BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF016A10

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB65927.1|  cinnamate 4-hydroxylase                                 348   7e-114   Ipomoea batatas [batate]
gb|AHJ60265.1|  cinnamate 4-monooxygenase                               330   4e-107   Ipomoea purpurea
gb|ADX33333.1|  cinnamate-4-hydroxylase 2                               330   5e-107   Petunia x hybrida [garden petunia]
gb|ABQ53544.1|  cinnamic acid 4-hydroxylase                             318   3e-106   Arachis diogoi
ref|XP_009607087.1|  PREDICTED: trans-cinnamate 4-monooxygenase         327   9e-106   Nicotiana tomentosiformis
gb|ADX33332.1|  cinnamate-4-hydroxylase 1                               327   1e-105   Petunia x hybrida [garden petunia]
ref|XP_009798122.1|  PREDICTED: trans-cinnamate 4-monooxygenase         326   4e-105   Nicotiana sylvestris
gb|ADO16243.1|  cinnamate 4-hydroxylase                                 325   5e-105   Ocimum tenuiflorum [holy basil]
gb|AEM63593.1|  cinnamate 4-hydroxylase                                 325   7e-105   Leucaena leucocephala [cassie]
gb|ACF19421.1|  candidate cinnamic acid 4-hydroxylase                   325   9e-105   Capsicum annuum
ref|XP_010253046.1|  PREDICTED: trans-cinnamate 4-monooxygenase         325   9e-105   Nelumbo nucifera [Indian lotus]
gb|ABD77493.2|  cinnamic acid 4-hydroxylase                             324   1e-104   Arnebia euchroma
dbj|BAB71716.1|  cinnamic acid 4-hydroxylase                            324   1e-104   Lithospermum erythrorhizon
ref|XP_010252045.1|  PREDICTED: trans-cinnamate 4-monooxygenase         324   1e-104   Nelumbo nucifera [Indian lotus]
gb|ABC69413.1|  CYP73A47v2                                              324   1e-104   Nicotiana tabacum [American tobacco]
emb|CAP08847.1|  cinnamate-4-hydroxylase                                314   2e-104   Arabidopsis lyrata [lyrate rockcress]
gb|ADO16244.1|  cinnamate 4-hydroxylase                                 323   3e-104   Ocimum basilicum [basil]
gb|AEM63594.1|  cinnamate 4-hydroxylase                                 323   4e-104   Leucaena leucocephala [cassie]
ref|XP_009766429.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    323   6e-104   Nicotiana sylvestris
gb|EYU46023.1|  hypothetical protein MIMGU_mgv1a004904mg                322   7e-104   Erythranthe guttata [common monkey flower]
ref|XP_009601847.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    322   8e-104   Nicotiana tomentosiformis
gb|AIY32618.1|  cinnamate-4-hydroxylase                                 322   1e-103   Perilla frutescens [beefsteak-mint]
gb|ABC69046.1|  cinnamic acid 4-hydroxylase                             322   2e-103   Solanum tuberosum [potatoes]
ref|XP_011080651.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    321   2e-103   Sesamum indicum [beniseed]
gb|KJB83924.1|  hypothetical protein B456_013G271700                    321   2e-103   Gossypium raimondii
gb|ACH56520.1|  cinnamate-4-hydroxylase                                 321   3e-103   Gossypium hirsutum [American cotton]
gb|ACZ54906.1|  cinnamate 4-hydroxylase                                 321   3e-103   Leucaena leucocephala [cassie]
gb|AAG10196.1|AF286647_1  cinnamate-4-hydroxylase                       321   3e-103   Gossypium arboreum [tree cotton]
ref|XP_002523952.1|  cinnamate 4-hydroxylase, putative                  321   3e-103   Ricinus communis
gb|ACR10242.1|  cinnamate-4-hydroxylase                                 320   4e-103   Canarium album [Chinese white-olive]
gb|AGH32777.1|  cinnamic acid 4-hydroxylase                             320   4e-103   Camellia chekiangoleosa
gb|AID51447.1|  cinnamate 4-hydroxylase 2                               320   5e-103   Astragalus membranaceus
ref|XP_006350887.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    321   5e-103   Solanum tuberosum [potatoes]
gb|ACZ06240.1|  cinnamate 4-hydroxylase 2                               320   6e-103   Gossypium hirsutum [American cotton]
ref|XP_011089532.1|  PREDICTED: trans-cinnamate 4-monooxygenase         320   7e-103   Sesamum indicum [beniseed]
pir||PC4237  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - ...    318   7e-103
ref|XP_006432069.1|  hypothetical protein CICLE_v10000921mg             320   9e-103   Citrus clementina [clementine]
gb|AGX85600.1|  coumarate 4-hydroxylase                                 319   1e-102   Scoparia dulcis [escobilla]
gb|ABF69099.1|  trans-cinnamate 4-hydroxylase                           319   2e-102   Populus tremuloides
gb|AGJ84133.1|  putative trans-cinnamate 4-hydroxylase                  319   2e-102   Hibiscus cannabinus [bimli-jute]
gb|ABF69100.1|  trans-cinnamate 4-hydroxylase                           319   2e-102   Populus tremuloides
ref|XP_007017089.1|  Cinnamate-4-hydroxylase                            318   2e-102   Theobroma cacao [chocolate]
ref|XP_002325638.1|  trans-cinnamate 4-monooxygenase family protein     318   4e-102   Populus trichocarpa [western balsam poplar]
gb|AAG10197.1|  cinnamate-4-hydroxylase                                 318   4e-102   Gossypium arboreum [tree cotton]
ref|NP_001275824.1|  cinnamate 4-hydroxylase CYP73                      318   4e-102   Citrus sinensis [apfelsine]
ref|XP_011015228.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    318   4e-102   Populus euphratica
gb|KJB72975.1|  hypothetical protein B456_011G207000                    318   4e-102   Gossypium raimondii
ref|XP_008456253.1|  PREDICTED: trans-cinnamate 4-monooxygenase         318   4e-102   Cucumis melo [Oriental melon]
sp|Q96423.1|TCMO_GLYEC  RecName: Full=Trans-cinnamate 4-monooxyge...    318   4e-102   Glycyrrhiza echinata [hedgehog licorice]
ref|XP_011041784.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    318   4e-102   Populus euphratica
ref|XP_010938024.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    318   5e-102   Elaeis guineensis
gb|AAG43824.1|AF212318_1  cinnamic acid 4-hydroxylase                   318   5e-102   Capsicum annuum
ref|XP_002881114.1|  cinnamate-4-hydroxylase                            317   8e-102   
ref|XP_009403855.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    313   9e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEV93475.1|  4-coumarate:CoA ligase                                  317   1e-101   Caragana korshinskii
ref|XP_007205045.1|  hypothetical protein PRUPE_ppa004544mg             317   1e-101   Prunus persica
ref|XP_007011365.1|  Cinnamate-4-hydroxylase                            316   1e-101   
gb|KDP45711.1|  hypothetical protein JCGZ_17318                         316   2e-101   Jatropha curcas
ref|XP_008240713.1|  PREDICTED: trans-cinnamate 4-monooxygenase         316   2e-101   Prunus mume [ume]
gb|ADZ54778.1|  trans-cinnamate 4-monooxygenase                         316   2e-101   Prunus avium [gean]
ref|XP_008657127.1|  PREDICTED: trans-cinnamate 4-monooxygenase         316   2e-101   Zea mays [maize]
gb|ADD54647.1|  cinnamate 4-hydroxylase                                 307   3e-101   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004970385.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    315   3e-101   
gb|AFN44010.1|  cinnamate 4-hydroxylase                                 315   3e-101   Neolamarckia cadamba
ref|XP_010685980.1|  PREDICTED: trans-cinnamate 4-monooxygenase         315   4e-101   Beta vulgaris subsp. vulgaris [field beet]
gb|AAT68775.2|  trans-cinnamate 4-hydroxylase                           311   4e-101   Camellia sinensis [black tea]
emb|CDP04040.1|  unnamed protein product                                309   4e-101   Coffea canephora [robusta coffee]
gb|ADN32769.1|  cinnamate 4-hydroxylase                                 315   5e-101   Scutellaria baicalensis [Baikal skullcap]
emb|CDX84829.1|  BnaA03g14010D                                          315   5e-101   
gb|ADG43134.1|  cinnamate 4-hydroxylase                                 315   5e-101   Isatis tinctoria [woad]
emb|CDY23995.1|  BnaC03g16960D                                          315   6e-101   Brassica napus [oilseed rape]
emb|CAP08829.1|  cinnamate-4-hydroxylase                                315   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAC99993.1|  cinnamate 4-hydroxylase                                 315   7e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08828.1|  cinnamate-4-hydroxylase                                315   7e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAB58355.1|  cinnamate-4-hydroxylase                                 315   8e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08846.1|  cinnamate-4-hydroxylase                                314   8e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ABF17875.1|  cinnamate 4-hydroxylase isoform 2                       315   8e-101   Brassica napus [oilseed rape]
gb|AID16078.1|  cinnamate 4-hydroxylase                                 315   8e-101   Morus alba
emb|CAP08827.1|  cinnamate-4-hydroxylase                                314   9e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180607.1|  trans-cinnamate 4-monooxygenase                       314   9e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410152.1|  hypothetical protein EUTSA_v10016545mg             314   1e-100   Eutrema salsugineum [saltwater cress]
gb|AFY17065.1|  cinnamate 4-hydroxylase 2                               314   1e-100   Panicum virgatum
gb|AAC35857.1|  cinnamic acid 4-hydroxylase                             313   1e-100   Capsicum chinense [bonnet pepper]
gb|AGJ71350.1|  cinnamate 4-hydroxylase 1                               314   1e-100   Eucalyptus urophylla
dbj|BAB71717.1|  cinnamic acid 4-hydroxylase                            314   1e-100   Lithospermum erythrorhizon
ref|XP_010510361.1|  PREDICTED: trans-cinnamate 4-monooxygenase         314   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010103664.1|  Trans-cinnamate 4-monooxygenase                    314   2e-100   Morus notabilis
sp|P48522.1|TCMO_CATRO  RecName: Full=Trans-cinnamate 4-monooxyge...    313   2e-100   Catharanthus roseus [chatas]
ref|XP_009132739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    313   2e-100   Brassica rapa
gb|AHL83550.1|  C4H                                                     313   3e-100   Morus alba var. multicaulis
gb|AEA02458.1|  cinnamate 4-hydroxylase                                 313   3e-100   Prunus armeniaca
ref|XP_010094425.1|  Trans-cinnamate 4-monooxygenase                    313   3e-100   Morus notabilis
gb|AHG06398.1|  cinnamic acid 4-hydroxylase                             313   3e-100   Ornithogalum longebracteatum [sea-onion]
gb|AGG55322.1|  cinnamate 4-hydroxylase                                 313   3e-100   Paeonia lactiflora [common garden peony]
gb|AGN70893.1|  cinammate 4-hydroxylase                                 313   3e-100   Dendrobium officinale
ref|XP_010414263.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    313   3e-100   Camelina sativa [gold-of-pleasure]
gb|AEA02459.1|  cinnamate 4-hydroxylase                                 313   3e-100   Prunus cerasifera x Prunus munsoniana
gb|ABF69101.1|  trans-cinnamate 4-hydroxylase                           313   3e-100   Populus tremuloides
dbj|BAE72875.1|  Cinnamic acid 4-hydroxylase                            313   4e-100   Glandularia x hybrida [garden verbena]
sp|O24312.1|TCMO_POPTM  RecName: Full=Trans-cinnamate 4-monooxyge...    313   4e-100   Populus tremuloides
ref|XP_009354868.1|  PREDICTED: trans-cinnamate 4-monooxygenase         313   4e-100   Pyrus x bretschneideri [bai li]
ref|XP_004294725.1|  PREDICTED: trans-cinnamate 4-monooxygenase         313   4e-100   Fragaria vesca subsp. vesca
gb|ABF69102.1|  trans-cinnamate 4-hydroxylase                           313   4e-100   Populus tremuloides
ref|XP_011021057.1|  PREDICTED: trans-cinnamate 4-monooxygenase         313   4e-100   Populus euphratica
gb|KHN40993.1|  Trans-cinnamate 4-monooxygenase                         310   4e-100   Glycine soja [wild soybean]
gb|AIT52342.1|  cinammate 4-hydroxylase 1                               313   5e-100   Daucus carota [carrots]
gb|AFZ78542.1|  cinnamate 4-hydroxylase                                 312   5e-100   Populus tomentosa [Chinese white poplar]
ref|XP_010032943.1|  PREDICTED: trans-cinnamate 4-monooxygenase         312   5e-100   Eucalyptus grandis [rose gum]
gb|ABF17873.1|  cinnamate 4-hydroxylase isoform 1                       312   6e-100   Brassica napus [oilseed rape]
ref|XP_008810838.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    312   6e-100   Phoenix dactylifera
gb|KHN30609.1|  Trans-cinnamate 4-monooxygenase                         310   6e-100   Glycine soja [wild soybean]
