ANSRPPNPQ
Sbjct  564  TGEKQDCLCFIELIVHKDDTSRELLEWGSRVCSANSRPPNPQ  605



>gb|ABJ99596.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTM+R GQ PII
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMIRFGQNPII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYTAF++A+HNGEGKCWTAKVF EE+L EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEALHNGEGKCWTAKVFCEEDLKEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KK CLCFIEVI HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  565  GPKKGCLCFIEVIAHKDDTSKELLEWGSRVAAANSRPPNPQ  605



>ref|XP_003520410.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=603

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLR  Q+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRNEQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELVEAIQTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AAN RPPNPQ
Sbjct  562  TGVKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANGRPPNPQ  603



>ref|XP_009399900.1| PREDICTED: pyruvate decarboxylase 2 [Musa acuminata subsp. malaccensis]
Length=607

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQNTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  EEEL EAIE A
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVTCEEELKEAIEAA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             GAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  MGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_007016910.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY34529.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=605

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQD+STMLRC Q+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVIACIGDGSFQVTAQDISTMLRCEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  EEEL+EAIE A
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVHCEEELIEAIEKA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TDEKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|KJB57435.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=384

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  223  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  282

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  E+EL++AI  A
Sbjct  283  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRTEDELIDAIAAA  342

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEV  HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  343  TGEKKDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ  384



>ref|XP_008243339.1| PREDICTED: pyruvate decarboxylase 2 [Prunus mume]
Length=605

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PE+RV++ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEQRVLAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL+EAIETAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELIEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GDKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_002866069.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42328.1| pyruvate decarboxylase-2 [Arabidopsis lyrata subsp. lyrata]
Length=607

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P +RVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNRRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVKAINTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +KD  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKDSFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_010920798.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=605

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAARGKRVIACIGDGSFQVTAQDVSTMLRCGQNSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA M+AIHNGEGKCWTAKV  EEEL EAI+TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALMEAIHNGEGKCWTAKVHCEEELQEAIDTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDC CFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  MGTKKDCFCFIEVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|NP_001284421.1| pyruvate decarboxylase 1 [Cucumis melo]
 gb|AIC36754.1| pyruvate/alpha-keto acid decarboxylase [Cucumis melo]
Length=606

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  445  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDISTMIRCGQKTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KV  EEELVEAIETA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVRCEEELVEAIETA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TEAKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|KHN22554.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=603

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLR  Q+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRNEQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELVEAIQTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AAN RPPNPQ
Sbjct  562  TGVKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANGRPPNPQ  603



>ref|XP_010443084.1| PREDICTED: pyruvate decarboxylase 2-like [Camelina sativa]
Length=607

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELV+AI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVKAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>gb|AAA68290.1| pyruvate decarboxylase 1 [Oryza sativa Indica Group]
 gb|AAC49442.1| pyruvate decarboxylase [Oryza sativa Indica Group]
Length=602

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  441  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSI  500

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  501  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  560

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  561  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  602



>ref|XP_010529008.1| PREDICTED: pyruvate decarboxylase 2 [Tarenaya hassleriana]
Length=608

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 1/163 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEF+MQYGSIGWSVGATLGYAQA PEKRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFEMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMIRCGQKSI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEEL+EAI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVKCEEELIEAINTA  565

Query  340  TG-AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T   KK+ LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TSEEKKESLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  608



>sp|A2Y5L9.1|PDC1_ORYSI RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Indica Group]
 gb|EAY98379.1| hypothetical protein OsI_20290 [Oryza sativa Indica Group]
Length=605

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>dbj|BAC20138.1| pyruvate decarboxylase [Oryza sativa]
 gb|AAT93946.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 gb|EEE64046.1| hypothetical protein OsJ_18875 [Oryza sativa Japonica Group]
Length=605

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|NP_001055803.1| Os05g0469600 [Oryza sativa Japonica Group]
 sp|Q0DHF6.1|PDC1_ORYSJ RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Oryza sativa 
Japonica Group]
 gb|AAT93945.1| putative pyruvate decarboxylase [Oryza sativa Japonica Group]
 dbj|BAF17717.1| Os05g0469600 [Oryza sativa Japonica Group]
 dbj|BAG94713.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94986.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64045.1| hypothetical protein OsJ_18874 [Oryza sativa Japonica Group]
Length=605

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCGQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|KHN18047.1| Pyruvate decarboxylase isozyme 2 [Glycine soja]
Length=607

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLR  Q+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRNEQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELVEAIQTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AAN RPPNPQ
Sbjct  566  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANGRPPNPQ  607



>ref|XP_003516954.1| PREDICTED: pyruvate decarboxylase 4 [Glycine max]
Length=607

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLR  Q+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRNEQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELVEAIQTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AAN RPPNPQ
Sbjct  566  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANGRPPNPQ  607



>ref|XP_004294304.1| PREDICTED: pyruvate decarboxylase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=604

 Score =   307 bits (787),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVG TLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  443  EGCGYEFQMQYGSIGWSVGGTLGYAQAVPNKRVIACIGDGSFQVTAQDVSTMIRCNQKSI  502

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EE+L+EAIETA
Sbjct  503  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEDLIEAIETA  562

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIE+IVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  563  TGEKKDCLCFIEIIVHKDDTSKELLEWGSRVSSANSRPPNPQ  604



>gb|EPS58298.1| pyruvate decarboxylase, partial [Genlisea aurea]
Length=589

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVISCIGDGSFQVTAQDVSTMLRC Q  II
Sbjct  429  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISCIGDGSFQVTAQDVSTMLRCNQNTII  488

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  EEEL EAI TAT
Sbjct  489  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRTEEELAEAIATAT  548

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
              KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  549  DEKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>gb|AGA15796.1| pyruvate decarboxylase 1, partial [Diospyros kaki]
Length=409

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  248  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  307

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEGKCWTAKV  EE+LVEAI TA
Sbjct  308  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTAKVCTEEQLVEAIATA  367

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGA KD LCFIEV+VHKDDTSKELLEWGSRV++ANSRPPNPQ
Sbjct  368  TGAHKDSLCFIEVLVHKDDTSKELLEWGSRVASANSRPPNPQ  409



>ref|NP_195752.1| pyruvate decarboxylase 4 [Arabidopsis thaliana]
 sp|Q9M040.1|PDC4_ARATH RecName: Full=Pyruvate decarboxylase 4; Short=AtPDC4 [Arabidopsis 
thaliana]
 emb|CAB81915.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90327.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=603

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQATPEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVLSFIGDGSFQVTAQDISTMIRNGQKAI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  562  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  603



>ref|XP_010447294.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=605

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVT QD+STMLR GQ+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTVQDISTMLRNGQKTI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV YEEELVEAI+TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRYEEELVEAIKTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TTEKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_010052217.1| PREDICTED: pyruvate decarboxylase 1 [Eucalyptus grandis]
 gb|KCW76156.1| hypothetical protein EUGRSUZ_D00535 [Eucalyptus grandis]
Length=582

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  421  ENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  480

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL +AI TA
Sbjct  481  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRTEEELKDAIATA  540

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  541  TGPHKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  582



>ref|XP_010482907.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Camelina sativa]
 ref|XP_010482908.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Camelina sativa]
Length=607

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P +RVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNRRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELV+AI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVKAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_010448857.1| PREDICTED: pyruvate decarboxylase 2-like, partial [Camelina sativa]
Length=644

 Score =   308 bits (788),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  483  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  542

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELV+AI+TA
Sbjct  543  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVKAIKTA  602

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  603  TTEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  644



>ref|XP_010257091.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=580

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  419  EGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVIACIGDGSFQMTAQDVSTMLRCGQKSI  478

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IF+INNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEG CWT+KV YEEELVEAI+TA
Sbjct  479  IFVINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNGEGNCWTSKVRYEEELVEAIKTA  538

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV++AN R PNPQ
Sbjct  539  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVASANGRHPNPQ  580



>gb|ABR17980.1| unknown [Picea sitchensis]
Length=409

 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+CIGDGSFQVT QDVSTM+R GQ  I
Sbjct  248  EKCGYEFQMQYGSIGWSVGATLGYAQAVPDKRVIACIGDGSFQVTVQDVSTMIRNGQNTI  307

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DA+HNGEGKCWT KV  EEE+VEAI+T+
Sbjct  308  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDALHNGEGKCWTVKVKTEEEVVEAIKTS  367

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  368  LGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  409



>gb|ABJ99597.1| pyruvate decarboxylase [Lycoris aurea]
Length=605

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTM+R GQ PII
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMIRFGQNPII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            F INNGGYTIEVEIHDGPYNVIKNWNYTAF++A+HNGEGKCWTAKVF EE+L EAIETAT
Sbjct  505  FPINNGGYTIEVEIHDGPYNVIKNWNYTAFVEALHNGEGKCWTAKVFCEEDLKEAIETAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KK CLCFIEVI HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  565  GPKKGCLCFIEVIAHKDDTSKELLEWGSRVAAANSRPPNPQ  605



>gb|ACN40470.1| unknown [Picea sitchensis]
Length=409

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+CIGDGSFQVT QDVSTM+R GQ  I
Sbjct  248  EKCGYEFQMQYGSIGWSVGATLGYAQAAPDKRVIACIGDGSFQVTVQDVSTMIRNGQNTI  307

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DA+HNGEGKCWT KV  EEE+VEAI+T+
Sbjct  308  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDALHNGEGKCWTVKVKTEEEVVEAIKTS  367

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  368  LGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  409



>ref|NP_195033.1| pyruvate decarboxylase 1 [Arabidopsis thaliana]
 sp|O82647.1|PDC1_ARATH RecName: Full=Pyruvate decarboxylase 1; Short=AtPDC1 [Arabidopsis 
thaliana]
 emb|CAA21216.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 emb|CAB80024.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana]
 gb|AAL49793.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AAM67459.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana]
 gb|AEE86169.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV++ IGDGSFQVT QD+STMLR GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLAFIGDGSFQVTVQDISTMLRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV YEEELVEAI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRYEEELVEAITTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TTEKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|NP_195753.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
 sp|Q9M039.1|PDC3_ARATH RecName: Full=Pyruvate decarboxylase 3; Short=AtPDC3 [Arabidopsis 
thaliana]
 emb|CAB81916.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AAP21263.1| At5g01330 [Arabidopsis thaliana]
 dbj|BAE99688.1| pyruvate decarboxylase-like protein [Arabidopsis thaliana]
 gb|AED90328.1| pyruvate decarboxylase-3 [Arabidopsis thaliana]
Length=592