sp|Q43054.1|TCMO_POPKI  RecName: Full=Trans-cinnamate 4-monooxyge...    312   6e-100   Populus sieboldii x Populus grandidentata
ref|XP_002458683.1|  hypothetical protein SORBIDRAFT_03g038160          312   6e-100   Sorghum bicolor [broomcorn]
gb|ACM17896.1|  cinnamate-4-hydroxylase                                 312   6e-100   Rubus occidentalis [black raspberry]
gb|AAG50231.1|AF302495_1  cinnamate 4-hydroxylase                       312   6e-100   Populus trichocarpa x Populus deltoides
ref|XP_003616037.1|  Trans-cinnamate 4-monooxygenase                    312   7e-100   Medicago truncatula
sp|Q43067.2|TCMO_PEA  RecName: Full=Trans-cinnamate 4-monooxygena...    312   7e-100   Pisum sativum [garden pea]
gb|ACC63873.1|  trans-cinnamate 4-hydroxylase                           312   7e-100   Populus trichocarpa [western balsam poplar]
ref|XP_002319974.1|  hypothetical protein POPTR_0013s15380g             312   7e-100   Populus trichocarpa [western balsam poplar]
gb|AAC49187.2|  trans-cinnamic acid hydroxylase                         312   8e-100   Pisum sativum [garden pea]
ref|XP_010921158.1|  PREDICTED: trans-cinnamate 4-monooxygenase         312   9e-100   Elaeis guineensis
sp|P37115.1|TCMO_VIGRR  RecName: Full=Trans-cinnamate 4-monooxyge...    311   1e-99    Vigna radiata var. radiata [golden gram]
gb|KHG02507.1|  Cytochrome P450 protein                                 312   1e-99    Gossypium arboreum [tree cotton]
dbj|BAA24355.1|  trans-cinnamate 4-hydroxylase                          311   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AGE10592.1|  cinnamate 4-hydroxylase                                 311   1e-99    Lonicera japonica [Japanese honeysuckle]
gb|AGC29944.1|  CYP73A107                                               311   1e-99    Sinopodophyllum hexandrum [Himalayan mayapple]
dbj|BAI77480.1|  cinnamate-4-hydroxylase                                311   1e-99    Brassica rapa
ref|XP_009141068.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    311   1e-99    Brassica rapa
emb|CAK95273.1|  cinnamate-4-hydroxylase                                311   1e-99    Cucumis sativus [cucumbers]
emb|CDP19477.1|  unnamed protein product                                311   2e-99    Coffea canephora [robusta coffee]
gb|KGN46762.1|  hypothetical protein Csa_6G133710                       307   2e-99    Cucumis sativus [cucumbers]
emb|CDX97826.1|  BnaC04g41130D                                          311   2e-99    
dbj|BAF81522.1|  cinnamate-4-hydroxylase                                311   2e-99    Brassica rapa
gb|ACE95171.1|  cinnamate-4-hydroxylase                                 311   2e-99    Populus tomentosa [Chinese white poplar]
gb|AJD25173.1|  cytochrome P450 CYP73A120                               310   3e-99    Salvia miltiorrhiza [Chinese salvia]
gb|AHB52741.1|  cinnamate 4-hydroxylase                                 310   3e-99    Pyrus x bretschneideri [bai li]
ref|XP_004154553.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    310   3e-99    
ref|NP_001237317.1|  trans-cinnamate 4-monooxygenase                    310   3e-99    Glycine max [soybeans]
gb|ABN48717.1|  cinnamate 4-hydroxylase                                 310   3e-99    Salvia miltiorrhiza [Chinese salvia]
gb|AEK94316.1|  cinnamic acid 4-hydroxylase-like protein                310   3e-99    Pyrus x bretschneideri [bai li]
ref|XP_006294053.1|  hypothetical protein CARUB_v10023044mg             310   3e-99    Capsella rubella
gb|ADT63059.1|  cinnamate 4-hydroxylase                                 306   3e-99    Fagopyrum esculentum
ref|XP_008792249.1|  PREDICTED: trans-cinnamate 4-monooxygenase         310   4e-99    Phoenix dactylifera
gb|AEH68208.1|  cinnamate 4-hydroxylase                                 310   4e-99    Astragalus mongholicus
gb|ACZ73612.1|  cinnamate 4-hydroxylase                                 310   4e-99    Bambusa oldhamii
gb|EMT08179.1|  Trans-cinnamate 4-monooxygenase                         308   5e-99    
ref|XP_007146898.1|  hypothetical protein PHAVU_006G079700g             310   5e-99    Phaseolus vulgaris [French bean]
ref|XP_003564495.1|  PREDICTED: trans-cinnamate 4-monooxygenase         310   5e-99    Brachypodium distachyon [annual false brome]
gb|ABC75596.1|  cinnamate 4-hydroxylase                                 310   6e-99    Salvia miltiorrhiza [Chinese salvia]
gb|EPS68507.1|  cinnamate-4-hydroxylase 1                               307   6e-99    Genlisea aurea
ref|XP_004500376.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    310   6e-99    Cicer arietinum [garbanzo]
gb|AAU09021.1|  Cinnamic acid 4-hydroxylase                             310   6e-99    Agastache rugosa
gb|ACB78015.1|  cinnamic acid 4-hydroxylase                             310   6e-99    Trifolium pratense [peavine clover]
gb|AAS48416.1|  cinammate 4-hydroxylase                                 310   6e-99    Allium cepa
ref|NP_001288861.1|  trans-cinnamate 4-monooxygenase                    310   6e-99    Brassica rapa
gb|AFP49808.1|  cinnamate 4-hydroxylase 4                               310   7e-99    Coffea arabica [arabica coffee]
gb|AFD36436.1|  cinnamate 4-hydroxylase 1                               310   7e-99    Astragalus membranaceus
gb|AGP25594.1|  cinnamate 4-hydroxylase                                 310   7e-99    Aquilaria sinensis
gb|ACR44227.1|  C4H                                                     310   7e-99    Glycine max [soybeans]
ref|XP_003544934.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    309   8e-99    Glycine max [soybeans]
gb|ABX74779.1|  cinnamate-4-hydroxylase                                 309   9e-99    Rubus coreanus [cha tian pao]
gb|AIB06733.1|  cinnamate 4-mono-oxygenase                              309   9e-99    Mangifera indica
gb|ABX74781.1|  cinnamate-4-hydroxylase                                 309   1e-98    Rubus sp. SSL-2007
ref|NP_001281035.1|  trans-cinnamate 4-monooxygenase                    309   1e-98    Malus domestica [apple tree]
gb|AFV47361.1|  C4H                                                     309   1e-98    Helichrysum aureonitens
gb|ACB78016.1|  cinnamic acid 4-hydroxylase                             309   1e-98    Trifolium pratense [peavine clover]
gb|KFK22945.1|  hypothetical protein AALP_AAs47561U000100               309   1e-98    Arabis alpina [alpine rockcress]
ref|XP_004139932.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    309   1e-98    
ref|NP_001266151.1|  trans-cinnamate 4-monooxygenase                    308   2e-98    
gb|AIS92509.1|  cinnamate 4-hydroxylase                                 308   2e-98    Epimedium sagittatum
gb|ACB78014.1|  cinnamic acid 4-hydroxylase                             308   2e-98    Trifolium pratense [peavine clover]
ref|XP_010922761.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    308   2e-98    Elaeis guineensis
prf||2209439A  cytochrome P450 monooxygenase                            308   3e-98 
gb|AEM63672.1|  cinnamate 4-hydroxylase                                 308   4e-98    Platycodon grandiflorus [balloon-flower]
gb|AFG30055.1|  cinnamate-4-hydroxylase                                 308   4e-98    Malus hybrid cultivar
gb|ACJ37399.1|  trans-cinnamate 4-monooxygenase                         308   4e-98    Echinacea angustifolia [black sampson]
ref|XP_007142041.1|  hypothetical protein PHAVU_008G247400g             308   4e-98    Phaseolus vulgaris [French bean]
ref|XP_008363432.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    299   4e-98    
gb|ABA59555.1|  cinnamate-4-hydroxylase                                 307   5e-98    Parthenocissus henryana
emb|CDX84830.1|  BnaA03g14000D                                          307   5e-98    
sp|Q43240.1|TCMO_ZINVI  RecName: Full=Trans-cinnamate 4-monooxyge...    307   5e-98    Zinnia elegans [garden zinnia]
dbj|BAJ95120.1|  predicted protein                                      307   5e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9AR74.1|TCMO_RUTGR  RecName: Full=Trans-cinnamate 4-monooxyge...    307   6e-98    Ruta graveolens
gb|AAN63028.1|  cinnamate 4-hydroxylase                                 307   6e-98    Ruta graveolens
gb|AHA84274.1|  trans-cinnamate 4-monooxygenase                         307   7e-98    Phaseolus vulgaris [French bean]
gb|AAG09206.1|AF175276_1  trans-cinnamic acid hydroxylase               301   1e-97    Pisum sativum [garden pea]
gb|AFD29887.1|  cinnamate 4-hydroxylase                                 306   1e-97    Bambusa emeiensis
ref|XP_008782669.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    306   1e-97    Phoenix dactylifera
ref|XP_009421412.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    306   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACM69364.1|  cinnamic acid 4-hydroxylase                             306   1e-97    Humulus lupulus [common hop]
gb|AHY94893.1|  cinnamate-4-hydroxylase                                 306   2e-97    Prunella vulgaris
ref|XP_009421411.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    306   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842509.1|  hypothetical protein AMTR_s00077p00107120          305   2e-97    Amborella trichopoda
ref|XP_009410039.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    305   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABE68874.1|  cinnamate 4-hydroxylase                                 305   4e-97    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009374388.1|  PREDICTED: trans-cinnamate 4-monooxygenase         306   4e-97    Pyrus x bretschneideri [bai li]
gb|AAT39513.1|  cinnamate-4-hydroxylase                                 305   4e-97    Camptotheca acuminata
sp|Q04468.1|TCMO_HELTU  RecName: Full=Trans-cinnamate 4-monooxyge...    305   4e-97    Helianthus tuberosus [Jerusalem artichoke]
gb|AGU91429.1|  trans-cinnamate 4-monooxygenase                         305   5e-97    Chrysanthemum boreale
ref|XP_010542699.1|  PREDICTED: trans-cinnamate 4-monooxygenase         305   6e-97    Tarenaya hassleriana [spider flower]
gb|ADO16181.1|  cytochrome P450 mono-oxygenase                          305   6e-97    Artemisia annua [sweet Annie]
gb|ACF74449.1|  trans-cinnamate 4-monooxygenase                         304   7e-97    Echinacea angustifolia [black sampson]
ref|XP_008788521.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    304   8e-97    Phoenix dactylifera
emb|CBI15809.3|  unnamed protein product                                303   1e-96    Vitis vinifera
ref|XP_010931381.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    304   1e-96    
gb|AHJ61295.1|  cinnamate-4-hydroxylase                                 304   1e-96    Hordeum vulgare [barley]
ref|XP_002266238.1|  PREDICTED: trans-cinnamate 4-monooxygenase         303   1e-96    Vitis vinifera
ref|XP_010522015.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    303   1e-96    Tarenaya hassleriana [spider flower]
gb|ACY78690.1|  trans-cinnamate 4-monooxygenase                         303   2e-96    Cynara cardunculus var. scolymus [artichoke]
ref|XP_009354880.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    303   2e-96    Pyrus x bretschneideri [bai li]
gb|AHG97392.1|  C4H catalytic cinnamic acid-4-hydroxylase               303   3e-96    Ageratina adenophora
gb|EYU36901.1|  hypothetical protein MIMGU_mgv1a004876mg                302   4e-96    Erythranthe guttata [common monkey flower]
gb|AAG09205.1|AF175275_1  trans-cinnamic acid hydroxylase               302   6e-96    Pisum sativum [garden pea]
gb|ABR18390.1|  unknown                                                 293   6e-96    Picea sitchensis
gb|AGO03798.1|  cytochrome P450-like protein                            301   7e-96    Tanacetum cinerariifolium [pyrethrum]
sp|P37114.1|TCMO_MEDSA  RecName: Full=Trans-cinnamate 4-monooxyge...    301   9e-96    Medicago sativa [alfalfa]
gb|EMS54616.1|  Trans-cinnamate 4-monooxygenase                         299   9e-96    Triticum urartu
ref|XP_006410151.1|  hypothetical protein EUTSA_v10016544mg             301   9e-96    Eutrema salsugineum [saltwater cress]
dbj|BAJ17666.1|  cinnamate 4-hydroxylase                                301   1e-95    Gynura bicolor
ref|XP_009132738.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    301   2e-95    Brassica rapa
sp|Q43033.1|TCMO_PETCR  RecName: Full=Trans-cinnamate 4-monooxyge...    300   2e-95    Petroselinum crispum
gb|AAG09207.1|AF175277_1  trans-cinnamic acid hydroxylase               295   2e-95    Pisum sativum [garden pea]
gb|AAO62904.1|  cinnamate 4-hydroxylase                                 299   9e-95    Ammi majus [ameo mayor]
gb|AEA72281.1|  cinnamate 4-hydroxylase                                 298   2e-94    Angelica gigas