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQATPEKRV+S IGDGSFQVTAQDVSTM+R GQ+ I
Sbjct  431  KGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVLSFIGDGSFQVTAQDVSTMIRNGQKTI  490

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI TA
Sbjct  491  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAINTA  550

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  551  TLEKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  592



>ref|XP_009125425.1| PREDICTED: pyruvate decarboxylase 4 [Brassica rapa]
 emb|CDY55899.1| BnaAnng13920D [Brassica napus]
Length=607

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTMLR GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMLRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV YEEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRYEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  566  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVAAANGRPPNPQ  607



>ref|XP_004961783.1| PREDICTED: pyruvate decarboxylase 1-like [Setaria italica]
Length=610

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQR +
Sbjct  449  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQRSV  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL EAI TA
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNSDGNCWTKKVRTEEELKEAIATA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>ref|XP_007140235.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
 gb|ESW12229.1| hypothetical protein PHAVU_008G095400g [Phaseolus vulgaris]
Length=606

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQ+TAQDVSTMLRCGQ+ I
Sbjct  445  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQMTAQDVSTMLRCGQKTI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KVF EEELVEAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVFCEEELVEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD  CFIEVI HKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  565  TGPKKDSFCFIEVIAHKDDTSKELLEWGSRVCAANSRPPNPQ  606



>ref|XP_006401505.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
 gb|ESQ42958.1| hypothetical protein EUTSA_v10013010mg [Eutrema salsugineum]
Length=607

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELVEAI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVEAIHTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEV+VHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  566  TNEEKESFCFIEVVVHKDDTSKELLEWGSRVAAANGRPPNPQ  607



>ref|XP_006649916.1| PREDICTED: pyruvate decarboxylase 2-like [Oryza brachyantha]
Length=371

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  210  EGCGYEFQMQYGSIGWSVGALLGYAQGAQDKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  269

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL EAI TA
Sbjct  270  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGTA  329

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  330  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  371



>ref|XP_006283364.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
 gb|EOA16262.1| hypothetical protein CARUB_v10004406mg [Capsella rubella]
Length=607

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQD+STMLR GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDISTMLRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT+KV +EEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTSKVRHEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TTEKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_010432620.1| PREDICTED: pyruvate decarboxylase 1-like [Camelina sativa]
Length=609

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVT QD+STMLR GQ+ I
Sbjct  448  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTVQDISTMLRNGQKTI  507

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT+KV YEEELVEAI+TA
Sbjct  508  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTSKVRYEEELVEAIKTA  567

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  568  TTEKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  609



>gb|AAO42252.1| putative pyruvate decarboxylase [Arabidopsis thaliana]
Length=564

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQATPEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  403  KGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVLSFIGDGSFQVTAQDISTMIRNGQKAI  462

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYT EVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI+TA
Sbjct  463  IFLINNGGYTTEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTA  522

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  523  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  564



>ref|XP_006281555.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
 gb|EOA14453.1| hypothetical protein CARUB_v10027657mg [Capsella rubella]
Length=607

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  EEELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRCEEELVKAINTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
               +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  MNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_006363624.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVTAQD+STMLRCGQR I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAAKEKRVIAFIGDGSFQVTAQDISTMLRCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVRCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TEAKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|EMT10365.1| Pyruvate decarboxylase isozyme 2 [Aegilops tauschii]
Length=424

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRCGQ  II
Sbjct  264  GCGYEFQMQYGSIGWSVGALLGYAQGATDKRVIACIGDGSFQVTAQDVSTMLRCGQNSII  323

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL  AIETAT
Sbjct  324  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVTCEEELTAAIETAT  383

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEV+ HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  384  GDKKDCLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ  424



>gb|AEF33613.1| pyruvate decarboxylase [Salvia miltiorrhiza f. alba]
Length=605

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+CIGDGSFQVTAQDVSTMLRCGQ  II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPDKRVIACIGDGSFQVTAQDVSTMLRCGQNSII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAI NGEG CWT KV  EEEL+EAI+TAT
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAICNGEGNCWTTKVRCEEELLEAIDTAT  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G K DCLCFIEVIVHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  565  GVKNDCLCFIEVIVHKDDTSKELLEWGSRVSAANGRPPNPQ  605



>gb|ACI41983.1| putative pyruvate decarboxylase 1 [Diospyros kaki]
Length=482

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  321  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  380

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEGKCWTAKV  EE+LVEAI TA
Sbjct  381  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTAKVCTEEQLVEAIATA  440

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGA KD LCFIEV+VHKDDTSKELLEWGSRV++ANSRPPNPQ
Sbjct  441  TGAHKDSLCFIEVLVHKDDTSKELLEWGSRVASANSRPPNPQ  482



>ref|XP_010922580.1| PREDICTED: pyruvate decarboxylase 2-like [Elaeis guineensis]
Length=604

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
             CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ  II
Sbjct  444  ACGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMMRCGQNTII  503

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KV  EEEL EAI+TA 
Sbjct  504  FLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTMKVQCEEELKEAIQTAL  563

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  GPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  604



>gb|AAG13131.1|AF193791_1 pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVIS IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETA 
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAN  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GPKKDSFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>emb|CDY19880.1| BnaC09g31460D [Brassica napus]
Length=607

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAIPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF++AIHNGEGKCWTAKV  E+ELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEAIHNGEGKCWTAKVRCEDELVKAISTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_009120024.1| PREDICTED: pyruvate decarboxylase 2 [Brassica rapa]
Length=607

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAIPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF++AIHNGEGKCWTAKV  E+ELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEAIHNGEGKCWTAKVRCEDELVKAISTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>emb|CDY17293.1| BnaA10g09270D [Brassica napus]
Length=607

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAIPNKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF++AIHNGEGKCWTAKV  E+ELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEAIHNGEGKCWTAKVRCEDELVKAISTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|NP_200307.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
 sp|Q9FFT4.1|PDC2_ARATH RecName: Full=Pyruvate decarboxylase 2; Short=AtPDC2 [Arabidopsis 
thaliana]
 dbj|BAB08775.1| pyruvate decarboxylase [Arabidopsis thaliana]
 gb|AED96563.1| pyruvate decarboxylase-2 [Arabidopsis thaliana]
Length=607

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P +RVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNRRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF++AIHNGEGKCWTAKV  EEELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEAIHNGEGKCWTAKVRCEEELVKAINTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_010437810.1| PREDICTED: pyruvate decarboxylase 1 [Camelina sativa]
Length=608

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVT QD+STMLR GQ+ I
Sbjct  447  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTVQDISTMLRNGQKTI  506

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV YEEELVEAI+TA
Sbjct  507  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRYEEELVEAIKTA  566

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  K DCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  567  TTEKTDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  608



>emb|CDY66930.1| BnaCnng52860D [Brassica napus]
Length=607

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTMLR GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMLRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  566  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVAAANGRPPNPQ  607



>gb|EAY98380.1| hypothetical protein OsI_20291 [Oryza sativa Indica Group]
Length=605

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVISCIGDGSFQ+TAQDVSTMLRC Q+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTMLRCEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHN +G CWT KV  EEEL+EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHNSDGNCWTKKVRTEEELIEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIE+IVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_010451999.1| PREDICTED: pyruvate decarboxylase 4-like [Camelina sativa]
Length=603

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLSFIGDGSFQVTAQDISTMIRNGQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL EAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTKKVRYEEELEEAIKTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVIVHKDDTS+ELLEWGSRVSAAN RPPNPQ
Sbjct  562  TTEKKDCLCFIEVIVHKDDTSRELLEWGSRVSAANGRPPNPQ  603



>ref|XP_010558370.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
 ref|XP_010558371.1| PREDICTED: pyruvate decarboxylase 1-like [Tarenaya hassleriana]
Length=603

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV++ IGDGSFQVTAQD+STMLR GQ+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLAFIGDGSFQVTAQDISTMLRNGQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELL+WGSRVSAANSRPPNPQ
Sbjct  562  TCQKKDSLCFIEVIVHKDDTSKELLQWGSRVSAANSRPPNPQ  603



>ref|XP_002867205.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43464.1| hypothetical protein ARALYDRAFT_491381 [Arabidopsis lyrata subsp. 
lyrata]
Length=607

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV++ IGDGSFQVTAQD+STMLR  Q+ I
Sbjct  446  RGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLAFIGDGSFQVTAQDISTMLRNRQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV YEEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRYEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TMEKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_002439941.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
 gb|EES18371.1| hypothetical protein SORBIDRAFT_09g023060 [Sorghum bicolor]
Length=609

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  448  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  507

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNG+G CWT KV  E EL EAI TA
Sbjct  508  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLINAIHNGDGNCWTMKVRTEAELKEAIATA  567

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  568  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  609



>ref|XP_009773011.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana sylvestris]
Length=588

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  427  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKSI  486

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  487  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATA  546

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  547  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  588



>ref|XP_010423945.1| PREDICTED: pyruvate decarboxylase 4 [Camelina sativa]
Length=603

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVLSFIGDGSFQVTAQDISTMIRNGQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL EAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTKKVRYEEELEEAIKTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVIVHKDDTS+ELLEWGSRVSAAN RPPNPQ
Sbjct  562  TTEKKDCLCFIEVIVHKDDTSRELLEWGSRVSAANGRPPNPQ  603



>ref|XP_009376417.1| PREDICTED: pyruvate decarboxylase 2 [Pyrus x bretschneideri]
Length=610

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+ IGDGSFQVT QDVSTM+R GQ+ II
Sbjct  450  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIAFIGDGSFQVTVQDVSTMIRNGQKNII  509

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETAT
Sbjct  510  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAT  569

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  570  GAKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>gb|EYU42548.1| hypothetical protein MIMGU_mgv1a003111mg [Erythranthe guttata]
Length=607

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  446  QGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVIACIGDGSFQVTAQDVSTMIRCGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAI NGEG CWT+KV+ EEEL+ AIETA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGVVDAICNGEGNCWTSKVYCEEELIAAIETA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            +G KKD LCFIEVIVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  566  SGEKKDSLCFIEVIVHKDDTSKELLEWGSRVSSANSRPPNPQ  607



>ref|XP_008384777.1| PREDICTED: pyruvate decarboxylase 1-like isoform X2 [Malus domestica]
Length=606

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  445  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCNQKSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  TEEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>ref|XP_002870930.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47189.1| pyruvate decarboxylase-3 [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+P KRV+S IGDGSFQVTAQDVSTM+R GQ+ I
Sbjct  431  KGCGYEFQMQYGSIGWSVGATLGYAQASPNKRVLSFIGDGSFQVTAQDVSTMIRNGQKTI  490

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI TA
Sbjct  491  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAINTA  550

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSR+SAAN RPPNPQ
Sbjct  551  TSEKKDSLCFIEVIVHKDDTSKELLEWGSRISAANGRPPNPQ  592



>gb|ACR35995.1| unknown [Zea mays]
 gb|AFW82288.1| hypothetical protein ZEAMMB73_515806 [Zea mays]
Length=609

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  448  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  507

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN EG CWT KV  EE+L EAI TA
Sbjct  508  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSEGNCWTMKVRTEEQLKEAIATA  567

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  568  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  609



>ref|XP_009385546.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STMLRC Q+ I
Sbjct  442  QGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMLRCEQKSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +D+IHNGEGKCWT KV  EEEL +AIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDSIHNGEGKCWTTKVQREEELKKAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  K DCLCFI+V+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TNEKSDCLCFIDVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|AAL37492.1| pyruvate decarboxylase [Fragaria x ananassa]
Length=605

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETA 
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAN  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GPKKDRLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_002870931.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47190.1| hypothetical protein ARALYDRAFT_486945 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLSFIGDGSFQVTAQDISTMIRNGQKTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEELVEAI+TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  562  TLEKKDSLCFIEVIVHKDDTSKELLEWGSRVAAANGRPPNPQ  603



>gb|EMT10366.1| Pyruvate decarboxylase isozyme 2 [Aegilops tauschii]
Length=406

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
             GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  245  DGCGYEFQMQYGSIGWSVGALLGYAQGATDKRVIACIGDGSFQVTAQDVSTMLRCGQNSI  304

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFL NNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  EEEL  AIETA
Sbjct  305  IFLSNNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVTCEEELTAAIETA  364

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+ HKDDTSKELLEWGSRVS ANSRPPNPQ
Sbjct  365  TGDKKDCLCFIEVVAHKDDTSKELLEWGSRVSTANSRPPNPQ  406



>ref|XP_009358206.1| PREDICTED: pyruvate decarboxylase 1-like [Pyrus x bretschneideri]
Length=582

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYA++ P+KR+I+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  421  EGCGYEFQMQYGSIGWSVGATLGYAESVPKKRIIACIGDGSFQVTAQDVSTMIRCNQKSI  480

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL EAI TA
Sbjct  481  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRTEEELTEAIATA  540

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCF+EVIVHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  541  TGEKKDCLCFVEVIVHKDDTSKELLEWGSRVSSANSRLPNPQ  582



>ref|XP_009594221.1| PREDICTED: pyruvate decarboxylase 2 isoform X2 [Nicotiana tomentosiformis]
Length=588

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  427  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKNI  486

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  487  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATA  546

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  547  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  588



>ref|XP_006286440.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
 gb|EOA19338.1| hypothetical protein CARUB_v10003893mg [Capsella rubella]
Length=604

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV+S IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  443  KGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLSFIGDGSFQVTAQDISTMIRNGQKTI  502

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV YEEEL EAI+TA
Sbjct  503  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVKYEEELEEAIKTA  562

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVIVH+DDTS+ELLEWGSRV+AAN RPPNPQ
Sbjct  563  TSEKKDCLCFIEVIVHRDDTSRELLEWGSRVAAANGRPPNPQ  604



>ref|XP_004302532.1| PREDICTED: pyruvate decarboxylase 2 [Fragaria vesca subsp. vesca]
Length=605

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+ IGDGSFQVTAQDVSTM+R GQR II
Sbjct  445  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIAFIGDGSFQVTAQDVSTMIRNGQRTII  504

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETA 
Sbjct  505  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAN  564

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  GPKKDSFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_008350688.1| PREDICTED: pyruvate decarboxylase 2 [Malus domestica]
Length=490

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+  GDGSFQVTAQDVSTM+R GQ+ IIF
Sbjct  331  CGYEFQMQYGSIGWSVGATLGYAQAVPQKRVIAFXGDGSFQVTAQDVSTMIRNGQKTIIF  390

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LI NGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETATG
Sbjct  391  LIXNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETATG  450

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            AKKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  451  AKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  490



>ref|XP_009369597.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  445  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCNQKSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  565  TEEKKDCLCFIEVIAHKDDTSKELLEWGSRVSSANSRPPNPQ  606



>ref|XP_009338952.1| PREDICTED: pyruvate decarboxylase 2-like [Pyrus x bretschneideri]
Length=606

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  445  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCNQKSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDCLCFIEVI HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  565  TEEKKDCLCFIEVIAHKDDTSKELLEWGSRVSSANSRPPNPQ  606



>gb|KFK24633.1| hypothetical protein AALP_AA8G005000 [Arabis alpina]
Length=607

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDISTMIRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV YEEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRYEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  566  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVAAANGRPPNPQ  607



>ref|XP_007134808.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
 gb|ESW06802.1| hypothetical protein PHAVU_010G078000g [Phaseolus vulgaris]
Length=605

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P+KRVISCIGDGSFQVT QD+STM+R  Q+ I
Sbjct  444  KGCGYEFQMQYGSIGWSVGATLGYAQAVPQKRVISCIGDGSFQVTVQDISTMIRNEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAI+ A
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVTCEEELIEAIQIA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  564  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANSRPPNPQ  605



>ref|XP_010253808.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=647

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQ+TAQDVSTMLRCGQR I
Sbjct  486  QGCGYEFQMQYGSIGWSVGATLGYAQAAPNKRVIACIGDGSFQMTAQDVSTMLRCGQRSI  545

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWN T  M+AI NG+GKCWT KV  EEELVEAI+ A
Sbjct  546  IFLINNGGYTIEVEIHDGPYNVIKNWNCTGLMNAICNGDGKCWTTKVRCEEELVEAIKLA  605

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVI+HKDDTSKELL+WGSRVSAANSRPPNPQ
Sbjct  606  TGDKKDCLCFIEVILHKDDTSKELLQWGSRVSAANSRPPNPQ  647



>sp|P28516.1|PDC1_MAIZE RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Zea mays]
 emb|CAA42120.1| pyruvate decarboxylase [Zea mays]
Length=610

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  449  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN EG CWT KV  EE+L EAI T 
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSEGNCWTMKVRTEEQLKEAIATV  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>gb|KJB57434.1| hypothetical protein B456_009G164100 [Gossypium raimondii]
Length=589

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEGKCWTAKV  E+EL++AI  A
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGKCWTAKVRTEDELIDAIAAA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKD LCFIEV  HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  548  TGEKKDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ  589



>gb|ACF87987.1| unknown [Zea mays]
Length=371

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ    KRVI+ IGDGSFQVTAQDVSTMLRC Q  I
Sbjct  210  EGCGYEFQMQYGSIGWSVGALLGYAQGANHKRVIAFIGDGSFQVTAQDVSTMLRCEQNSI  269

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNG GKCWT+KV  EEEL  AIETA
Sbjct  270  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGLGKCWTSKVKSEEELTAAIETA  329

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  330  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  371



>ref|XP_006398630.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
 gb|ESQ40083.1| hypothetical protein EUTSA_v10013008mg [Eutrema salsugineum]
Length=607

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQD+STMLR GQ+ I
Sbjct  446  KGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDISTMLRNGQKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV +EEELVEAI+TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRHEEELVEAIKTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRV+AAN RPPNPQ
Sbjct  566  TTEKKDSLCFIEVIVHKDDTSKELLEWGSRVAAANGRPPNPQ  607



>ref|XP_007207128.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
 gb|EMJ08327.1| hypothetical protein PRUPE_ppa003096mg [Prunus persica]
Length=605

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDVSTMIRCEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  564  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVSSANSRLPNPQ  605



>ref|XP_009391704.1| PREDICTED: pyruvate decarboxylase 1 [Musa acuminata subsp. malaccensis]
Length=606

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLR GQ  II
Sbjct  446  GCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRSGQNSII  505

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNGEG CWT KV  EEEL EAIE   
Sbjct  506  FLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGEGNCWTTKVTCEEELKEAIEKVM  565

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  GPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|KJB21559.1| hypothetical protein B456_004G001200 [Gossypium raimondii]
Length=605

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTMLRC Q+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVISCIGDGSFQVTAQDVSTMLRCEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEG CWT KV  E EL+EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVEAIHNGEGNCWTKKVRNEGELIEAIGTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  564  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANSRPPNPQ  605



>ref|XP_008221277.1| PREDICTED: pyruvate decarboxylase 1-like [Prunus mume]
Length=605

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  444  EGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDVSTMIRCEQKSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  564  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVSSANSRLPNPQ  605



>ref|XP_004485877.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cicer arietinum]
Length=584

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  423  ENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  482

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F++AIHNGEGKCWTAKV  EEEL+EAI TA
Sbjct  483  IFLINNGGYTIEVEIHDGPYNVIKNWDYTRFVNAIHNGEGKCWTAKVRTEEELIEAIATA  542

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            +GA+KD LCFIEV  HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  543  SGAEKDSLCFIEVFAHKDDTSKELLEWGSRVAAANSRPPNPQ  584



>ref|XP_007025437.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
 gb|EOY28059.1| Pyruvate decarboxylase-2 isoform 1 [Theobroma cacao]
Length=589

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNY+  +DAIHNG+GKCWTAKV  EEEL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYSGLVDAIHNGDGKCWTAKVRTEEELKEAISTA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAK+D LCFIEV  HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  548  TGAKRDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ  589



>ref|XP_007025438.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
 gb|EOY28060.1| Pyruvate decarboxylase-2 isoform 2 [Theobroma cacao]
Length=590

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  429  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  488

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNY+  +DAIHNG+GKCWTAKV  EEEL EAI TA
Sbjct  489  IFLINNGGYTIEVEIHDGPYNVIKNWNYSGLVDAIHNGDGKCWTAKVRTEEELKEAISTA  548

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAK+D LCFIEV  HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  549  TGAKRDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ  590



>ref|XP_008344771.1| PREDICTED: pyruvate decarboxylase 1-like [Malus domestica]
Length=606

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q  I
Sbjct  445  EGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCBQXSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL EAI TA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRTEEELTEAIATA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVI HKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  565  TGEKKDCLCFIEVIXHKDDTSKELLEWGSRVSSANSRLPNPQ  606



>ref|XP_008362250.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA PEKRVI+ IGDGSFQVT QDVSTM+R GQ+ II
Sbjct  444  GCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIAFIGDGSFQVTVQDVSTMIRNGQKNII  503

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETAT
Sbjct  504  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAT  563

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKD LCFIEVI HKDDTSKELLEWGSRVSAANSR PNPQ
Sbjct  564  GAKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRSPNPQ  604



>ref|XP_011096418.1| PREDICTED: pyruvate decarboxylase 1 [Sesamum indicum]
Length=585