gb|AJD22263.1|  cinnamate 4-hydroxylase                                 297   4e-94    Angelica dahurica
gb|ACY06865.2|  cinnamate 4-hydroxylase                                 296   7e-94    Astragalus chrysochlorus
gb|AID69233.1|  cinnamate 4-hydroxylase                                 296   8e-94    Garcinia mangostana [mangosteen]
gb|AEN19718.1|  cinnamate 4-hydroxylase                                 296   1e-93    Acacia auriculiformis x Acacia mangium
gb|ABX75854.1|  cinnamate 4-hydroxylase                                 296   1e-93    Acacia auriculiformis x Acacia mangium
gb|AFU54390.1|  cinnamate 4-hydroxylase                                 295   2e-93    Fagopyrum tataricum [Kangra buckwheat]
gb|AFP89925.1|  cinnamate 4-hydroxylase                                 283   1e-92    Neolamarckia cadamba
gb|ABF58026.1|  cinnamate-4-hydroxylate-like                            291   2e-92    Hibiscus cannabinus [bimli-jute]
emb|CDP18607.1|  unnamed protein product                                284   2e-92    Coffea canephora [robusta coffee]
gb|AAW70021.1|  cinnamic acid 4-hydroxylase                             292   3e-92    Ginkgo biloba [ginkgo]
gb|AFX98061.1|  cinnamate 4-hydroxylase                                 292   3e-92    Cunninghamia lanceolata [China fir]
gb|AFP89917.1|  cinnamate 4-hydroxylase                                 281   3e-92    Neolamarckia cadamba
emb|CDY29671.1|  BnaA04g17560D                                          290   2e-91    Brassica napus [oilseed rape]
ref|XP_009141067.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    290   3e-91    Brassica rapa
gb|ACN40359.1|  unknown                                                 290   3e-91    Picea sitchensis
gb|AIT52343.1|  cinammate 4-hydroxylase 2                               283   4e-91    Daucus carota [carrots]
gb|AHY28686.1|  cinnamate 4-hydroxylase 1                               279   5e-91    Pinus echinata [shortleaf pine]
gb|AFP89924.1|  cinnamate 4-hydroxylase                                 278   5e-91    Neolamarckia cadamba
ref|XP_009354901.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    288   1e-90    
gb|AIE16481.1|  cinnamate 4-hydroxylase                                 275   7e-90    Glycine max [soybeans]
ref|XP_004151467.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    286   7e-90    Cucumis sativus [cucumbers]
ref|XP_008457287.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    285   2e-89    Cucumis melo [Oriental melon]
emb|CDX97827.1|  BnaC04g41120D                                          285   2e-89    
gb|AAD23378.1|AF096998_1  trans-cinnamate 4-hydroxylase                 284   4e-89    Pinus taeda
emb|CAK95274.1|  cinnamate-4-hydroxylase                                273   1e-88    Cucumis melo [Oriental melon]
gb|AHF20175.1|  cinnamate 4-hydroxylase                                 278   6e-88    Musa acuminata AAA Group [Cavendish banana]
dbj|BAJ96982.1|  predicted protein                                      281   6e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009416323.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    281   7e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32263.1|  Trans-cinnamate 4-monooxygenase                         280   2e-87    
emb|CDM82046.1|  unnamed protein product                                277   2e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003568699.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    277   3e-86    Brachypodium distachyon [annual false brome]
gb|AAG17469.1|AF123610_8  cytochrome P450                               276   3e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002461939.1|  hypothetical protein SORBIDRAFT_02g010910          276   7e-86    Sorghum bicolor [broomcorn]
gb|EMT12860.1|  Trans-cinnamate 4-monooxygenase                         273   7e-85    
ref|XP_011089530.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    273   1e-84    Sesamum indicum [beniseed]
gb|AIE16514.1|  cinnamate 4-hydroxylase                                 262   1e-84    Glycine max [soybeans]
dbj|BAK03000.1|  predicted protein                                      272   2e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFY17064.1|  cinnamate 4-hydroxylase 1                               272   2e-84    Panicum virgatum
ref|NP_001149158.1|  trans-cinnamate 4-monooxygenase                    271   3e-84    
ref|NP_001140726.1|  putative cytochrome P450 superfamily protein       270   9e-84    Zea mays [maize]
gb|EYU36902.1|  hypothetical protein MIMGU_mgv1a004808mg                270   1e-83    Erythranthe guttata [common monkey flower]
gb|EAY97535.1|  hypothetical protein OsI_19463                          269   2e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001055190.1|  Os05g0320700                                       269   3e-83    
ref|XP_006654260.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    269   3e-83    Oryza brachyantha
gb|ACM47732.1|  cinnamate 4-hydroxylase                                 262   6e-83    Polypodium aureum
gb|EYU36905.1|  hypothetical protein MIMGU_mgv1a004883mg                268   1e-82    Erythranthe guttata [common monkey flower]
ref|NP_001140681.1|  putative cytochrome P450 superfamily protein       266   6e-82    Zea mays [maize]
ref|XP_011089529.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    266   6e-82    Sesamum indicum [beniseed]
gb|AER39775.1|  CYP73A91                                                264   2e-81    Festuca rubra subsp. commutata
gb|AER39776.1|  CYP73A91-2                                              263   8e-81    Festuca rubra subsp. commutata
ref|XP_011089531.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    263   9e-81    
gb|AER39778.1|  CYP73A91-4                                              262   1e-80    Festuca rubra subsp. commutata
gb|AER39777.1|  CYP73A91-3                                              262   2e-80    Festuca rubra subsp. commutata
gb|AGW27201.1|  cinnamate 4-hydroxylase 2                               258   2e-80    Salvia miltiorrhiza [Chinese salvia]
gb|AHI17493.2|  cinnamate 4-hydroxylase                                 262   2e-80    Dryopteris fragrans
ref|XP_001773868.1|  predicted protein                                  260   6e-80    
ref|XP_002980756.1|  trans-cinnamate 4-hydroxylase                      261   8e-80    
ref|XP_002977018.1|  trans-cinnamate 4-hydroxylase                      259   3e-79    
gb|ADF28536.1|  cinnamate 4-hydroxylase                                 258   1e-78    
gb|EYU36906.1|  hypothetical protein MIMGU_mgv1a025595mg                257   1e-78    
gb|EAY76296.1|  hypothetical protein OsI_04230                          255   4e-78    
gb|EPS58735.1|  cinnamate 4-hydroxylase                                 255   6e-78    
gb|ABV80353.1|  cytochrome P450-dependent monooxygenase                 254   2e-77    
gb|EAZ35606.1|  hypothetical protein OsJ_19896                          253   3e-77    
gb|ADF28535.1|  cinnamate 4-hydroxylase                                 252   2e-76    
ref|XP_001781223.1|  predicted protein                                  251   2e-76    
gb|AHY28705.1|  trans-cinnamate 4-hydroxylase 2                         240   4e-76    
gb|ADO24190.1|  cinnamate 4-hydroxylase                                 250   8e-76    
gb|AHY28711.1|  trans-cinnamate 4-hydroxylase 2                         239   1e-75    
gb|AHY28709.1|  trans-cinnamate 4-hydroxylase 2                         239   1e-75    
ref|NP_001172628.1|  Os01g0820000                                       250   2e-75    
gb|AAV33906.1|  trans-cinnamate 4-hydroxylase 2                         237   4e-75    
gb|AAV33887.1|  trans-cinnamate 4-hydroxylase 2                         237   5e-75    
emb|CDY23996.1|  BnaC03g16950D                                          247   5e-75    
gb|AAV33894.1|  trans-cinnamate 4-hydroxylase 2                         236   2e-74    
gb|ACE88962.1|  cinnamic acid 4-hydroxylase                             243   1e-73    
gb|AFL65041.1|  trans-cinnamate 4-hydroxylase                           244   2e-73    
ref|XP_004169246.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    239   5e-73    
gb|ACC63872.1|  trans-cinnamate 4-hydroxylase                           243   5e-73    
ref|XP_002452044.1|  hypothetical protein SORBIDRAFT_04g017460          242   1e-72    
ref|XP_011017615.1|  PREDICTED: cytochrome P450 CYP73A100-like          242   2e-72    
ref|XP_011078197.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    236   5e-72    
ref|XP_008450760.1|  PREDICTED: cytochrome P450 CYP73A100-like          241   6e-72    
gb|EMS49797.1|  Trans-cinnamate 4-monooxygenase                         240   8e-72    
ref|XP_004152894.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    239   1e-71    
gb|AGE10620.1|  cinnamate 4-hydroxylase                                 230   2e-71    
ref|XP_006850963.1|  hypothetical protein AMTR_s00025p00202710          238   4e-71    
gb|AGO02171.1|  cinnamate 4-hydroxylase                                 230   4e-71    
ref|XP_001781937.1|  predicted protein                                  237   7e-71    
gb|ACR36061.1|  unknown                                                 237   9e-71    
ref|NP_001151365.1|  trans-cinnamate 4-monooxygenase                    237   9e-71    
gb|AGJ71351.1|  cinnamate 4-hydroxylase 2                               237   1e-70    
ref|XP_010046885.1|  PREDICTED: cytochrome P450 CYP73A100-like          237   1e-70    
ref|NP_001046819.1|  Os02g0467600                                       237   2e-70    
gb|AHY28710.1|  trans-cinnamate 4-hydroxylase 2                         225   2e-70    
ref|NP_001046814.1|  Os02g0467000                                       237   2e-70    
ref|XP_004151378.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    231   2e-70    
ref|XP_006360653.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    236   3e-70    
emb|CAN70035.1|  hypothetical protein VITISV_027249                     235   6e-70    
ref|XP_002266142.1|  PREDICTED: cytochrome P450 CYP73A100               235   7e-70    
ref|XP_002266037.1|  PREDICTED: cytochrome P450 CYP73A100               235   9e-70    
ref|XP_009387808.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    226   1e-69    
ref|XP_009618442.1|  PREDICTED: cytochrome P450 CYP73A100-like          234   1e-69    
ref|XP_008450720.1|  PREDICTED: cytochrome P450 CYP73A100-like          234   1e-69    
gb|KGN61199.1|  hypothetical protein Csa_2G068700                       233   2e-69    
gb|AAK62344.1|  elicitor-inducible cytochrome P450                      234   2e-69    
ref|XP_009779123.1|  PREDICTED: cytochrome P450 CYP73A100-like          234   2e-69    
gb|EMT17866.1|  Trans-cinnamate 4-monooxygenase                         228   2e-69    
ref|XP_006647305.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    232   3e-69    
ref|XP_004172739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    231   5e-69    
ref|XP_004240122.1|  PREDICTED: cytochrome P450 CYP73A100-like          233   5e-69    
ref|XP_010928775.1|  PREDICTED: cytochrome P450 CYP73A100-like          233   5e-69    
ref|XP_004152891.1|  PREDICTED: LOW QUALITY PROTEIN: trans-cinnam...    233   6e-69    
ref|XP_002534996.1|  cinnamate 4-hydroxylase, putative                  233   6e-69    
ref|XP_006647306.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    233   7e-69    
ref|XP_008450772.1|  PREDICTED: cytochrome P450 CYP73A100-like          232   9e-69    
ref|XP_008798169.1|  PREDICTED: cytochrome P450 CYP73A100-like          231   2e-68    
ref|XP_010533060.1|  PREDICTED: cytochrome P450 CYP73A100-like          231   2e-68    
ref|XP_008450733.1|  PREDICTED: cytochrome P450 CYP73A100-like          231   3e-68    
ref|XP_007225069.1|  hypothetical protein PRUPE_ppa018282mg             229   3e-68    
gb|KDP27749.1|  hypothetical protein JCGZ_19778                         231   3e-68    
gb|AGE10593.1|  cinnamate 4-hydroxylase                                 231   3e-68    
ref|XP_010927178.1|  PREDICTED: cytochrome P450 CYP73A100-like          230   5e-68    
ref|XP_010106946.1|  Trans-cinnamate 4-monooxygenase                    233   6e-68    
ref|XP_004299767.1|  PREDICTED: cytochrome P450 CYP73A100-like          229   7e-68    
gb|AHF20176.1|  cinnamate 4-hydroxylase                                 229   2e-67    
ref|XP_003574953.1|  PREDICTED: cytochrome P450 CYP73A100-like          229   2e-67    
dbj|BAJ98052.1|  predicted protein                                      229   2e-67    
ref|XP_009417516.1|  PREDICTED: cytochrome P450 CYP73A100-like          229   2e-67    
ref|XP_009391094.1|  PREDICTED: cytochrome P450 CYP73A100-like          226   2e-67    