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  424  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRTI  483

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  EEELVEAI TA
Sbjct  484  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVKTEEELVEAIATA  543

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGA+ + LCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  544  TGAQSESLCFIEVLVHKDDTSKELLEWGSRVSAANSRPPNPQ  585



>ref|XP_010264586.1| PREDICTED: pyruvate decarboxylase 2 [Nelumbo nucifera]
Length=606

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P KRV++ IGDGSFQ+TAQ+VSTMLRC Q+ I
Sbjct  445  EGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVLAFIGDGSFQMTAQEVSTMLRCNQKSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F+D+IHNGEGKCWT KV  EEELVEAI+ A
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGFVDSIHNGEGKCWTTKVRCEEELVEAIKLA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  565  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANSRPPNPQ  606



>ref|XP_008372585.1| PREDICTED: pyruvate decarboxylase 2, partial [Malus domestica]
Length=485

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+  GDGSFQVTAQDVSTM+R GQ+ IIF
Sbjct  326  CGYEFQMQYGSIGWSVGATLGYAQAVPQKRVIAFXGDGSFQVTAQDVSTMIRNGQKTIIF  385

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LI NGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETATG
Sbjct  386  LIXNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETATG  445

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            AKKD LCFIEVIVHKDDTSK LLEWGSRVSAANSRPPNPQ
Sbjct  446  AKKDSLCFIEVIVHKDDTSKXLLEWGSRVSAANSRPPNPQ  485



>emb|CDY10495.1| BnaCnng03960D [Brassica napus]
Length=608

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            QGCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQDVSTMLR GQ+ I
Sbjct  447  QGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVLAFIGDGSFQVTAQDVSTMLRNGQKTI  506

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV YEEELVEAI TA
Sbjct  507  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRYEEELVEAITTA  566

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVI+HKDDTSKELLEWGSRV+AAN RP NPQ
Sbjct  567  TLEKKDSLCFIEVILHKDDTSKELLEWGSRVAAANGRPHNPQ  608



>ref|XP_010277737.1| PREDICTED: pyruvate decarboxylase 1 [Nelumbo nucifera]
Length=589

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKEKRVIACIGDGSFQVTAQDISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  E+EL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVRTEDELTEAIATA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K+D LCFIEV+VHKDDTSKELLEWGSRV +ANSRPPNPQ
Sbjct  548  TGEKQDSLCFIEVLVHKDDTSKELLEWGSRVCSANSRPPNPQ  589



>ref|XP_004249069.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum lycopersicum]
Length=603

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVTAQD+STML+CGQR I
Sbjct  442  KGCGYEFQMQYGSIGWSVGATLGYAQAAKEKRVIAFIGDGSFQVTAQDISTMLQCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEELVEAI TA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVRCEEELVEAIGTA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TEAKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>ref|XP_008391462.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=527

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+  GDGSFQVTAQDVSTM+R GQ+ IIF
Sbjct  368  CGYEFQMQYGSIGWSVGATLGYAQAVPQKRVIAFXGDGSFQVTAQDVSTMIRNGQKTIIF  427

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LI NGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETATG
Sbjct  428  LIXNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETATG  487

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            AKKD LCFIEVIVHKDDTSK LLEWGSRVSAANSRPPNPQ
Sbjct  488  AKKDSLCFIEVIVHKDDTSKXLLEWGSRVSAANSRPPNPQ  527



>ref|XP_011460964.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=608

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVG TLGYAQA P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  449  CRYEFQMQYGSIGWSVGGTLGYAQAVPNKRVIACIGDGSFQVTAQDVSTMIRCNQKSIIF  508

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EE+L+EAIETATG
Sbjct  509  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEDLIEAIETATG  568

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIE+IVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  569  EKKDCLCFIEIIVHKDDTSKELLEWGSRVSSANSRPPNPQ  608



>emb|CBI15925.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  416  EGCGYEFQMQYGSIGWSVGAMLGYAQSVPDKRVIACIGDGSFQVTAQDVSTMIRCEQKSI  475

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  E+EL+EAIE A
Sbjct  476  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTKKVNNEQELIEAIEIA  535

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  536  TGEKKDCLCFIEVVVHKDDTSKELLEWGSRVSSANSRAPNPQ  577



>ref|XP_002275486.1| PREDICTED: pyruvate decarboxylase 1 [Vitis vinifera]
 emb|CBI30661.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQ   +KRVI+CIGDGSFQVTAQDVSTM+RCGQR I
Sbjct  416  ENCGYEFQMQYGSIGWSVGATLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCGQRTI  475

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YTA ++AIHNGEGKCWTAKV  E+EL EAI TA
Sbjct  476  IFLINNGGYTIEVEIHDGPYNVIKNWDYTALINAIHNGEGKCWTAKVRTEDELTEAIATA  535

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGA KD LCFIEV VHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  536  TGAHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANGRPPNPQ  577



>gb|KJB69604.1| hypothetical protein B456_011G033400 [Gossypium raimondii]
Length=337

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 148/177 (84%), Gaps = 16/177 (9%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEK----------------RVISCIGDGSFQVT  566
            GC YEFQMQYGSIGWSVGATLGYAQA PEK                RVI+CIGDGSFQVT
Sbjct  161  GCEYEFQMQYGSIGWSVGATLGYAQAVPEKWSVGATLGYAQAVPEKRVIACIGDGSFQVT  220

Query  565  AQDVSTMLRCGQRPIIFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTA  386
            AQDVSTMLRCGQ+ IIFLINN GYTIEVEIHDGPYNVIK WNYTA +DAIHNGE KCWT 
Sbjct  221  AQDVSTMLRCGQKTIIFLINNRGYTIEVEIHDGPYNVIKKWNYTALVDAIHNGEAKCWTT  280

Query  385  KVFYEEELVEAIETATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            KVF EEELVEAI+TA GAKKDCLCFIEVIVHKDDTSKELLEWGSRV A +SRPP PQ
Sbjct  281  KVFCEEELVEAIKTAMGAKKDCLCFIEVIVHKDDTSKELLEWGSRVCAPSSRPPTPQ  337



>ref|XP_010279076.1| PREDICTED: pyruvate decarboxylase 1-like [Nelumbo nucifera]
Length=589

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAQDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIH+GEGKCWTAKV  E+EL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHDGEGKCWTAKVRTEDELTEAISTA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAK+D LCFIE++VHKDDTSKELLEWG+RVS+ANSRPPNPQ
Sbjct  548  TGAKQDSLCFIEILVHKDDTSKELLEWGTRVSSANSRPPNPQ  589



>emb|CDO99368.1| unnamed protein product [Coffea canephora]
Length=610

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ PEKRVI+CIGDGSFQVTAQDVSTM+R  Q+ I
Sbjct  449  EGCGYEFQMQYGSIGWSVGATLGYAQSVPEKRVIACIGDGSFQVTAQDVSTMIRSNQKTI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DA+ NGEG CWT KV  EEELV AIETA
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDALCNGEGNCWTTKVRCEEELVNAIETA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  569  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVSSANSRPPNPQ  610



>dbj|BAC23043.1| pyruvate decarboxylase [Solanum tuberosum]
Length=592

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVTAQD+STML+CGQR I
Sbjct  431  KDCGYEFQMQYGSIGWSVGATLGYAQAAKEKRVIAFIGDGSFQVTAQDISTMLQCGQRTI  490

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEELVEAIETA
Sbjct  491  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVRCEEELVEAIETA  550

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  551  TETKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  592



>ref|XP_002465414.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
 gb|EER92412.1| hypothetical protein SORBIDRAFT_01g038360 [Sorghum bicolor]
Length=610

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  449  EGCGYEFQMQYGSIGWSVGALLGYAQGANQKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNGEGKCWT+KV  EEEL  AIETA
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGEGKCWTSKVKCEEELTAAIETA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
               KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  LAEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>ref|NP_001105422.1| pyruvate decarboxylase 1 [Zea mays]
 emb|CAA35589.1| pyruvate decarboxylase [Zea mays]
Length=610

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  449  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN EG CWT KV  EE+L EAI  A
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSEGNCWTMKVRTEEQLKEAIAMA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>gb|AAX33299.1| pyruvate decarboxylase 2 [Petunia x hybrida]
Length=588

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  427  KGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCDQKNI  486

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEG CWT KV  EEEL +AI TA
Sbjct  487  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAIHNGEGNCWTQKVRTEEELTDAIATA  546

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  547  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  588



>ref|XP_004984863.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=610

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  449  EGCGYEFQMQYGSIGWSVGALLGYAQGANDKRVIACIGDGSFQVTAQDVSTMLRCKQNSI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL  AIETA
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTAAIETA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>ref|XP_008356242.1| PREDICTED: pyruvate decarboxylase 2, partial [Malus domestica]
Length=485

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            CGYEFQMQYGSIGWSVGATLGYAQA P+KRVI+  GDGSFQVTAQDVSTM+R GQ+ IIF
Sbjct  326  CGYEFQMQYGSIGWSVGATLGYAQAVPQKRVIAFXGDGSFQVTAQDVSTMIRNGQKTIIF  385

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETATG
Sbjct  386  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETATG  445

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            A  D LCFIEVIVHKDDTSK+LLEWGSRVSAANSRPPNPQ
Sbjct  446  AXXDXLCFIEVIVHKDDTSKKLLEWGSRVSAANSRPPNPQ  485



>dbj|BAK04101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  II
Sbjct  440  GCGYEFQMQYGSIGWSVGALLGYAQGARDKRVIACIGDGSFQVTAQDVSTMLRCEQNSII  499

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL  AIETAT
Sbjct  500  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVTCEEELTAAIETAT  559

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEV+ HKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  560  GEKKDCLCFIEVVAHKDDTSKELLEWGSRVCAANSRPPNPQ  600



>ref|XP_004958794.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=605

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ    KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  444  EGCGYEFQMQYGSIGWSVGALLGYAQGAAGKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL  AI+TA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVACEEELTAAIDTA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K+DCLCFIEV+ HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  TGEKEDCLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_006363625.1| PREDICTED: pyruvate decarboxylase 1-like [Solanum tuberosum]
Length=603

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVTAQD+STML+CGQR I
Sbjct  442  KDCGYEFQMQYGSIGWSVGATLGYAQAAKEKRVIAFIGDGSFQVTAQDISTMLQCGQRTI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEELVEAIETA
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVRCEEELVEAIETA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  TETKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>ref|XP_002276535.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Vitis vinifera]
Length=607