ref|XP_008223950.1|  PREDICTED: cytochrome P450 CYP73A100-like          229   2e-67    
ref|XP_001773101.1|  predicted protein                                  226   6e-67    
ref|XP_010263371.1|  PREDICTED: cytochrome P450 CYP73A100-like          227   9e-67    
ref|XP_007142896.1|  hypothetical protein PHAVU_007G026000g             226   1e-66    
ref|XP_007014539.1|  Trans-cinnamate 4-monooxygenase                    224   9e-66    
ref|XP_003555891.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    224   1e-65    
sp|H2DH22.1|C7A10_PANGI  RecName: Full=Cytochrome P450 CYP73A100        223   2e-65    
emb|CAA70595.1|  cinnamate 4-hydroxylase                                223   3e-65    
ref|XP_004497107.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    223   3e-65    
gb|KDO62016.1|  hypothetical protein CISIN_1g012770mg                   221   3e-65    
gb|AAD11427.1|  cinnamate 4-hydroxylase                                 223   5e-65    
dbj|BAE93150.1|  trans-cinnamate 4-monooxygenase                        210   6e-65    
ref|XP_006453189.1|  hypothetical protein CICLE_v10008125mg             221   6e-65    
gb|KHN11432.1|  Trans-cinnamate 4-monooxygenase                         222   9e-65    
ref|XP_010669584.1|  PREDICTED: cytochrome P450 CYP73A100-like          222   9e-65    
ref|NP_001275769.1|  cinnamate 4-hydroxylase CYP73                      221   1e-64    
emb|CDP12494.1|  unnamed protein product                                220   4e-64    
ref|XP_008782811.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    218   2e-63    
ref|XP_003637406.1|  Trans-cinnamate 4-monooxygenase                    215   3e-62    
gb|AAV36369.1|  cinnamate 4-hydroxylase                                 203   2e-60    
gb|AAV36378.1|  cinnamate 4-hydroxylase                                 203   2e-60    
gb|AHF20174.1|  cinnamate 4-hydroxylase                                 199   2e-60    
ref|XP_008355062.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    195   4e-59    
emb|CBI40667.3|  unnamed protein product                                201   9e-59    
gb|AAN03651.1|  putative C4H                                            190   2e-57    
gb|AFR37694.1|  cinnamate 4-hydroxylase                                 190   2e-57    
gb|AFR37685.1|  cinnamate 4-hydroxylase                                 190   2e-57    
gb|AFR37682.1|  cinnamate 4-hydroxylase                                 190   2e-57    
gb|AFR37715.1|  cinnamate 4-hydroxylase                                 190   3e-57    
gb|EMS65504.1|  Trans-cinnamate 4-monooxygenase                         201   5e-57    
gb|AEK79567.1|  cinnamate 4-hydroxylase                                 194   9e-57    
gb|EMT22866.1|  Trans-cinnamate 4-monooxygenase                         196   4e-55    
emb|CAA70596.1|  cinnamate 4-hydroxylase                                189   3e-54    
dbj|BAF03070.1|  cinnamate 4-hydroxylase                                183   1e-52    
dbj|BAF03071.1|  cinnamate 4-hydroxylase                                177   3e-50    
gb|KHN05578.1|  Trans-cinnamate 4-monooxygenase                         182   3e-50    
gb|ABI78932.1|  cinnamate 4-hydroxylase                                 176   5e-50    
gb|ACH59163.1|  trans-cinnamate 4-hydroxylase                           167   2e-48    
pir||PC4236  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - ...    172   3e-47 
ref|XP_006596898.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    164   1e-46    
ref|XP_008363435.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    162   3e-46    
dbj|BAE20400.1|  cinnamate 4-hydroxylase                                166   4e-46    
gb|AFP49342.1|  trans-cinnamate 4-hydroxylase                           145   5e-40    
gb|EPS57212.1|  hypothetical protein M569_17608                         150   3e-39    
gb|EYU18589.1|  hypothetical protein MIMGU_mgv1a004793mg                148   2e-37    
ref|XP_009407110.1|  PREDICTED: LOW QUALITY PROTEIN: trans-cinnam...    140   1e-36    
gb|EYU42910.1|  hypothetical protein MIMGU_mgv1a004732mg                145   2e-36    
ref|XP_009141948.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    144   2e-36    
emb|CDY06955.1|  BnaA04g23600D                                          143   6e-36    
gb|AAS16903.1|  putative cinnamate 4-hydroxylase                        134   6e-36    
gb|KFK42328.1|  hypothetical protein AALP_AA2G241900                    142   1e-35    
ref|XP_002881744.1|  CYP98A3                                            142   2e-35    
gb|KGN63286.1|  hypothetical protein Csa_2G423660                       136   2e-35    
gb|AAL06992.1|  At2g40890/T20B5.9                                       140   2e-35    
ref|XP_008443234.1|  PREDICTED: cytochrome P450 98A2                    141   3e-35    
gb|AAB86449.2|  putative cytochrome P450                                139   3e-35    
emb|CDY22488.1|  BnaC03g22980D                                          139   3e-35    
gb|ACO25188.1|  p-coumaroyl ester 3'-hydroxylase                        141   4e-35    
gb|AFP49812.1|  4-coumaric acid 3`-hydroxylase 25                       141   4e-35    
emb|CDY14751.1|  BnaC04g47480D                                          141   4e-35    
ref|XP_010517530.1|  PREDICTED: cytochrome P450 98A3                    140   9e-35    
ref|XP_006294048.1|  hypothetical protein CARUB_v10023039mg             140   1e-34    
ref|XP_008786871.1|  PREDICTED: cytochrome P450 98A2-like isoform X2    139   1e-34    
ref|XP_010508793.1|  PREDICTED: cytochrome P450 98A3-like isoform X1    140   1e-34    
ref|XP_010508794.1|  PREDICTED: cytochrome P450 98A3-like isoform X2    140   1e-34    
ref|XP_010505845.1|  PREDICTED: cytochrome P450 98A3-like               140   1e-34    
ref|NP_850337.1|  cytochrome P450 98A3                                  140   1e-34    
ref|XP_008786870.1|  PREDICTED: cytochrome P450 98A2-like isoform X1    140   1e-34    
emb|CDP06248.1|  unnamed protein product                                139   1e-34    
gb|ABO77958.1|  p-coumaroyl quinate/shikimate 3'-hydroxylase            139   1e-34    
dbj|BAC44836.1|  cytochrome P-450                                       139   2e-34    
ref|XP_004961648.1|  PREDICTED: cytochrome P450 98A1-like               139   2e-34    
emb|CAK22403.1|  p-coumarate 3-hydroxylase                              138   2e-34    
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          139   2e-34    
ref|XP_008347926.1|  PREDICTED: cytochrome P450 98A2-like               137   2e-34    
ref|XP_006836224.1|  hypothetical protein AMTR_s00101p00102460          139   2e-34    
ref|XP_002440001.1|  hypothetical protein SORBIDRAFT_09g024210          139   3e-34    
ref|XP_009133464.1|  PREDICTED: cytochrome P450 98A3                    139   3e-34    
emb|CDY35432.1|  BnaA03g19280D                                          139   3e-34    
ref|XP_006841381.1|  hypothetical protein AMTR_s00181p00052680          133   4e-34    
ref|XP_009413956.1|  PREDICTED: cytochrome P450 98A2                    138   4e-34    
gb|AEH20527.1|  coumarate 3-hydroxylase                                 138   4e-34    
ref|XP_010931545.1|  PREDICTED: cytochrome P450 98A2-like               138   4e-34    
gb|AEG19446.1|  CYP98A22                                                138   4e-34    
ref|XP_008455823.1|  PREDICTED: cytochrome P450 81D1-like               137   6e-34    
gb|AAU44038.1|  putative cytochrome P450                                137   6e-34    
ref|XP_009596523.1|  PREDICTED: cytochrome P450 98A2-like               137   6e-34    
ref|XP_010525432.1|  PREDICTED: cytochrome P450 98A3                    137   7e-34    
ref|XP_008365319.1|  PREDICTED: cytochrome P450 98A2-like               137   7e-34    
ref|NP_001055922.1|  Os05g0494000                                       137   9e-34    
dbj|BAO20879.1|  coumaroyl shikimate 3-hydroxylase 1                    137   9e-34    
gb|ABB83676.1|  putative p-coumaroyl 3'-hydroxylase CYP98A-C1           137   9e-34    
ref|NP_001142110.1|  putative cytochrome P450 superfamily protein       137   9e-34    
ref|XP_010111218.1|  Cytochrome P450 98A2                               137   1e-33    
gb|AFD29885.1|  p-coumarate 3-hydroxylase                               137   1e-33    
ref|XP_006430495.1|  hypothetical protein CICLE_v10011520mg             137   1e-33    
gb|ADO16250.1|  p-coumaroyl shikimate 3'-hydroxylase                    137   1e-33    
ref|XP_008378903.1|  PREDICTED: cytochrome P450 98A2-like               137   1e-33    
gb|AAL99201.1|  p-coumaroyl shikimate 3'-hydroxylase isoform 2          137   1e-33    
gb|ACV91106.1|  p-coumaroyl-shikimate 3'-hydroxylase                    137   1e-33    
gb|ACX48910.1|  p-coumaroyl-shikimate 3'-hydroxylase                    137   1e-33    
ref|XP_006482026.1|  PREDICTED: cytochrome P450 98A2-like               137   1e-33    
emb|CAD20576.2|  putative cytochrome P450                               137   1e-33    
ref|XP_002323218.2|  hypothetical protein POPTR_0016s03090g             137   1e-33    
ref|XP_004249116.1|  PREDICTED: cytochrome P450 98A2-like               137   1e-33    
gb|AAL99200.1|  p-coumaroyl shikimate 3'-hydroxylase isoform 1          137   1e-33    
ref|XP_009770888.1|  PREDICTED: cytochrome P450 98A2-like isoform X2    137   1e-33    
gb|AFZ78540.1|  p-coumarate 3-hydroxylase                               137   1e-33    
ref|XP_009770887.1|  PREDICTED: cytochrome P450 98A2-like isoform X1    137   1e-33    
ref|XP_009355326.1|  PREDICTED: cytochrome P450 98A2-like               136   2e-33    
ref|XP_006373686.1|  hypothetical protein POPTR_0016s03080g             136   2e-33    
dbj|BAE98524.1|  cytochrome P450 like protein                           136   2e-33    
ref|XP_001783465.1|  predicted protein                                  136   2e-33    
ref|XP_006411356.1|  hypothetical protein EUTSA_v10016538mg             136   2e-33    
ref|XP_004156796.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    136   2e-33    
gb|EYU18590.1|  hypothetical protein MIMGU_mgv1a004789mg                136   3e-33    
gb|ABC59086.1|  cytochrome P450 monooxygenase CYP98A37                  136   3e-33    
ref|XP_006364777.1|  PREDICTED: cytochrome P450 98A2-like               135   3e-33    
ref|XP_011041370.1|  PREDICTED: cytochrome P450 98A2-like               135   3e-33    
gb|AFP49813.1|  4-coumaric acid 3`-hydroxylase 34                       135   3e-33    
gb|ABV80352.1|  cytochrome P450-dependent monooxygenase                 135   3e-33    
ref|XP_009355325.1|  PREDICTED: cytochrome P450 98A2-like               135   3e-33    
ref|XP_002308860.1|  Cytochrome P450 98A3 family protein                135   3e-33    
gb|AEM63674.1|  p-coumarate 3'-hydroxylase                              135   3e-33    
ref|XP_004151923.1|  PREDICTED: cytochrome P450 81D1-like               135   4e-33    
gb|ABR18076.1|  unknown                                                 135   4e-33    
gb|AGN54071.1|  cytochrome P450 monooxygenase                           135   4e-33    
ref|XP_002981149.1|  p-coumaroyl shikimate/quinate 3'-hydroxylase       135   4e-33    
gb|AAT06912.1|  cytochrome P450                                         135   4e-33    
gb|KHG28386.1|  Cytochrome P450                                         133   4e-33    
ref|XP_003521103.1|  PREDICTED: cytochrome P450 98A2-like               135   4e-33    
gb|AAS57921.1|  hydroxylase-like cytochrome P450 CASS                   135   4e-33    
gb|EMS68882.1|  Cytochrome P450 98A1                                    135   5e-33    
ref|XP_011040720.1|  PREDICTED: cytochrome P450 98A2                    135   6e-33    
ref|XP_004162621.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    133   6e-33    
ref|XP_003565894.2|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    135   6e-33    
emb|CDP19231.1|  unnamed protein product                                135   6e-33    
gb|AJD25232.1|  cytochrome P450 CYP98A78                                135   6e-33    
gb|ABB83677.1|  putative p-coumaroyl 3'-hydroxylase CYP98A-C2           135   6e-33    
gb|AAV36185.1|  coumarate 3-hydroxylase                                 132   6e-33    
gb|EPS72845.1|  hypothetical protein M569_01910                         135   6e-33    
gb|AHY28670.1|  coumarate 3-hydroxylase                                 133   7e-33    
gb|KDO61006.1|  hypothetical protein CISIN_1g0379901mg                  129   7e-33    
gb|AAV36205.1|  coumarate 3-hydroxylase                                 132   7e-33    
ref|XP_003568200.1|  PREDICTED: cytochrome P450 98A1                    134   8e-33    
ref|XP_009628880.1|  PREDICTED: cytochrome P450 98A2-like               134   8e-33    