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  446  EGCGYEFQMQYGSIGWSVGAMLGYAQSVPDKRVIACIGDGSFQVTAQDVSTMIRCEQKSI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  E+EL+EAIE A
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTKKVNNEQELIEAIEIA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEV+VHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  566  TGEKKDCLCFIEVVVHKDDTSKELLEWGSRVSSANSRAPNPQ  607



>emb|CDO96745.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQDVSTMLRCGQ  I
Sbjct  423  ENCGYEFQMQYGSIGWSVGATLGYAQAARNKRVIACIGDGSFQVTAQDVSTMLRCGQNSI  482

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEG CWTAKV  E+EL EAI TA
Sbjct  483  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGNCWTAKVRTEDELTEAIATA  542

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KDCLCFIEV+VHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  543  TGTHKDCLCFIEVLVHKDDTSKELLEWGSRVSSANSRPPNPQ  584



>gb|AAB16855.1| pyruvate decarboxylase [Arabidopsis thaliana]
Length=607

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA P +RVI+CIGDGSFQVTAQDVS M+RCG + I
Sbjct  446  EGCGYEFQMQYGSIGWSVGATLGYAQAMPNRRVIACIGDGSFQVTAQDVSPMIRCGHKTI  505

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF++AIHNGEGKCWT KV  EEELV+AI TA
Sbjct  506  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVEAIHNGEGKCWTPKVRCEEELVKAINTA  565

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +K+  CFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  566  TNEEKESFCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  607



>ref|XP_008779927.1| PREDICTED: pyruvate decarboxylase 1-like, partial [Phoenix dactylifera]
Length=271

 Score =   288 bits (737),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+ CG R I
Sbjct  110  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIHCGHRSI  169

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAI+NGEG+CWT+KV  EEEL +AI  A
Sbjct  170  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIYNGEGRCWTSKVRTEEELEDAISKA  229

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  +KD LCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  230  TEEQKDSLCFIEVMVHKDDTSKELLEWGSRVSAANSRPPNPQ  271



>sp|P51850.1|PDC1_PEA RecName: Full=Pyruvate decarboxylase 1; Short=PDC [Pisum sativum]
 emb|CAA91444.1| pyruvate decarboxylase [Pisum sativum]
Length=593

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  432  ENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  491

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F+ AIHNG+GKCWTAKV  EE+L EAI TA
Sbjct  492  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGFVSAIHNGQGKCWTAKVRTEEDLTEAIATA  551

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGA+KD LCFIEV  HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  552  TGAEKDSLCFIEVFAHKDDTSKELLEWGSRVAAANSRPPNPQ  593



>ref|XP_010323135.1| PREDICTED: pyruvate decarboxylase 2 [Solanum lycopersicum]
Length=586

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGY+FQMQYGSIGWSVGATLGYAQ+ P+KRV+S IGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  425  EGCGYQFQMQYGSIGWSVGATLGYAQSEPKKRVVSFIGDGSFQVTAQDVSTMIRCDQKTI  484

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL+EAI TA
Sbjct  485  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTQKVRTEEELIEAIATA  544

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  545  TGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  586



>ref|XP_008654188.1| PREDICTED: pyruvate decarboxylase 3-like [Zea mays]
 tpg|DAA64245.1| TPA: hypothetical protein ZEAMMB73_651726 [Zea mays]
Length=609

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGA LGYAQ  P+KRVI+CIGDGSFQVTAQDVSTMLRC QR II
Sbjct  448  GCGYEFQMQYGSIGWSVGALLGYAQGAPDKRVIACIGDGSFQVTAQDVSTMLRCEQRSII  507

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNG+G+CWTA+V  EEEL  AI TAT
Sbjct  508  FLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGQGRCWTARVATEEELTAAIATAT  567

Query  337  G-AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G  +KDCLCFIEV+VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  568  GDDRKDCLCFIEVVVHKDDTSKELLEWGSRVSAANSRPPNPQ  609



>gb|ACG29583.1| pyruvate decarboxylase isozyme 1 [Zea mays]
Length=610

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQDVSTMLRCGQ+ I
Sbjct  449  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTMLRCGQKSI  508

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHN +G CWT KV  EE+L EAI  A
Sbjct  509  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNSDGNCWTMKVRTEEQLKEAIAMA  568

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  569  TGDKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>ref|XP_011094440.1| PREDICTED: pyruvate decarboxylase 1-like [Sesamum indicum]
Length=609

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GC YEFQMQYGSIGWSVGATLGYAQA P  RVI+CIGDGSFQ+TAQDVSTM+RCGQ+ I
Sbjct  448  KGCRYEFQMQYGSIGWSVGATLGYAQAVPNMRVIACIGDGSFQMTAQDVSTMIRCGQKSI  507

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AI NGEG CW+ KV  EEEL+EAI+ A
Sbjct  508  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIQNGEGNCWSTKVRCEEELIEAIKNA  567

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNP+
Sbjct  568  TEAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPR  609



>ref|XP_008384776.1| PREDICTED: pyruvate decarboxylase 2-like isoform X1 [Malus domestica]
Length=610

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  451  CRYEFQMQYGSIGWSVGATLGYAQSVPKKRVIACIGDGSFQVTAQDVSTMIRCNQKSIIF  510

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TAT 
Sbjct  511  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTTKVRTEEELTEAIATATE  570

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  571  EKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  610



>ref|XP_006449474.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
 gb|ESR62714.1| hypothetical protein CICLE_v10014703mg [Citrus clementina]
Length=589

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL EA++TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  548  TGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>gb|KDO77804.1| hypothetical protein CISIN_1g007800mg [Citrus sinensis]
Length=589

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL EA++TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKTA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  548  TGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>gb|EMT15339.1| hypothetical protein F775_43983 [Aegilops tauschii]
Length=605

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  444  EGCGYEFQMQYGSIGWSVGALLGYAQGASDKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AIHNGEGKCWTAKV  EEEL  AIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIHNGEGKCWTAKVKCEEELTAAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  LGEKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>gb|EMS61021.1| Pyruvate decarboxylase isozyme 2 [Triticum urartu]
Length=571

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  374  EGCGYEFQMQYGSIGWSVGALLGYAQGASDKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  433

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AIHNGEGKCWTAKV  EEEL  AIETA
Sbjct  434  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIHNGEGKCWTAKVKCEEELTAAIETA  493

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNP 
Sbjct  494  LGEKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPH  535



>dbj|BAJ94428.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=606

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTMLRC Q  I
Sbjct  445  EGCGYEFQMQYGSIGWSVGALLGYAQGASDKRVIACIGDGSFQVTAQDVSTMLRCEQNSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AIHNGEGKCWTAKV  EEEL  AIETA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIHNGEGKCWTAKVKCEEELTAAIETA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  LGEKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>ref|XP_009773010.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana sylvestris]
Length=614

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  455  CRYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKSIIF  514

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TATG
Sbjct  515  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATATG  574

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  575  EKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  614



>ref|XP_008362261.1| PREDICTED: pyruvate decarboxylase 2-like [Malus domestica]
Length=604

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  EKRVI+ IGDGSFQVT QDV TM+R GQ+ II
Sbjct  444  GCGYEFQMQYGSIGWSVGATLGYAQAVTEKRVIAFIGDGSFQVTVQDVXTMIRNGQKNII  503

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EEEL+EAIETAT
Sbjct  504  FLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRCEEELIEAIETAT  563

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            GAKKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPP+PQ
Sbjct  564  GAKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPSPQ  604



>sp|A2XFI3.2|PDC2_ORYSI RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Indica Group]
 gb|EEC75031.1| hypothetical protein OsI_11123 [Oryza sativa Indica Group]
Length=606

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTM+RC Q  I
Sbjct  445  EGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL EAI  A
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|AAA90948.1| pyruvate decarboxylase 2 [Oryza sativa Indica Group]
 gb|AAB40530.1| pyruvate decarboxylase 2 [Oryza sativa Indica Group]
Length=603

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTM+RC Q  I
Sbjct  442  EGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSI  501

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL EAI  A
Sbjct  502  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMA  561

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  562  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  603



>gb|ABR25487.1| pyruvate decarboxylase isozyme 3 [Oryza sativa Indica Group]
Length=201

 Score =   284 bits (726),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQA  +KRV++CIGDGSFQVTAQDVSTMLRCGQR I
Sbjct  41   EGCGYEFQMQYGSIGWSVGALLGYAQAV-QKRVVACIGDGSFQVTAQDVSTMLRCGQRSI  99

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+Y   ++AIHNGEG+CW  +V  EEEL  AI TA
Sbjct  100  IFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEAAIATA  159

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K D LCFIEV+ HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  160  TGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ  201



>ref|XP_008775407.1| PREDICTED: pyruvate decarboxylase 2-like [Phoenix dactylifera]
Length=606

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGA LGYAQA  +KR+I+CIGDGSFQVTAQDVSTMLRCGQ  II
Sbjct  446  GCGYEFQMQYGSIGWSVGAALGYAQAAKDKRLIACIGDGSFQVTAQDVSTMLRCGQNSII  505

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNWNYTA ++AIHNGEG CWTAKV  EEEL EAIET+ 
Sbjct  506  FLINNGGYTIEVEIHDGPYNVIKNWNYTALVEAIHNGEGNCWTAKVKCEEELKEAIETSM  565

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEV +HKDD SKELLEWGSRVSAANSRPP+PQ
Sbjct  566  GPKKDCLCFIEVFLHKDDASKELLEWGSRVSAANSRPPSPQ  606



>sp|P51846.1|PDC2_TOBAC RecName: Full=Pyruvate decarboxylase 2; Short=NtPDC2 [Nicotiana 
tabacum]
 emb|CAA57448.1| pyruvate decarboxylase [Nicotiana tabacum]
Length=614

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  455  CRYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKNIIF  514

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TATG
Sbjct  515  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATATG  574

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  575  EKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  614



>ref|XP_009594220.1| PREDICTED: pyruvate decarboxylase 2 isoform X1 [Nicotiana tomentosiformis]
Length=614

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVGATLGYAQ+ P+KRVISCIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  455  CRYEFQMQYGSIGWSVGATLGYAQSVPKKRVISCIGDGSFQVTAQDVSTMIRCEQKNIIF  514

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  EEEL EAI TATG
Sbjct  515  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTMKVRTEEELTEAIATATG  574

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEVIVHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  575  EKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ  614



>ref|XP_003542972.1| PREDICTED: pyruvate decarboxylase 1-like [Glycine max]
Length=589

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQKTI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F+DAIHNG+GKCWTAKV  E++L EAI  A
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTRFVDAIHNGQGKCWTAKVRTEDDLTEAIAKA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  548  TGPQKDSLCFIEVFVHKDDTSKELLEWGSRVAAANSRPPNPQ  589



>ref|XP_008457351.1| PREDICTED: pyruvate decarboxylase 2-like [Cucumis melo]
Length=600

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  439  KGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDVSTMIRCEQKTI  498

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHNGEGKCWT KV  EEEL+EAI TA
Sbjct  499  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIHNGEGKCWTTKVHTEEELIEAINTA  558

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
               K D LCFIEVIVHKDDTSKELLEWGSRV AANSR PNPQ
Sbjct  559  MDKKIDSLCFIEVIVHKDDTSKELLEWGSRVCAANSRAPNPQ  600



>ref|XP_003558149.1| PREDICTED: pyruvate decarboxylase 2 [Brachypodium distachyon]
Length=608

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQD+STMLRC Q  I
Sbjct  447  EGCGYEFQMQYGSIGWSVGALLGYAQGANDKRVIACIGDGSFQVTAQDISTMLRCAQNSI  506

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  EEEL  AI TA
Sbjct  507  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVKCEEELTAAIATA  566

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKD LCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  567  LGEKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  608



>ref|XP_008653674.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase 3-like 
[Zea mays]
Length=336

 Score =   288 bits (737),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGS+GWSVGA LGYAQ  P+KRVI+CIGDGSFQVTAQDVSTMLRC QR II
Sbjct  175  GCGYEFQMQYGSMGWSVGALLGYAQGAPDKRVIACIGDGSFQVTAQDVSTMLRCEQRSII  234

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNG G+CWT +V  EEEL  AI TAT
Sbjct  235  FLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGXGRCWTTRVATEEELTAAIATAT  294

Query  337  G-AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G  +KDCLCFIEV+ HKDDTSKELLEWGSRVSAANSRPPN Q
Sbjct  295  GDDRKDCLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNLQ  336



>ref|XP_002305755.2| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE86266.2| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=582

 Score =   296 bits (757),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  421  ENCGYEFQMQYGSIGWSVGATLGYAQAARDKRVIACIGDGSFQVTAQDISTMIRCGQRTI  480

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL  AI TA
Sbjct  481  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRTEDELTAAIATA  540

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIE+ VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  541  TGEHKDSLCFIEIFVHKDDTSKELLEWGSRVSAANSRPPNPQ  582



>ref|NP_001275795.1| pyruvate decarboxylase [Citrus sinensis]
 gb|AAZ05069.1| pyruvate decarboxylase [Citrus sinensis]
Length=589

 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL EA++ A
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRSEDELTEAMKAA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  548  TGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>ref|NP_001105052.1| pyruvate decarboxylase 3 [Zea mays]
 gb|AAL99744.1| pyruvate decarboxylase [Zea mays]
 gb|ACG43025.1| pyruvate decarboxylase isozyme 2 [Zea mays]
 gb|ACL54676.1| unknown [Zea mays]
 tpg|DAA44863.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=606

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ    KRVI+ IGDGSFQVTAQDVSTMLRC Q  I
Sbjct  445  EGCGYEFQMQYGSIGWSVGALLGYAQGANHKRVIAFIGDGSFQVTAQDVSTMLRCEQNSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNG GKCWT+KV  EEEL  AIETA
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGLGKCWTSKVKSEEELTAAIETA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  606



>gb|AAL99745.1| pyruvate decarboxylase [Zea mays]
 tpg|DAA44860.1| TPA: pyruvate decarboxylase3 [Zea mays]
Length=605

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ    KRVI+ IGDGSFQVTAQDVSTMLRC Q  I
Sbjct  444  EGCGYEFQMQYGSIGWSVGALLGYAQGANHKRVIAFIGDGSFQVTAQDVSTMLRCEQNSI  503

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNG GKCWT+KV  EEEL  AIETA
Sbjct  504  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGLGKCWTSKVKSEEELTAAIETA  563

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  LGEKKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_003593734.1| Pyruvate decarboxylase [Medicago truncatula]
 gb|AES63985.1| pyruvate decarboxylase [Medicago truncatula]
Length=582

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  421  ENCGYEFQMQYGSIGWSVGATLGYAQAATNKRVIACIGDGSFQVTAQDISTMIRCGQKSI  480

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F+ AIHNG+GKCWTAKV  EE+L+EAI TA
Sbjct  481  IFLINNGGYTIEVEIHDGPYNVIKNWDYTRFVSAIHNGQGKCWTAKVRTEEDLIEAIATA  540

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV  HKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  541  TGTEKDSLCFIEVFAHKDDTSKELLEWGSRVAAANSRPPNPQ  582



>ref|XP_007148065.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
 gb|ESW20059.1| hypothetical protein PHAVU_006G177600g [Phaseolus vulgaris]
Length=584

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  423  ENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  482

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F++AIHNG+GKCW AKV  E++L EAI TA
Sbjct  483  IFLINNGGYTIEVEIHDGPYNVIKNWDYTRFVEAIHNGQGKCWVAKVRTEDDLSEAIRTA  542

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            +GA+KD LCFIEV VHKDDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  543  SGAEKDSLCFIEVFVHKDDTSKELLEWGSRVAAANSRPPNPQ  584



>ref|XP_009123548.1| PREDICTED: pyruvate decarboxylase 1-like [Brassica rapa]
Length=600

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKRV++ IGDGSFQVTAQ+VSTMLR  Q+ I
Sbjct  440  RGCGYEFQMQYGSIGWSVGATLGYAQAQPEKRVVAFIGDGSFQVTAQEVSTMLRNEQKSI  499

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFL+NNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNGEGKCWT KV  EEELVEA+  A
Sbjct  500  IFLVNNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGEGKCWTTKVTCEEELVEAVTIA  559

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPN  221
            + +KKDCLCFIEVI+HKDDTSKELLEWGSRVSAANSRPPN
Sbjct  560  SESKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPN  599



>ref|XP_002317431.1| pyruvate decarboxylase family protein [Populus trichocarpa]
 gb|EEE98043.1| pyruvate decarboxylase family protein [Populus trichocarpa]
Length=593

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  432  ENCGYEFQMQYGSIGWSVGATLGYAQAARDKRVIACIGDGSFQVTAQDISTMIRCGQRTI  491

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL  AI TA
Sbjct  492  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRTEDELTAAIATA  551

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV VHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  552  TGEQKDSLCFIEVFVHKDDTSKELLEWGSRVSAANGRPPNPQ  593



>ref|XP_002522545.1| pyruvate decarboxylase, putative [Ricinus communis]
 gb|EEF39845.1| pyruvate decarboxylase, putative [Ricinus communis]
Length=589

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQD+STM+R GQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAARNKRVIACIGDGSFQVTAQDISTMIRSGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++AIHNGEGKCWTAKV  EEEL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVNAIHNGEGKCWTAKVHTEEELTEAIATA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G +KD LCFIEV+VHKDDTSKELLEWGSRVS+AN RPPNPQ
Sbjct  548  MGEQKDSLCFIEVLVHKDDTSKELLEWGSRVSSANGRPPNPQ  589



>ref|XP_009384923.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATP-EKRVISCIGDGSFQVTAQDVSTMLRCGQRP  524
            +GCGYEFQMQYGSIGWSVGATLGYAQA    KRVI+CIGDGSFQVTAQDVSTMLRC Q  
Sbjct  443  EGCGYEFQMQYGSIGWSVGATLGYAQAVKNRKRVIACIGDGSFQVTAQDVSTMLRCEQNS  502

Query  523  IIFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIET  344
            IIFLINNGGYTIEVEIHDGPYNVIKNWNY   +DAIHNGEGKCWT +V YEEEL EAI T
Sbjct  503  IIFLINNGGYTIEVEIHDGPYNVIKNWNYAGLVDAIHNGEGKCWTTRVRYEEELKEAIAT  562

Query  343  ATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            A GAK+DCLCFIEVIVHKDDTSKELLEWGSRV +ANSR PNPQ
Sbjct  563  AAGAKQDCLCFIEVIVHKDDTSKELLEWGSRVCSANSRAPNPQ  605



>ref|XP_004145248.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 ref|XP_004153721.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus]
 gb|KGN65827.1| hypothetical protein Csa_1G532350 [Cucumis sativus]
Length=600

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  439  KGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDVSTMIRCQQKTI  498

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHN EG CWT KV  EEEL+EAI TA
Sbjct  499  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALIDAIHNDEGNCWTTKVRTEEELIEAINTA  558

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  K D LCFIEVIVHKDDTSKELLEWGSRV AANSR PNPQ
Sbjct  559  TEKKSDSLCFIEVIVHKDDTSKELLEWGSRVCAANSRAPNPQ  600



>sp|Q05327.1|PDC3_MAIZE RecName: Full=Pyruvate decarboxylase 3; Short=PDC, partial [Zea 
mays]
 emb|CAA79819.1| pyruvate decarboxylase [Zea mays]
 dbj|BAA03354.1| pyruvate decarboxylase [Zea mays]
Length=202

 Score =   281 bits (719),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGY Q    KRVI+ IGDGSFQVTAQDVST+LRC Q  I
Sbjct  42   EGCGYEFQMQYGSIGWSVGALLGYPQGANHKRVIAFIGDGSFQVTAQDVSTILRCEQNSI  101

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAIHNG GKCWT+KV  EE+L  AIETA
Sbjct  102  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGLGKCWTSKVKSEEDLTAAIETA  161

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G +KDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  162  LG-EKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  202



>ref|XP_010108431.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
 gb|EXC19459.1| Pyruvate decarboxylase isozyme 1 [Morus notabilis]
Length=589

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGY+IE EIHDGPYNVIKNW+Y+  +DAIHNGEGKCWTAKV  E EL+EAI TA
Sbjct  488  IFLINNGGYSIEAEIHDGPYNVIKNWDYSGLVDAIHNGEGKCWTAKVRTEGELIEAIVTA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCF+EV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  548  TGEHKDSLCFVEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>gb|AIE47262.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA P KRVI+CIGDGSFQVTAQD+STM+R GQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAPNKRVIACIGDGSFQVTAQDISTMIRSGQRSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRTEDELTEAIATA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCF+EV+VHKDDTSKELLEWGSRV +AN RPPNPQ
Sbjct  548  TGEQKDSLCFVEVLVHKDDTSKELLEWGSRVCSANCRPPNPQ  589



>ref|XP_010924891.1| PREDICTED: pyruvate decarboxylase 1-like [Elaeis guineensis]
Length=577

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  416  ENCGYEFQMQYGSIGWSVGATLGYAQAAKNKRVIACIGDGSFQVTAQDISTMIRCGQRSI  475

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAI+NGEG CWT+KV  EEEL +AI  A
Sbjct  476  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAINNGEGGCWTSKVRTEEELEDAISKA  535