>gb|ADB65927.1| cinnamate 4-hydroxylase [Ipomoea batatas]
Length=505

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNPG+QKKLR+EIDAVLGPG QLTEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPGIQKKLREEIDAVLGPGVQLTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGIVLGRLVQNFELLPPPGHSKVDT
Sbjct  422  FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGIVLGRLVQNFELLPPPGHSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRT  504



>gb|AHJ60265.1| cinnamate 4-monooxygenase [Ipomoea purpurea]
Length=505

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 188/203 (93%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPHIQKKLRDEIDTVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFG GRRSCPGIILALPILGIVLGRLVQNFELLPPPG SKVDT
Sbjct  422  LEEEKHVEANGNDFRYLPFGAGRRSCPGIILALPILGIVLGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRT  504



>gb|ADX33333.1| cinnamate-4-hydroxylase 2 [Petunia x hybrida]
Length=505

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ABQ53544.1| cinnamic acid 4-hydroxylase [Arachis diogoi]
Length=226

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QK +RDEID VLGPG Q+TEPD  KLPYLQAVI
Sbjct  24   NINVAAIETTLWSIEWGIAELVNHPEIQKNVRDEIDTVLGPGHQVTEPDLQKLPYLQAVI  83

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  84   KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  143

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  144  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  203

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  204  TEKGGQFSLHILKHSTIVAKPRS  226



>ref|XP_009607087.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana tomentosiformis]
 gb|ABC69412.1| CYP73A47v3 [Nicotiana tabacum]
Length=505

 Score =   327 bits (839),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ADX33332.1| cinnamate-4-hydroxylase 1 [Petunia x hybrida]
Length=506

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID+VLGPG Q+TEP THKLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDSVLGPGVQITEPHTHKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPATWKRPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  423  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKH TIVMKPR 
Sbjct  483  TEKGGQFSLHILKHFTIVMKPRS  505



>ref|XP_009798122.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana sylvestris]
 gb|ABC69411.1| CYP73A47v1 [Nicotiana tabacum]
Length=505

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KE LRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KEALRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ADO16243.1| cinnamate 4-hydroxylase [Ocimum tenuiflorum]
Length=505

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPGAQ+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGAQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>gb|AEM63593.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVLGPGHQVTEPDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPGHSK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGHSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>gb|ACF19421.1| candidate cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   325 bits (832),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EIDAVLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQQKLREEIDAVLGPGVQVTEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHV+ANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEKHVDANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRS  504



>ref|XP_010253046.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   325 bits (832),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>gb|ABD77493.2| cinnamic acid 4-hydroxylase [Arnebia euchroma]
Length=504

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEIDA+LGPG Q+TEPDTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPRIQKKLRDEIDAILGPGVQVTEPDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLNGYDIPAESKILVNAWWLANNPEQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRA  504



>dbj|BAB71716.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID +LGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTILGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLNGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRS  504



>ref|XP_010252045.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>gb|ABC69413.1| CYP73A47v2 [Nicotiana tabacum]
Length=505

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KE LRLRMAIPLLVPHMNLHDAKLGG DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KEALRLRMAIPLLVPHMNLHDAKLGGLDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>emb|CAP08847.1| cinnamate-4-hydroxylase [Arabidopsis lyrata]
Length=226

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  23   NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  82

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  83   KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  142

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFRF+PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  143  FEEEAHVEANGNDFRFVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  202

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HSTIVMKPR
Sbjct  203  SEKGGQFSLHILNHSTIVMKPR  224



>gb|ADO16244.1| cinnamate 4-hydroxylase [Ocimum basilicum]
Length=505

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>gb|AEM63594.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
 gb|AEX08610.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVLGPGHQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_009766429.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana sylvestris]
Length=506

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID+VLG G Q+TEP+ +KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDSVLGVGVQITEPELNKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPATWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  423  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  483  TEKGGQFSLHILKHSTIVMKPRS  505



>gb|EYU46023.1| hypothetical protein MIMGU_mgv1a004904mg [Erythranthe guttata]
Length=505

 Score =   322 bits (826),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAELVN+P +QK+LRDEIDAV+GPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSVEWGIAELVNHPQIQKRLRDEIDAVVGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP+TW+NPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANNPATWRNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILG+ LGRLVQNFE+LPPPG  ++DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGVTLGRLVQNFEMLPPPGQERIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>ref|XP_009601847.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana tomentosiformis]
Length=506

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID+VLG G Q+TEP+ +KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDSVLGVGVQITEPELNKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPATWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  423  FEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  483  TEKGGQFSLHILKHSTIVMKPRS  505



>gb|AIY32618.1| cinnamate-4-hydroxylase [Perilla frutescens]
Length=505

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPGAQ+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGAQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPEQWKRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEA+GNDFR+LPFGVGRRSCPGIILA+PILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEASGNDFRYLPFGVGRRSCPGIILAMPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>gb|ABC69046.1| cinnamic acid 4-hydroxylase [Solanum tuberosum]
Length=505

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGMQVTEPDMPKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DT
Sbjct  422  FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRS  504



>ref|XP_011080651.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Sesamum indicum]
Length=505

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG  +TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVLGPGVPVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNP+EFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LG LVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGGLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRS  504



>gb|KJB83924.1| hypothetical protein B456_013G271700 [Gossypium raimondii]
Length=505

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV KPR
Sbjct  482  TEKGGQFSLHILKHSTIVAKPR  503



>gb|ACH56520.1| cinnamate-4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV KPR
Sbjct  482  TEKGGQFSLHILKHSTIVAKPR  503



>gb|ACZ54906.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TE DTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVLGPGHQVTESDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDA+LGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAQLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPGHSK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGHSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>gb|AAG10196.1|AF286647_1 cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|KHG13044.1| Cytochrome P450 protein [Gossypium arboreum]
Length=505

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV KPR
Sbjct  482  TEKGGQFSLHILKHSTIVAKPR  503



>ref|XP_002523952.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
 gb|EEF38439.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGNQITEPDTYKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>gb|ACR10242.1| cinnamate-4-hydroxylase [Canarium album]
Length=505

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLREEIDVVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLAN+P+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANDPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGH32777.1| cinnamic acid 4-hydroxylase [Camellia chekiangoleosa]
Length=505

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQKKLR E+DAVLGPG Q+TEPDT+KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPQVQKKLRQELDAVLGPGTQITEPDTYKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLG YDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGSYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  AEKGGQFSLHILKHSTIVMKPRS  504



>gb|AID51447.1| cinnamate 4-hydroxylase 2 [Astragalus membranaceus]
Length=505

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKK+R+EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKVREEIDRVLGPGHQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPE+FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEQFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>ref|XP_006350887.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum tuberosum]
Length=526

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPD  KLPYLQAVI
Sbjct  323  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDEIDTVLGPGMQVTEPDMPKLPYLQAVI  382

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLAN+P+ WK PEEFRPERF
Sbjct  383  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANDPAHWKKPEEFRPERF  442

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DT
Sbjct  443  FEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGQSKLDT  502

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  503  SEKGGQFSLHILKHSTIVMKPRS  525



>gb|ACZ06240.1| cinnamate 4-hydroxylase 2 [Gossypium hirsutum]
Length=505

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P  QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPETQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV KPR
Sbjct  482  TEKGGQFSLHILKHSTIVAKPR  503



>ref|XP_011089532.1| PREDICTED: trans-cinnamate 4-monooxygenase [Sesamum indicum]
Length=505

 Score =   320 bits (819),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID V+GPG  LTEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVVGPGVPLTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLAN+P+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWWLANDPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESSVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>pir||PC4237 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - Japanese 
aspen x large-toothed aspen (fragment)
 dbj|BAA11578.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=454

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  251  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVI  310

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  311  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  370

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  371  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  430

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  431  SEKGGQFSLHILKHSTIVAKPRS  453



>ref|XP_006432069.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
 gb|AAK57011.1|AF378333_1 cinnamate 4-hydroxylase [Citrus x paradisi]
 gb|ESR45309.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
Length=505

 Score =   320 bits (819),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGX85600.1| coumarate 4-hydroxylase [Scoparia dulcis]
Length=505

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKK+RDEID VLGPG Q+TEP+ H+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKVRDEIDTVLGPGVQVTEPELHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ABF69099.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGJ84133.1| putative trans-cinnamate 4-hydroxylase [Hibiscus cannabinus]
Length=505

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDEID VLGPG Q+TEPDTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPRIQQKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGR+VQNFELLPP G SK+DT
Sbjct  422  FEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRMVQNFELLPPNGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>gb|ABF69100.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_007017089.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY34708.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D VLGPG Q+TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTVLGPGHQITEPDTYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNP+EFRPERF
Sbjct  362  KETLRFRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV KPR
Sbjct  482  TEKGGQFSLHILKHSTIVAKPR  503



>ref|XP_002325638.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ACC63871.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
 gb|EEF00020.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQITEPDTNKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|AAG10197.1| cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|ACZ06239.1| cinnamate 4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT
Sbjct  422  FEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPKGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>ref|NP_001275824.1| cinnamate 4-hydroxylase CYP73 [Citrus sinensis]
 gb|AAF66066.2|AF255014_1 cinnamate 4-hydroxylase CYP73 [Citrus sinensis]
Length=519

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  316  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVI  375

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  376  KETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKPEEFRPERF  435

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  436  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  495

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
             EKGGQFSLHILKHSTIV KPR
Sbjct  496  AEKGGQFSLHILKHSTIVAKPR  517



>ref|XP_011015228.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQVTEPDTNKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|KJB72975.1| hypothetical protein B456_011G207000 [Gossypium raimondii]
Length=505

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT
Sbjct  422  FEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPKGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>ref|XP_008456253.1| PREDICTED: trans-cinnamate 4-monooxygenase [Cucumis melo]
Length=505

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVPITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>sp|Q96423.1|TCMO_GLYEC RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycyrrhiza 
echinata]
 dbj|BAA13414.1| cytochrome P450 (CYP73A14) [Glycyrrhiza echinata]
Length=505

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKK+RDEID VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKVRDEIDRVLGPGHQVTEPDMQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_011041784.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGHQVTEPDTNKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_010938024.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRHELDTVLGPGVQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDNWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LDEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVCKPRV  504



>gb|AAG43824.1|AF212318_1 cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EIDAVLGPG Q+TEPDTHKLP LQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQQKLREEIDAVLGPGVQVTEPDTHKLPDLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMA PLLVPHMN+HDAKL GYDIPAESKILVN WWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMATPLLVPHMNIHDAKLAGYDIPAESKILVNPWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EEKHV+ANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LKEEKHVDANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRS  504



>ref|XP_002881114.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57373.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=505

 Score =   317 bits (812),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFRF+PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRFVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HSTIVMKPR
Sbjct  482  SEKGGQFSLHILNHSTIVMKPR  503



>ref|XP_009403855.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+PG+Q+KLR E+DAVLGPG  +TEPD  KLPYLQAVI
Sbjct  185  NINVAAIETTLWSIEWGVAELVNHPGIQRKLRQELDAVLGPGVPITEPDIPKLPYLQAVI  244

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  245  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  304

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I LGRLVQNFELLPPPG  +VDT
Sbjct  305  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILCITLGRLVQNFELLPPPGTDQVDT  364

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  365  TEKGGQFSLHILKHSTIVCKPRA  387



>gb|AEV93475.1| 4-coumarate:CoA ligase [Caragana korshinskii]
Length=505

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKK+RDEID+VLGPG Q+TEPD   LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKVRDEIDSVLGPGHQVTEPDIQNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_007205045.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
 gb|EMJ06244.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
Length=504

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>ref|XP_007011365.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY20175.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG  +TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRNEIDTVLGPGVPVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK+LVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKVLVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQAKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>gb|KDP45711.1| hypothetical protein JCGZ_17318 [Jatropha curcas]
Length=505

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHIL HSTIV KPR 
Sbjct  482  TEKGGQFSLHILNHSTIVAKPRS  504



>ref|XP_008240713.1| PREDICTED: trans-cinnamate 4-monooxygenase [Prunus mume]
Length=504

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRA  504



>gb|ADZ54778.1| trans-cinnamate 4-monooxygenase [Prunus avium]
Length=505

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHILKHSTIV+KP
Sbjct  482  TEKGGQFSLHILKHSTIVLKP  502



>ref|XP_008657127.1| PREDICTED: trans-cinnamate 4-monooxygenase [Zea mays]
 gb|AFW84752.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=505

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW +AELVN+P +Q+KLR E+D VLGPG Q+TEPDTH LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAVAELVNHPEIQQKLRQELDTVLGPGHQITEPDTHNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW+LANNP +W+ PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWYLANNPDSWRRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  KVDT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVCKPRT  504



>gb|ADD54647.1| cinnamate 4-hydroxylase [Bruguiera gymnorhiza]
Length=261

 Score =   307 bits (787),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS EW IAELVN+P +QKKLR E+D VLGP   +TEPDTH+LPYLQAVI
Sbjct  58   NINVAAIETTLWSTEWVIAELVNHPEIQKKLRIELDTVLGPDHPITEPDTHQLPYLQAVI  117

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  118  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  177

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  178  LEEESNVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  237

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  238  TEKGGQFSLHILKHSTIVAKPRS  260



>ref|XP_004970385.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Setaria italica]
Length=505

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLR E+DA LGPG Q+TEPDTH+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQRKLRQELDAALGPGHQITEPDTHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAW+LANNP +W+ PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWYLANNPDSWRRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE+HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEERHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVCKPRA  504



>gb|AFN44010.1| cinnamate 4-hydroxylase [Neolamarckia cadamba]
Length=505

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR+EID VLGPG Q+TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPRVQRKLREEIDTVLGPGVQVTEPDTNKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGGHDIPAESKILVNAWWLANNPENWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>ref|XP_010685980.1| PREDICTED: trans-cinnamate 4-monooxygenase [Beta vulgaris subsp. 
vulgaris]
Length=504

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 179/202 (89%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLG G Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQNKLREEIDTVLGKGHQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHNAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFRFLPFGVGRRSCPGIILALPILGI +GRLVQNFEL+PPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRFLPFGVGRRSCPGIILALPILGITIGRLVQNFELMPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILKHSTIV+KPR
Sbjct  482  TEKGGQFSLHILKHSTIVLKPR  503



>gb|AAT68775.2| trans-cinnamate 4-hydroxylase [Camellia sinensis]
Length=390

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LG G Q+TEPDT+KLPYLQAV+
Sbjct  187  NINVAAIETTLWSIEWGIAELVNHPQIQKKLRHELDTMLGLGVQITEPDTYKLPYLQAVV  246

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  247  KETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWWLANNPDNWKNPEEFRPERF  306

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT
Sbjct  307  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQAKIDT  366

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV+KPR 
Sbjct  367  AEKGGQFSLHILKHSTIVLKPRS  389



>emb|CDP04040.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR EID VLGPG Q+TEPDT KLPYLQAV+
Sbjct  117  NINVAAIETTLWSIEWGIAELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTLKLPYLQAVV  176

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF
Sbjct  177  KETLRLRMAIPLLVPHMNLNEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERF  236

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  237  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  296

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV+KPR 
Sbjct  297  AEKGGQFSLHILKHSTIVLKPRS  319



>gb|ADN32769.1| cinnamate 4-hydroxylase [Scutellaria baicalensis]
Length=507

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P ++KK+R+E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  304  NINVAAIETTLWSIEWGIAELVNHPEIRKKVREELDTVLGPGVQITEPDTHKLPYLQAVI  363

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  364  KETLRLRMAIPLLVPHMNLHDAKLNGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  423

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I +GRLVQNFELLPPPG +K+DT
Sbjct  424  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILCITIGRLVQNFELLPPPGQAKLDT  483

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHI+KHSTIV+KPR 
Sbjct  484  TEKGGQFSLHIMKHSTIVLKPRS  506



>emb|CDX84829.1| BnaA03g14010D [Brassica napus]
Length=505

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRS  504



>gb|ADG43134.1| cinnamate 4-hydroxylase [Isatis tinctoria]
Length=509

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK  EEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKLEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILTHSTIVMKPRA  504



>emb|CDY23995.1| BnaC03g16960D [Brassica napus]
Length=505

 Score =   315 bits (807),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRS  504



>emb|CAP08829.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>gb|AAC99993.1| cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>emb|CAP08828.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>gb|AAB58355.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08830.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08831.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08832.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08833.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08838.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08839.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08842.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08843.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08844.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08845.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>emb|CAP08846.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=488

 Score =   314 bits (804),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  285  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  344

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  345  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  404

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  405  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  464

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  465  SEKGGQFSLHILNHSIIVMKPR  486



>gb|ABF17875.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 gb|ABF17876.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 emb|CDY29670.1| BnaA04g17570D [Brassica napus]
Length=505

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGVAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRT  504



>gb|AID16078.1| cinnamate 4-hydroxylase [Morus alba]
Length=505

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRDELDTVLGQGVQITEPDMLKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LQEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>emb|CAP08827.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08834.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08835.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08836.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08837.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS I+MKPR
Sbjct  482  SEKGGQFSLHILNHSIILMKPR  503



>ref|NP_180607.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 sp|P92994.1|TCMO_ARATH RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Arabidopsis 
thaliana]
 gb|AAB58356.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAB63088.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAL38321.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAP68314.1| At2g30490 [Arabidopsis thaliana]
 emb|CAP08840.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08841.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AEC08397.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 gb|AGA15806.1| C4H [Expression vector pUDE172]
Length=505

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>ref|XP_006410152.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
 dbj|BAJ33716.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51605.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
Length=505

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRA  504



>gb|AFY17065.1| cinnamate 4-hydroxylase 2 [Panicum virgatum]
Length=505

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLR E+DA LGPG Q+TEPDTH+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLRQELDAALGPGHQITEPDTHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW+LANNP +W+ PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWYLANNPDSWRRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHILK+STIV KPR
Sbjct  482  TEKGGQFSLHILKYSTIVCKPR  503



>gb|AAC35857.1| cinnamic acid 4-hydroxylase [Capsicum chinense]
Length=469

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AI+TTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDT KLPYLQAVI
Sbjct  266  NINVAAIQTTLWSIEWGIAELVNHPHIQQKLREEIDTVLGPGVQVTEPDTQKLPYLQAVI  325

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHM+LHDAKL  YDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  326  KETLRLRMAIPLLVPHMSLHDAKLAVYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  385

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHV+ANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFE+ PPPG SK+DT
Sbjct  386  LEEEKHVDANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFEMFPPPGQSKLDT  445

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  446  SEKGGQFSLHILKHSTIVMKPRS  468



>gb|AGJ71350.1| cinnamate 4-hydroxylase 1 [Eucalyptus urophylla]
Length=505

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EIDAVLGPG  +TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPQIQRKLREEIDAVLGPGVPVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILG+ +G+LVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGVTIGQLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>dbj|BAB71717.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/202 (89%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLG YDIPAESK LVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGEYDIPAESKSLVNAWWLANNPTQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEA+GNDFR+LPFGVGRRSCPGIILALPILGI LG LV+NFELLPPPG SK+DT
Sbjct  422  LEEEAKVEASGNDFRYLPFGVGRRSCPGIILALPILGITLGGLVKNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHILKHSTIVMKPR
Sbjct  482  SEKGGQFSLHILKHSTIVMKPR  503



>ref|XP_010510361.1| PREDICTED: trans-cinnamate 4-monooxygenase [Camelina sativa]
Length=505

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HSTIVMKPR
Sbjct  482  SEKGGQFSLHILNHSTIVMKPR  503



>ref|XP_010103664.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB96547.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRHELDTVLGPGEQITEPDTYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF++LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEAKVEANGNDFKYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>sp|P48522.1|TCMO_CATRO RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Catharanthus 
roseus]
 emb|CAA83552.1| cinnamate 4-hydroxylase (CYP73) [Catharanthus roseus]
Length=505

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE++ VLGPG Q+TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELETVLGPGVQITEPDTYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPL +PHMNLHDAKLGGYDIPAESKILVNAW+LANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLFLPHMNLHDAKLGGYDIPAESKILVNAWFLANNPEHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRT  504



>ref|XP_009132739.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLAN+P +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANSPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRS  504



>gb|AHL83550.1| C4H [Morus alba var. multicaulis]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRDELDTVLGQGVQITEPDMLKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLAN+P+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANDPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LQEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>gb|AEA02458.1| cinnamate 4-hydroxylase [Prunus armeniaca]
Length=504

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D+VLGPG Q+TEP+  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVQITEPEIQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>ref|XP_010094425.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB56006.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRDELDTVLGRGVQITEPDMLKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT
Sbjct  422  LQEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPAGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVLKPRS  504



>gb|AHG06398.1| cinnamic acid 4-hydroxylase [Ornithogalum saundersiae]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR+E+D VLGPG Q+TEPD H+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPKVQQKLRNELDTVLGPGVQITEPDMHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANNPEHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF+++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEAKVEANGNDFKYIPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>gb|AGG55322.1| cinnamate 4-hydroxylase [Paeonia lactiflora]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMN++DAKLGG+DIPAESK+LVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNINDAKLGGFDIPAESKVLVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV  P+ 
Sbjct  482  TEKGGQFSLHILKHSTIVANPKI  504



>gb|AGN70893.1| cinammate 4-hydroxylase [Dendrobium catenatum]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLRDE+D VLG G Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEVQRKLRDELDTVLGRGNQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGY+IPAESKILVNAWWLANNP+ WKNP++FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYEIPAESKILVNAWWLANNPAQWKNPDQFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFRF+PFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  422  LEEESKVEANGNDFRFIPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGMEKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHILKH T+V KPR
Sbjct  482  SEKGGQFSLHILKHYTVVAKPR  503



>ref|XP_010414263.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
 ref|XP_010469851.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
Length=505

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ H+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHEAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HSTIVMKPR
Sbjct  482  SEKGGQFSLHILNHSTIVMKPR  503



>gb|AEA02459.1| cinnamate 4-hydroxylase [Prunus cerasifera x Prunus munsoniana]
Length=504

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D+VLGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDSVLGPGVQITEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ABF69101.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>dbj|BAE72875.1| Cinnamic acid 4-hydroxylase [Verbena x hybrida]
Length=505

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLGPG Q+TEPD  KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDVPKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFE++PPPG +K+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFEMVPPPGQAKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>sp|O24312.1|TCMO_POPTM RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
tremuloides]
 gb|AAB67874.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_009354868.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=504

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+DAVLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDAVLGRGVQITEPDVQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMK R 
Sbjct  482  SEKGGQFSLHILKHSTIVMKSRA  504



>ref|XP_004294725.1| PREDICTED: trans-cinnamate 4-monooxygenase [Fragaria vesca subsp. 
vesca]
Length=504

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLG G Q+TEP+ HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGHGVQVTEPELHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILG+ LGRLVQNFE+LPPPG +++DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGVTLGRLVQNFEMLPPPGQTQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRA  504



>gb|ABF69102.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_011021057.1| PREDICTED: trans-cinnamate 4-monooxygenase [Populus euphratica]
Length=505

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>gb|KHN40993.1| Trans-cinnamate 4-monooxygenase [Glycine soja]
Length=434

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+
Sbjct  231  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVV  290

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  291  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  350

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  351  FEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  410

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHILKHSTIV KPR
Sbjct  411  SEKGGQFSLHILKHSTIVAKPR  432



>gb|AIT52342.1| cinammate 4-hydroxylase 1 [Daucus carota]
Length=506

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D+VLG G Q+ EPD HKLPYL+AVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQEKLRDEMDSVLGVGVQICEPDIHKLPYLEAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLH+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHEAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE+ VEANG+DFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEERKVEANGDDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  483  AEKGGQFSLHILKHSTIVCKPRS  505



>gb|AFZ78542.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+  +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWEIAELVNHSLIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  FEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_010032943.1| PREDICTED: trans-cinnamate 4-monooxygenase [Eucalyptus grandis]
 gb|KCW52446.1| hypothetical protein EUGRSUZ_J01844 [Eucalyptus grandis]
Length=505

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+EIDAVLGPG  +TEP+ +KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPQIQRKLREEIDAVLGPGVPVTEPELYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILG+ +G+LVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGVTIGQLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|ABF17873.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 gb|ABF17874.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 emb|CDY02068.1| BnaC04g14330D [Brassica napus]
Length=505

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDF+++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFKYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILHHSTIVMKPRS  504



>ref|XP_008810838.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETT WSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTQWSIEWGIAELVNHPEIQRKLRRELDTVLGPGVQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WKNP+EFRPERF
Sbjct  362  KETLRRRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDNWKNPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
              EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LAEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
             EKGGQFSLHILKHSTIV KPR
Sbjct  482  AEKGGQFSLHILKHSTIVCKPR  503



>gb|KHN30609.1| Trans-cinnamate 4-monooxygenase [Glycine soja]
Length=433

 Score =   310 bits (794),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+K+RDEID VL  G Q+TEPD  KLPYLQAV+
Sbjct  230  NINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVV  289

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  290  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  349

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPIL I LGRLVQNFELLPPPG S++DT
Sbjct  350  LEEELHVEANGNDFRYLPFGVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQSQIDT  409