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEV+VHKDDTSKELLEWGSRVS ANSRPPNPQ
Sbjct  536  TGEQKDSLCFIEVMVHKDDTSKELLEWGSRVSTANSRPPNPQ  577



>ref|XP_006350849.1| PREDICTED: pyruvate decarboxylase 2-like [Solanum tuberosum]
Length=613

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C Y+FQMQYGSIGWSVGATLGYAQ+ P+KRVIS IGDGSFQVTAQDVSTM+RC Q+PIIF
Sbjct  454  CRYQFQMQYGSIGWSVGATLGYAQSVPKKRVISFIGDGSFQVTAQDVSTMIRCDQKPIIF  513

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DA+HNGEG CWT KV  EEEL EAI TATG
Sbjct  514  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDALHNGEGNCWTQKVRTEEELTEAIATATG  573

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEVIVH+DDTSKELLEWGSRV +AN RPPNPQ
Sbjct  574  EKKDCLCFIEVIVHRDDTSKELLEWGSRVCSANGRPPNPQ  613



>gb|KCW52500.1| hypothetical protein EUGRSUZ_J01896 [Eucalyptus grandis]
Length=601

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQD+ST++RCGQ+ I
Sbjct  440  EGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVIACIGDGSFQVTAQDISTIIRCGQKTI  499

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  E EL +AI TA
Sbjct  500  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRCERELEDAITTA  559

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDC CFIEVIVHKDDTSKELLEWGSRVSAANSR PN Q
Sbjct  560  TEEKKDCFCFIEVIVHKDDTSKELLEWGSRVSAANSRTPNSQ  601



>ref|XP_010034573.1| PREDICTED: pyruvate decarboxylase 1-like [Eucalyptus grandis]
Length=609

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P+KRVI+CIGDGSFQVTAQD+ST++RCGQ+ I
Sbjct  448  EGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVIACIGDGSFQVTAQDISTIIRCGQKTI  507

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  E EL +AI TA
Sbjct  508  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVRCERELEDAITTA  567

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  KKDC CFIEVIVHKDDTSKELLEWGSRVSAANSR PN Q
Sbjct  568  TEEKKDCFCFIEVIVHKDDTSKELLEWGSRVSAANSRTPNSQ  609



>gb|EYU28059.1| hypothetical protein MIMGU_mgv1a003736mg [Erythranthe guttata]
Length=567

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  406  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  465

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWTAKV  E+ELV+AI  A
Sbjct  466  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTAKVKTEDELVKAIAAA  525

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T   K+ LCFIEV+VHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  526  TDTYKESLCFIEVLVHKDDTSKELLEWGSRVSSANSRPPNPQ  567



>ref|XP_010912563.1| PREDICTED: pyruvate decarboxylase 1 [Elaeis guineensis]
Length=577

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQ++STM+RCGQR I
Sbjct  416  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMIRCGQRSI  475

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAI+NG G CWT+KV  EEEL++AI  A
Sbjct  476  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAINNGRGGCWTSKVRTEEELLDAISKA  535

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  536  TGEQKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  577



>ref|XP_009386639.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=579

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  E+RVI+CIGDGSFQVTAQDVSTM+R GQR I
Sbjct  418  ENCGYEFQMQYGSIGWSVGATLGYAQAAKERRVIACIGDGSFQVTAQDVSTMIRHGQRSI  477

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAI+NGEGKCWT KV  EEEL EA+  A
Sbjct  478  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAINNGEGKCWTCKVRTEEELEEAVAKA  537

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCF+EVIVHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  538  TGEMKDSLCFLEVIVHKDDTSKELLEWGSRVSSANSRPPNPQ  579



>ref|XP_004968281.1| PREDICTED: pyruvate decarboxylase 2-like [Setaria italica]
Length=598

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVT Q+VSTMLR GQ  I
Sbjct  437  EGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTVQEVSTMLRWGQNSI  496

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  ++A HNGEGKC+TAKV  EEEL EA++ A
Sbjct  497  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVEAFHNGEGKCYTAKVRTEEELKEALKAA  556

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  557  LGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  598



>ref|XP_004165846.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate decarboxylase isozyme 
2-like [Cucumis sativus]
Length=600

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQ+ P KRVI+CIGDGSFQVTAQDVSTM+RC Q+ I
Sbjct  439  KGCGYEFQMQYGSIGWSVGATLGYAQSVPSKRVIACIGDGSFQVTAQDVSTMIRCQQKTI  498

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTA +DAIHN EG CWT K   EEEL+EAI TA
Sbjct  499  IFLINNGGYTIEVEIHDGPYNVIKNWNYTALIDAIHNDEGNCWTTKARTEEELIEAINTA  558

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T  K D LCFIEVIVHKDDTSKELLEWGSRV AANSR PNPQ
Sbjct  559  TEKKSDSLCFIEVIVHKDDTSKELLEWGSRVCAANSRAPNPQ  600



>ref|XP_004134669.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 ref|XP_004155547.1| PREDICTED: pyruvate decarboxylase isozyme 1-like [Cucumis sativus]
 gb|KGN49289.1| Pyruvate decarboxylase [Cucumis sativus]
Length=589

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQAT  KR+I+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQATKHKRIIACIGDGSFQVTAQDISTMIRCGQRTI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWTAKV  E+EL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTAKVGTEQELTEAIATA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
                K+ LCFIEV+VHKDDTSKELLEWGSRV++AN RPPNPQ
Sbjct  548  RDEHKESLCFIEVLVHKDDTSKELLEWGSRVASANGRPPNPQ  589



>ref|XP_010650884.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Vitis vinifera]
Length=611

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  694  CGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPIIF  515
            C YEFQMQYGSIGWSVGA LGYAQ+ P+KRVI+CIGDGSFQVTAQDVSTM+RC Q+ IIF
Sbjct  452  CRYEFQMQYGSIGWSVGAMLGYAQSVPDKRVIACIGDGSFQVTAQDVSTMIRCEQKSIIF  511

Query  514  LINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETATG  335
            LINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEG CWT KV  E+EL+EAIE ATG
Sbjct  512  LINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTKKVNNEQELIEAIEIATG  571

Query  334  AKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             KKDCLCFIEV+VHKDDTSKELLEWGSRVS+ANSR PNPQ
Sbjct  572  EKKDCLCFIEVVVHKDDTSKELLEWGSRVSSANSRAPNPQ  611



>ref|XP_009402387.1| PREDICTED: pyruvate decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATP-EKRVISCIGDGSFQVTAQDVSTMLRCGQRP  524
            +GCGYEFQMQYGSIGWSVGATLGYAQA    KRVI+ IGDGSFQVTAQDVSTMLRCGQ  
Sbjct  443  EGCGYEFQMQYGSIGWSVGATLGYAQAVKGSKRVIAFIGDGSFQVTAQDVSTMLRCGQNS  502

Query  523  IIFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIET  344
            IIFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEGKCWT KV +EEEL EAIET
Sbjct  503  IIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTTKVRHEEELKEAIET  562

Query  343  ATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            A G+K+DCLCFIEVIVHKDDTSKELLEWGSRV +ANSR PNPQ
Sbjct  563  AMGSKQDCLCFIEVIVHKDDTSKELLEWGSRVCSANSRAPNPQ  605



>ref|XP_011045902.1| PREDICTED: pyruvate decarboxylase 1 [Populus euphratica]
Length=593

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  432  ENCGYEFQMQYGSIGWSVGATLGYAQAARDKRVIACIGDGSFQVTAQDISTMIRCGQRTI  491

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYT+EV+IHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL  AI TA
Sbjct  492  IFLINNGGYTVEVQIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRTEDELTAAIATA  551

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIE+ VHKDDTSKELLEWGSRVSAAN RPPNPQ
Sbjct  552  TGEQKDSLCFIEIFVHKDDTSKELLEWGSRVSAANGRPPNPQ  593



>gb|KHG03537.1| Pyruvate decarboxylase isozyme 1 [Gossypium arboreum]
Length=601

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 150/174 (86%), Gaps = 12/174 (7%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQ+ I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQKSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAK------------VF  377
            IFLINNGGYTIEVEIHDGPYNVIKNWNYTAF+DAIHNGEG+CWTAK            V 
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGRCWTAKMHPLLTLRSTSLVR  547

Query  376  YEEELVEAIETATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             E+EL++AI  ATG KKD LCFIEV  HKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  548  TEDELIDAIAAATGEKKDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ  601



>gb|EEE58866.1| hypothetical protein OsJ_10464 [Oryza sativa Japonica Group]
Length=569

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTM+RC Q  I
Sbjct  409  EGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSI  468

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL EAI  A
Sbjct  469  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMA  528

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G +KDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  529  LG-EKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  569



>ref|XP_009352809.1| PREDICTED: pyruvate decarboxylase 1 [Pyrus x bretschneideri]
Length=587

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQ   +KRVI+CIGDGSFQVTAQD+STM+RCGQ  I
Sbjct  426  ENCGYEFQMQYGSIGWSVGATLGYAQGAKDKRVIACIGDGSFQVTAQDISTMIRCGQNTI  485

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEGKCWT KV  EE+L EAI  A
Sbjct  486  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTTKVRTEEDLTEAIAKA  545

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  546  TGEHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  587



>ref|XP_006658999.1| PREDICTED: pyruvate decarboxylase 3-like [Oryza brachyantha]
Length=520

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQA P+KRV++CIGDGSFQVTAQDVSTMLRCGQR I
Sbjct  359  EGCGYEFQMQYGSIGWSVGAVLGYAQAMPKKRVVACIGDGSFQVTAQDVSTMLRCGQRSI  418

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+Y   + AIHNGEG CW  +V  EEEL  AI TA
Sbjct  419  IFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVRAIHNGEGACWATRVACEEELRAAIATA  478

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K  CLCFIEV+ HKDDTSKELLEWGSRV AANSRPPNPQ
Sbjct  479  TGDKAHCLCFIEVVAHKDDTSKELLEWGSRVCAANSRPPNPQ  520



>ref|XP_001763233.1| predicted protein [Physcomitrella patens]
 gb|EDQ72110.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQ  P KRVI+CIGDGSFQVTAQDVSTM+RCGQR II
Sbjct  416  GCGYEFQMQYGSIGWSVGATLGYAQGAPNKRVIACIGDGSFQVTAQDVSTMIRCGQRSII  475

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYN+IKNWNYT  ++A HNGEGK WT KV  E++L++AI TA 
Sbjct  476  FLINNGGYTIEVEIHDGPYNIIKNWNYTGVVEAFHNGEGKLWTCKVRTEDDLIDAIATAQ  535