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  410  SEKGGQFSLHILKHSTIVAKPRS  432



>sp|Q43054.1|TCMO_POPKI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
sieboldii x Populus grandidentata]
 pir||JC5129 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) A - Japanese 
aspen x large-toothed aspen
 dbj|BAA11579.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
 dbj|BAA11576.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=505

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EE   VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEGAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_002458683.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
 gb|EES03803.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
Length=505

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLR E+D VL PG Q+TEPDTH LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLRQELDTVLAPGQQITEPDTHNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW+LANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWYLANNPESWKRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHS IV KPR 
Sbjct  482  TEKGGQFSLHILKHSNIVCKPRT  504



>gb|ACM17896.1| cinnamate-4-hydroxylase [Rubus occidentalis]
Length=504

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGRGVQITEPEIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRT  504



>gb|AAG50231.1|AF302495_1 cinnamate 4-hydroxylase [Populus trichocarpa x Populus deltoides]
Length=505

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_003616037.1| Trans-cinnamate 4-monooxygenase [Medicago truncatula]
 gb|ABC59087.1| cytochrome P450 monooxygenase CYP73A3 [Medicago truncatula]
 gb|ADK91846.1| coumarate 4-hydroxylase [Medicago truncatula]
 gb|AES98995.1| cytochrome P450 family cinnamate 4-hydroxylase [Medicago truncatula]
Length=506

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+ G+Q K+R+E+D VLGPG Q+TEPD HKLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHQGIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLNGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>sp|Q43067.2|TCMO_PEA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Pisum 
sativum]
Length=505

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRA  504



>gb|ACC63873.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
Length=505

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_002319974.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 ref|XP_002319975.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ABK93900.1| unknown [Populus trichocarpa]
 gb|EEE95897.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 gb|EEE95898.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRS  504



>gb|AAC49187.2| trans-cinnamic acid hydroxylase [Pisum sativum]
Length=503

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  300  NINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  359

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  360  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  419

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  420  LEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  479

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  480  SEKGGQFSLHILKHSTIVAKPRA  502



>ref|XP_010921158.1| PREDICTED: trans-cinnamate 4-monooxygenase [Elaeis guineensis]
Length=505

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRHELDTVLGPGVQITEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G DIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLRGCDIPAESKILVNAWWLANNPDNWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVCKPRV  504



>sp|P37115.1|TCMO_VIGRR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Vigna 
radiata var. radiata]
 gb|AAA33755.1| cinnamate 4-hydroxylase [Vigna radiata var. radiata]
Length=505

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+K+RDEID VLG G Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLGVGHQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  422  FEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHST+V KPR 
Sbjct  482  SEKGGQFSLHILKHSTVVAKPRS  504



>gb|KHG02507.1| Cytochrome P450 protein [Gossypium arboreum]
Length=532

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  739  VXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKET  560
            V AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVIKET
Sbjct  332  VKAIETTLWSIEWGIAELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVIKET  391

Query  559  LRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffee  380
            LRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEE
Sbjct  392  LRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEE  451

Query  379  EKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEK  200
            E  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT+EK
Sbjct  452  ESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPKGQSKLDTSEK  511

Query  199  GGQFSLHILKHSTIVMKPRC  140
            GGQFSLHILKHSTIV KPR 
Sbjct  512  GGQFSLHILKHSTIVAKPRM  531



>dbj|BAA24355.1| trans-cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KL +E+D VLGPG Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLGNELDTVLGPGVQVTEPDLHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT
Sbjct  422  FEEESHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HS IVMKPR
Sbjct  482  SEKGGQFSLHILNHSIIVMKPR  503



>gb|AGE10592.1| cinnamate 4-hydroxylase [Lonicera japonica]
Length=505

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAELVN+  +Q KLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSVEWGIAELVNHQEIQNKLRHELDTVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPAKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQNKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGC29944.1| CYP73A107 [Sinopodophyllum hexandrum]
 gb|AGV76060.1| cinnamate-4-hydroxylase [Sinopodophyllum hexandrum]
Length=504

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRHELDTVLGPGVQITEPDTHKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAW+LANNP  WKNPEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWFLANNPEHWKNPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  421  LEEEANVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFS+ ILKHSTIV+KPR 
Sbjct  481  TEKGGQFSMFILKHSTIVVKPRV  503



>dbj|BAI77480.1| cinnamate-4-hydroxylase [Brassica rapa]
 emb|CDY10741.1| BnaA05g11950D [Brassica napus]
Length=505

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILHHSTIVMKPRS  504



>ref|XP_009141068.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGVAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR +PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRDVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRT  504



>emb|CAK95273.1| cinnamate-4-hydroxylase [Cucumis sativus]
Length=505

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF++LPFG GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFKYLPFGAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVVKPRV  504



>emb|CDP19477.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR EID VLGPG Q+TEPDTHKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMA+PLLVPHMNL++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF
Sbjct  362  KETLRLRMAVPLLVPHMNLNEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPIL I LG LVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILAITLGSLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVLKPRS  504



>gb|KGN46762.1| hypothetical protein Csa_6G133710 [Cucumis sativus]
Length=391

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+
Sbjct  188  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVV  247

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM IPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  248  KETLRLRMTIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  307

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF++LPFG GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  308  LEEESKVEANGNDFKYLPFGAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  367

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  368  SEKGGQFSLHILKHSTIVVKPRV  390



>emb|CDX97826.1| BnaC04g41130D [Brassica napus]
Length=505

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGVAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+ AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNVAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILNHSTIVMKPRT  504



>dbj|BAF81522.1| cinnamate-4-hydroxylase [Brassica rapa]
 dbj|BAI77479.1| cinnamate-4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILHHSTIVMKPRS  504



>gb|ACE95171.1| cinnamate-4-hydroxylase [Populus tomentosa]
 gb|AFZ78541.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEA+GNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEASGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|AJD25173.1| cytochrome P450 CYP73A120 [Salvia miltiorrhiza]
Length=504

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVV  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  421  LEEEAKVDANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  481  SEKGGQFSLHILKHSTIVLKPRS  503



>gb|AHB52741.1| cinnamate 4-hydroxylase [Pyrus x bretschneideri]
Length=504

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLG G Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSLHILKHSTIVMKP
Sbjct  482  SEKGGQFSLHILKHSTIVMKP  502



>ref|XP_004154553.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF++LPFG GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFKYLPFGAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVVKPRV  504



>ref|NP_001237317.1| trans-cinnamate 4-monooxygenase [Glycine max]
 sp|Q42797.1|TCMO_SOYBN RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycine 
max]
 emb|CAA63172.1| cinnamic acid 4-hydroxylase [Glycine max]
 gb|ACN81819.1| coumarate 4-hydroxylase [Glycine max]
 gb|AEX32785.1| cinnamate-4-hydroxylase [Glycine max]
Length=506

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  423  FEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>gb|ABN48717.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVV  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  421  LEEEAKVDANGNDFRYLPFGVGRRSCPGIILALPILGIAIGRLVQNFELLPPPGQSKIDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  481  SEKGGQFSLHILKHSTIVLKPRS  503



>gb|AEK94316.1| cinnamic acid 4-hydroxylase-like protein [Pyrus x bretschneideri]
Length=504

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLG G Q+TEPD HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMK R 
Sbjct  482  SEKGGQFSLHILKHSTIVMKSRA  504



>ref|XP_006294053.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
 gb|EOA26951.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
Length=506

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLG G Q+TEP+ HKLPYLQAV+
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEMDTVLGLGVQVTEPELHKLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  423  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHIL HSTIVMKPR
Sbjct  483  SEKGGQFSLHILNHSTIVMKPR  504



>gb|ADT63059.1| cinnamate 4-hydroxylase [Fagopyrum esculentum]
Length=388

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAV+
Sbjct  186  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRDELDTVLGKGVQITEPDLPKLPYLQAVV  245

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  246  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  305

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFE+LPPPG +K+DT
Sbjct  306  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFEMLPPPGENKLDT  365

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSLHILKHSTIVMKP
Sbjct  366  SEKGGQFSLHILKHSTIVMKP  386



>ref|XP_008792249.1| PREDICTED: trans-cinnamate 4-monooxygenase [Phoenix dactylifera]
Length=505

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR+E+D VLGPG  +TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEVQQKLRNELDTVLGPGVAVTEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            +EKGGQFSLHILKHSTIV KPR
Sbjct  482  SEKGGQFSLHILKHSTIVAKPR  503



>gb|AEH68208.1| cinnamate 4-hydroxylase [Astragalus mongholicus]
Length=505

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAEL N+P +Q K+RDEID+VLGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELANHPEIQNKVRDEIDSVLGPGHQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|ACZ73612.1| cinnamate 4-hydroxylase [Bambusa oldhamii]
Length=507

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW I ELVN+P +Q+KLR E+DAVLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIGELVNHPEIQRKLRHELDAVLGPGHQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAW+LANNP  WK PEE RPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWYLANNPDQWKRPEELRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHS IV KPR 
Sbjct  482  AEKGGQFSLHILKHSNIVAKPRA  504



>gb|EMT08179.1| Trans-cinnamate 4-monooxygenase [Aegilops tauschii]
Length=446

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVI
Sbjct  243  NINVAAIETTLWSIEWGLAELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVI  302

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GY+IPAESKILVNAW+LANNP  WK P+EFRPERF
Sbjct  303  KETLRLRMAIPLLVPHMNLHDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFRPERF  362

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DT
Sbjct  363  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDT  422

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  423  TEKGGQFSLHILKHSTIVAKPRV  445



>ref|XP_007146898.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
 gb|ESW18892.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
Length=505

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLW+IEWGIAELVN+P +QKK+R+EID V+GPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWTIEWGIAELVNHPEIQKKVREEIDRVVGPGNQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL  AKLGGYDIPAESK+LVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQHAKLGGYDIPAESKVLVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFRFLPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  422  LEEESKVEANGNDFRFLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_003564495.1| PREDICTED: trans-cinnamate 4-monooxygenase [Brachypodium distachyon]
Length=505

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLRDE+D VLG G Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLRDELDTVLGAGHQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGGY+IPAESKILVNAW+LANNP  W+ P+EFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGYNIPAESKILVNAWFLANNPEEWRRPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRFLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHS IV KPR 
Sbjct  482  TEKGGQFSLHILKHSNIVAKPRV  504



>gb|ABC75596.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVV  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFE+LPPPG SK+DT
Sbjct  421  LEEEAKVDANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKIDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  481  SEKGGQFSLHILKHSTIVLKPRS  503



>gb|EPS68507.1| cinnamate-4-hydroxylase 1, partial [Genlisea aurea]
Length=421

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAELVN+P VQKKLRDEIDAVLG G  +TEPDTHKLPYLQAVI
Sbjct  218  NINVAAIETTLWSVEWGIAELVNHPNVQKKLRDEIDAVLGRGVPVTEPDTHKLPYLQAVI  277

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM IPLLVPHMNLHDAKL GYDIPAESKI VNAWWL NNP  WK PEEFRPERF
Sbjct  278  KETLRLRMPIPLLVPHMNLHDAKLSGYDIPAESKIFVNAWWLGNNPELWKKPEEFRPERF  337

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VEANGN+F+++PFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  338  LEEEANVEANGNEFKYVPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  397

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHST+V+KPR 
Sbjct  398  SEKGGQFSLHILKHSTVVLKPRA  420



>ref|XP_004500376.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cicer arietinum]
Length=505

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLRDEID +LGP  Q+TE DTHKLPYLQA+I
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPSIQNKLRDEIDKILGPKHQVTEQDTHKLPYLQAII  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM+IPLLVPHMNLHDAKLG YD  AESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMSIPLLVPHMNLHDAKLGSYDXXAESKILVNAWWLANNPVHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFRFLPFGVGRRSCPGIILALPI+GI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRFLPFGVGRRSCPGIILALPIIGITLGRLVQNFELLPPPGESKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV+KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVLKPRS  504



>gb|AAU09021.1| Cinnamic acid 4-hydroxylase [Agastache rugosa]
Length=502

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP VQ+K+R+E+D VLG G  +TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPEVQRKVREEMDRVLGVGVPVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESK+LVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKVLVNAWWLANNPEQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGKSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHIL HSTIVMKP
Sbjct  482  TEKGGQFSLHILNHSTIVMKP  502



>gb|ACB78015.1| cinnamic acid 4-hydroxylase, partial [Trifolium pratense]
Length=498

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  295  NINVAAIETTLWSIEWGIAELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVI  354

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  355  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  414

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  415  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  474

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  475  SEKGGQFSLHILKHSTIVAKPRS  497



>gb|AAS48416.1| cinammate 4-hydroxylase [Allium cepa]
Length=505

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KL+ E+D VLGPG Q+TEPDTH+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPKIQRKLQHELDTVLGPGTQITEPDTHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK+PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKDPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNF+L+PPPG  K+DT
Sbjct  422  LEEEAKVEANGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFDLMPPPGMDKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHIL HSTIV KPR 
Sbjct  482  TEKGGQFSLHILNHSTIVAKPRV  504