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKD LCFIE++VH+DDTSKELLEWGSRV+AANSRPPNPQ
Sbjct  536  GEKKDHLCFIEIMVHRDDTSKELLEWGSRVAAANSRPPNPQ  576



>ref|XP_008805101.1| PREDICTED: pyruvate decarboxylase 1-like [Phoenix dactylifera]
Length=604

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  GCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPII  518
            GCGYEFQMQYGSIGWSVGATLGYAQA  +KRV++ IGDGSFQVTAQD+STM+R  Q+ II
Sbjct  444  GCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVLAFIGDGSFQVTAQDISTMMRYEQKSII  503

Query  517  FLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETAT  338
            FLINNGGYTIEVEIHDGPYNVIKNW+YTA +DAIHN EGKCWT KV  EEEL EAI+TA 
Sbjct  504  FLINNGGYTIEVEIHDGPYNVIKNWDYTALVDAIHNDEGKCWTMKVRCEEELKEAIQTAL  563

Query  337  GAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            G KKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  564  GPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  604



>gb|EEC82735.1| hypothetical protein OsI_27437 [Oryza sativa Indica Group]
Length=428

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQA  +KRV++CIGDGSFQVTAQDVSTMLRCGQR I
Sbjct  268  EGCGYEFQMQYGSIGWSVGALLGYAQAV-QKRVVACIGDGSFQVTAQDVSTMLRCGQRSI  326

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+Y   ++AIHNGEG+CW  +V  EEEL  AI TA
Sbjct  327  IFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEAAIATA  386

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG K D LCFIEV+ HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  387  TGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ  428



>ref|XP_008805886.1| PREDICTED: pyruvate decarboxylase 1 [Phoenix dactylifera]
Length=577

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  416  ENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDISTMIRCGQRSI  475

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            +FLINNGGYTIEVEIHDGPYNVIKNWNYT F+DAI NG+G CWT+KV  EEELV+AI  A
Sbjct  476  VFLINNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIDNGQGGCWTSKVRTEEELVDAISKA  535

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIEVI HKDDTSKELLEWGSRV+AANSR PNPQ
Sbjct  536  TGEQKDSLCFIEVIAHKDDTSKELLEWGSRVAAANSRHPNPQ  577



>ref|XP_010686333.1| PREDICTED: pyruvate decarboxylase 1 [Beta vulgaris subsp. vulgaris]
Length=581

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCG+EFQMQYGSIGWSVGATLGYAQA  +KRV++ IGDGSFQVTAQDVSTM+RCGQ+ I
Sbjct  420  EGCGFEFQMQYGSIGWSVGATLGYAQAAQDKRVVAFIGDGSFQVTAQDVSTMIRCGQKNI  479

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT F+ AIHNG+GKCWTAKV  E++LV+AI TA
Sbjct  480  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGFIKAIHNGQGKCWTAKVRTEDQLVDAITTA  539

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIEVIVHKDDTSKELLEWGSRV++ANSRPPNPQ
Sbjct  540  TGECKDSLCFIEVIVHKDDTSKELLEWGSRVASANSRPPNPQ  581



>ref|XP_004293926.1| PREDICTED: pyruvate decarboxylase 1 [Fragaria vesca subsp. vesca]
Length=589

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQ   +KRVI+CIGDGSFQVTAQD+STM+RCGQ  I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQGAKDKRVIACIGDGSFQVTAQDISTMIRCGQNTI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  +DAIHNGEGKCWT KV  EE+L EAI  A
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTTKVRTEEDLTEAIAKA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  548  TGEHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  589



>ref|NP_001049811.1| Os03g0293500 [Oryza sativa Japonica Group]
 sp|Q10MW3.1|PDC2_ORYSJ RecName: Full=Pyruvate decarboxylase 2; Short=PDC [Oryza sativa 
Japonica Group]
 gb|ABF95411.1| Pyruvate decarboxylase isozyme 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11725.1| Os03g0293500 [Oryza sativa Japonica Group]
 gb|ACA50507.1| pyruvate decarboxylase isozyme 2 [Oryza sativa Japonica Group]
 dbj|BAG95142.1| unnamed protein product [Oryza sativa Japonica Group]
Length=605

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGA LGYAQ   +KRVI+CIGDGSFQVTAQDVSTM+RC Q  I
Sbjct  445  EGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMIRCAQNSI  504

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT+KV  EEEL EAI  A
Sbjct  505  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTSKVKCEEELTEAIGMA  564

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
             G +KDCLCFIEVI HKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  565  LG-EKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ  605



>ref|XP_007026635.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
 gb|EOY07137.1| Thiamine pyrophosphate dependent pyruvate decarboxylase family 
protein [Theobroma cacao]
Length=614

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 9/171 (5%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQ---------VTAQDVST  548
            +GCGYEFQMQYGSIGWSVGATLGYAQA PEKR+I+CIGDGSFQ         VTAQDVST
Sbjct  444  RGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRIIACIGDGSFQIPAVIFCPVVTAQDVST  503

Query  547  MLRCGQRPIIFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEE  368
            MLRCGQ  IIFLINNGGYT+EV+IHDGPYNVIKNW+Y A +DAIHNGEG CWT KVF EE
Sbjct  504  MLRCGQNTIIFLINNGGYTVEVQIHDGPYNVIKNWDYAALVDAIHNGEGNCWTTKVFCEE  563

Query  367  ELVEAIETATGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            EL+EAI+ A GAKKDCLCFIEVIVHKDDTSK++LE+G+RVS  NSRPPN Q
Sbjct  564  ELIEAIDMAIGAKKDCLCFIEVIVHKDDTSKDVLEFGTRVSIVNSRPPNSQ  614



>ref|XP_009801931.1| PREDICTED: pyruvate decarboxylase 1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009801932.1| PREDICTED: pyruvate decarboxylase 1 isoform X2 [Nicotiana sylvestris]
Length=578

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CG+EFQMQYGSIGWSVGATLGYAQA  +KR+I+CIGDGSFQVTAQD+STM+RC Q+ I
Sbjct  417  ENCGFEFQMQYGSIGWSVGATLGYAQAAKDKRIIACIGDGSFQVTAQDISTMIRCAQKSI  476

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  EE+L EAI TA
Sbjct  477  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVKTEEDLTEAIATA  536

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T   KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  537  TSTHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  578



>ref|XP_010543216.1| PREDICTED: pyruvate decarboxylase 1 [Tarenaya hassleriana]
Length=604

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            +GCGYEFQMQYGSIGWSVGATLGYAQA+PEKRV++ IGDGSFQVTAQD+STM+R GQ+ I
Sbjct  443  KGCGYEFQMQYGSIGWSVGATLGYAQASPEKRVLAFIGDGSFQVTAQDISTMIRNGQKSI  502

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNG+GKCWT KV  EEEL EAIETA
Sbjct  503  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGQGKCWTTKVRCEEELEEAIETA  562

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  563  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  604



>ref|XP_004232952.1| PREDICTED: pyruvate decarboxylase 1 [Solanum lycopersicum]
Length=587

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CG+EFQMQYGSIGWSVGATLGYAQA  +KR+I+CIGDGSFQVTAQD+STM+RC Q+ I
Sbjct  426  ENCGFEFQMQYGSIGWSVGATLGYAQAAKDKRIIACIGDGSFQVTAQDISTMIRCAQKNI  485

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  EE+L EAI TA
Sbjct  486  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVKTEEDLTEAIATA  545

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            T   KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  546  TSTHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  587



>ref|XP_008225205.1| PREDICTED: pyruvate decarboxylase 1 [Prunus mume]
Length=573

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQ   +KRVI+ IGDGSFQVTAQD+STM+RCGQ  I
Sbjct  412  ENCGYEFQMQYGSIGWSVGATLGYAQGAKDKRVIAFIGDGSFQVTAQDISTMIRCGQNTI  471

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EE+L EAI  A
Sbjct  472  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRTEEDLTEAIAKA  531

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  532  TGEHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  573



>ref|XP_007213938.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
 gb|EMJ15137.1| hypothetical protein PRUPE_ppa003458mg [Prunus persica]
Length=573

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQ   +KRVI+ IGDGSFQVTAQD+STM+RCGQ  I
Sbjct  412  ENCGYEFQMQYGSIGWSVGATLGYAQGAKDKRVIAFIGDGSFQVTAQDISTMIRCGQNTI  471

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNWNYT  +DAIHNGEGKCWT KV  EE+L EAI  A
Sbjct  472  IFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRTEEDLTEAIAKA  531

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG  KD LCFIEV VHKDDTSKELLEWGSRVSAANSRPPNPQ
Sbjct  532  TGEHKDSLCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNPQ  573



>ref|XP_011027712.1| PREDICTED: pyruvate decarboxylase 1-like [Populus euphratica]
Length=593

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA  +KRVI+CIGDGSFQVTAQD+STM+RCGQR I
Sbjct  432  ENCGYEFQMQYGSIGWSVGATLGYAQAARDKRVIACIGDGSFQVTAQDISTMIRCGQRTI  491

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+YT  ++AIHNGEGKCWTAKV  E+EL  AI T 
Sbjct  492  IFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVNAIHNGEGKCWTAKVRTEDELTAAIATV  551

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +KD LCFIE+ VHKDDTSKELLEWGSRVS ANSRPP PQ
Sbjct  552  TGEQKDSLCFIEIFVHKDDTSKELLEWGSRVSDANSRPPKPQ  593



>gb|AIE47263.1| pyruvate decarboxylase [Hevea brasiliensis]
Length=589

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  700  QGCGYEFQMQYGSIGWSVGATLGYAQATPEKRVISCIGDGSFQVTAQDVSTMLRCGQRPI  521
            + CGYEFQMQYGSIGWSVGATLGYAQA   KRVI+CIGDGSFQVTAQ++STM+R GQ+ I
Sbjct  428  ENCGYEFQMQYGSIGWSVGATLGYAQAARNKRVIACIGDGSFQVTAQEISTMIRSGQKSI  487

Query  520  IFLINNGGYTIEVEIHDGPYNVIKNWNYTAFMDAIHNGEGKCWTAKVFYEEELVEAIETA  341
            IFLINNGGYTIEVEIHDGPYNVIKNW+Y  F++AIHNGEGKCWTAKV  E+EL EAI TA
Sbjct  488  IFLINNGGYTIEVEIHDGPYNVIKNWDYAGFVNAIHNGEGKCWTAKVRTEDELTEAIATA  547

Query  340  TGAKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ  215
            TG +K+ LCFIEV+VHKDDTSKELLEWGSRVS+ANSRPPNPQ
Sbjct  548  TGEQKNSLCFIEVLVHKDDTSKELLEWGSRVSSANSRPPNPQ  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320