>ref|NP_001288861.1| trans-cinnamate 4-monooxygenase [Brassica rapa]
 dbj|BAI77481.1| cinnamate-4-hydroxylase [Brassica rapa]
Length=505

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            +ETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  EETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HSTIVMKPR 
Sbjct  482  SEKGGQFSLHILHHSTIVMKPRS  504



>gb|AFP49808.1| cinnamate 4-hydroxylase 4 [Coffea arabica]
Length=505

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQ+KLR EID VLGPG Q+TEPDT KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTLKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVLKPRS  504



>gb|AFD36436.1| cinnamate 4-hydroxylase 1 [Astragalus membranaceus]
Length=505

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q K+RDEID+VLGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQNKVRDEIDSVLGPGHQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  422  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQFKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGP25594.1| cinnamate 4-hydroxylase [Aquilaria sinensis]
Length=504

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q KLR E+D VLG G Q+TEPDTHKLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWAIAELVNHPEIQTKLRRELDTVLGVGHQITEPDTHKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ W   EEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWDRSEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFRFLPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  421  LEEESKVEANGNDFRFLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGCSKLDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEKGGQFSLHIL HSTIV KPR
Sbjct  481  TEKGGQFSLHILNHSTIVAKPR  502



>gb|ACR44227.1| C4H [Glycine max]
 gb|ADG63467.1| C4H [Glycine max]
Length=506

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAES+ILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESRILVNAWWLANNPAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT
Sbjct  423  FEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>ref|XP_003544934.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Glycine max]
Length=505

 Score =   309 bits (792),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+K+RDEID VL  G Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPIL I LGRLVQNFELLPPPG S++DT
Sbjct  422  LEEELHVEANGNDFRYLPFGVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|ABX74779.1| cinnamate-4-hydroxylase [Rubus coreanus]
Length=504

 Score =   309 bits (792),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIET LWSIEWGIAELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+
Sbjct  302  NINVAAIETALWSIEWGIAELVNHPEIQKKLRDELDTVLGHGVQVTEPEIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIVMKPR 
Sbjct  482  TEKGGQFSLHILKHSTIVMKPRT  504



>gb|AIB06733.1| cinnamate 4-mono-oxygenase [Mangifera indica]
Length=505

 Score =   309 bits (792),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q +LR E+D VLG G Q+TEPDT+KLP+LQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTRLRHELDTVLGRGVQITEPDTYKLPFLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDA LGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDANLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV +PR 
Sbjct  482  TEKGGQFSLHILKHSTIVARPRT  504



>gb|ABX74781.1| cinnamate-4-hydroxylase [Rubus sp. SSL-2007]
Length=504

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGRGVQITEPEIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHS IVMKPR 
Sbjct  482  TEKGGQFSLHILKHSPIVMKPRT  504



>ref|NP_001281035.1| trans-cinnamate 4-monooxygenase [Malus domestica]
 gb|AAY87450.1| cinnamic acid hydroxylase [Malus domestica]
Length=504

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLG G Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGRGVQITEPDVPKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRA  504



>gb|AFV47361.1| C4H [Helichrysum aureonitens]
Length=504

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D +LGPG Q+TEPD  KLPYLQAV+
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRNELDTILGPGVQVTEPDIQKLPYLQAVV  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPEQWKKPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE +VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  421  FEEESNVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHST+V KPR 
Sbjct  481  SEKGGQFSLHILKHSTVVAKPRS  503



>gb|ACB78016.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>gb|KFK22945.1| hypothetical protein AALP_AAs47561U000100 [Arabis alpina]
Length=505

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLG G Q+TEP+ HKLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGLGVQVTEPELHKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDF+++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFKYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HS IVMKPR 
Sbjct  482  SEKGGQFSLHILNHSIIVMKPRT  504



>ref|XP_004139932.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=505

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM IPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMTIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF++LPFG GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFKYLPFGAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVVKPRV  504



>ref|NP_001266151.1| trans-cinnamate 4-monooxygenase [Cicer arietinum]
 sp|O81928.2|TCMO_CICAR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Cicer 
arietinum]
 emb|CAA07519.2| trans-cinnamic 4-monooxygenase [Cicer arietinum]
Length=505

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+R+EID VLGPG Q+TEPD  KLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHQKIQNKVREEIDRVLGPGHQVTEPDLQKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLSGFDIPAESKILVNAWWLANNPAQWKKPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  421  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  481  AEKGGQFSLHILKHSTIVCKPRS  503



>gb|AIS92509.1| cinnamate 4-hydroxylase [Epimedium sagittatum]
Length=505

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +Q++LR+E+DA LGPG  +TEPDT+KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPKIQQRLREELDANLGPGVPITEPDTYKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL G+DIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLNGFDIPAESKILVNAWWLANNPEHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQEKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>gb|ACB78014.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHST+V KPR 
Sbjct  483  SEKGGQFSLHILKHSTVVAKPRS  505



>ref|XP_010922761.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLR+E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLRNELDTVLGPGVQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDA+LGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDARLGGYDIPAESKILVNAWWLANNPDNWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEA+GND R+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LQEEAKVEASGNDSRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRV  504



>prf||2209439A cytochrome P450 monooxygenase
Length=503

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  300  NINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  359

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAE+KILVNAWWL NNP+ WK PEEFRPERF
Sbjct  360  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAETKILVNAWWLRNNPALWKKPEEFRPERF  419

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  420  LEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGIHIGRLVQNFELLPPPGQSKIDT  479

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  480  SEKGGQFSLHILKHSTIVAKPRA  502



>gb|AEM63672.1| cinnamate 4-hydroxylase [Platycodon grandiflorus]
Length=505

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR EID VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQLKLRHEIDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMN HDAKLG YDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNPHDAKLGSYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  MEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHIL HSTIV K R 
Sbjct  482  AEKGGQFSLHILNHSTIVAKGRS  504



>gb|AFG30055.1| cinnamate-4-hydroxylase [Malus hybrid cultivar]
Length=504

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLG G Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGRGVQITEPDVPKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRIVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIVMKPR 
Sbjct  482  SEKGGQFSLHILKHSTIVMKPRA  504



>gb|ACJ37399.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQVTEPDLDKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WK PE FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDQWKEPEVFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKV T
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVGT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>ref|XP_007142041.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
 gb|ESW14035.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
Length=505

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+K R+E+D VLG G Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKAREEMDRVLGAGHQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRL+QNFELLPPPG S++DT
Sbjct  422  FEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLIQNFELLPPPGQSQIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_008363432.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Malus domestica]
Length=266

 Score =   299 bits (766),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            N+N  AIETT+WS+EWGIAELVN+P +QKKLR+E+DAVLG G Q+TEPD  KLPYLQAVI
Sbjct  64   NVNAAAIETTMWSMEWGIAELVNHPEIQKKLREELDAVLGRGVQITEPDIQKLPYLQAVI  123

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK P EFRPERF
Sbjct  124  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPTLWKKPXEFRPERF  183

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VE NGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  184  LEEESKVETNGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  243

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EK GQFSLH LKHSTIVMKP
Sbjct  244  SEKXGQFSLHJLKHSTIVMKP  264



>gb|ABA59555.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
 gb|ACA25599.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
Length=505

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLG YDIPAESKILVNAWWLANNPS WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGSYDIPAESKILVNAWWLANNPSKWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VE NGNDFR+LPFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG +K+DT
Sbjct  422  LEEESKVEPNGNDFRYLPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQNKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHILKHSTIV KP
Sbjct  482  TEKGGQFSLHILKHSTIVAKP  502



>emb|CDX84830.1| BnaA03g14000D [Brassica napus]
Length=503

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KL++EID VLGPG Q+TEPD HKLPYLQAV+
Sbjct  300  NINVAAIETTLWSIEWGIAELVNHPEIQSKLKNEIDTVLGPGVQVTEPDLHKLPYLQAVL  359

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM +PLLVPHMNL DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  360  KETLRLRMGVPLLVPHMNLKDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  419

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGI+LALPILGI +GRLVQNFELLPPPG SKVDT
Sbjct  420  LEEEAHVEANGNDFRYLPFGVGRRSCPGIVLALPILGITIGRLVQNFELLPPPGQSKVDT  479

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TE GGQFSL IL HSTIVMKPR 
Sbjct  480  TEIGGQFSLKILNHSTIVMKPRA  502



>sp|Q43240.1|TCMO_ZINVI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Zinnia 
violacea]
 gb|AAB42024.1| cinnamic acid 4-hydroxylase [Zinnia violacea]
Length=505

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q KLR E+ + LGPG Q+TEPD HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQAKLRHELVSQLGPGVQVTEPDLHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  KVDT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>dbj|BAJ95120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGLAELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GY+IPAESKILVNAW+LANNP  WK P+EFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>sp|Q9AR74.1|TCMO_RUTGR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Ruta 
graveolens]
 emb|CAC35977.1| putative cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR EID VLGP  Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPDIQKKLRAEIDRVLGPDHQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP+ WK+P+ FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPAHWKDPQVFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESGVEANGNDFRYIPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSL IL HSTIV+KPR 
Sbjct  482  SEKGGQFSLFILNHSTIVLKPRS  504



>gb|AAN63028.1| cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR EID VLGP  Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPDIQKKLRAEIDRVLGPDHQITEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP+ WK+P+ FRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPAHWKDPQVFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESGVEANGNDFRYIPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSL IL HSTIV+KPR 
Sbjct  482  SEKGGQFSLFILNHSTIVLKPRS  504



>gb|AHA84274.1| trans-cinnamate 4-monooxygenase [Phaseolus vulgaris]
Length=506

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+K R+E+D VLG G Q+TEPD  KLPYLQAV+
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEIQQKAREEMDRVLGAGHQVTEPDIQKLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRL+QNFELLPPPG S++DT
Sbjct  423  FEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLIQNFELLPPPGQSQIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>gb|AAG09206.1|AF175276_1 trans-cinnamic acid hydroxylase [Pisum sativum]
Length=332

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  137  NINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  196

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  197  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  256

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  257  LEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  316

Query  208  TEKGGQFSLHILKHST  161
            +EKGGQFSLHILKHST
Sbjct  317  SEKGGQFSLHILKHST  332



>gb|AFD29887.1| cinnamate 4-hydroxylase [Bambusa emeiensis]
Length=507

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW I ELVN+P +Q+KLR E+D VLGPG Q+TEPD HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIGELVNHPEIQRKLRHELDEVLGPGHQITEPDAHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAW+LANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLSGYDIPAESKILVNAWYLANNPDQWKRPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHS IV KPR 
Sbjct  482  AEKGGQFSLHILKHSNIVAKPRA  504



>ref|XP_008782669.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR E+D VLGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRQELDTVLGPGVQITEPDIPKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G DIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAGCDIPAESKILVNAWWLANNPDNWKNPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I +G+LVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILNITIGQLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVCKPRV  504



>ref|XP_009421412.1| PREDICTED: trans-cinnamate 4-monooxygenase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=503

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLR E+D+VLG G  +TEPD  KLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGVAELVNHPEIQRKLRHELDSVLGRGVPITEPDIQKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ W+NPEEF PERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWRNPEEFHPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQ+FELLPPPG SKVDT
Sbjct  421  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQDFELLPPPGVSKVDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  481  TEKGGQFSLHILKHSTIVCKPRA  503



>gb|ACM69364.1| cinnamic acid 4-hydroxylase [Humulus lupulus]
Length=505

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR E+D VLGPG Q+TEPD HKLPYL AVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRIELDTVLGPGVQITEPDMHKLPYLNAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+ AKLGGYDIPAESKILVNAWWLAN+P+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNQAKLGGYDIPAESKILVNAWWLANDPAHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFRFLPFGVGRRSCPGIILALPILGI +GRLVQNFELLPP G +K+DT
Sbjct  422  FEEESKVEANGNDFRFLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPAGQTKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV+KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVLKPRS  504



>gb|AHY94893.1| cinnamate-4-hydroxylase [Prunella vulgaris]
Length=505

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAELVN+P +Q KLR E+D VLGPG Q+TEPD +KLPYLQAV+
Sbjct  302  NINVAAIETTLWSVEWGIAELVNHPEIQNKLRHELDTVLGPGVQITEPDIYKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESK+LVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKVLVNAWWLANNPAQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+ T
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQKKIGT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSLHILKHSTIVMKP
Sbjct  482  SEKGGQFSLHILKHSTIVMKP  502



>ref|XP_009421411.1| PREDICTED: trans-cinnamate 4-monooxygenase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=513

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLR E+D+VLG G  +TEPD  KLPYLQAVI
Sbjct  311  NINVAAIETTLWSIEWGVAELVNHPEIQRKLRHELDSVLGRGVPITEPDIQKLPYLQAVI  370

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ W+NPEEF PERF
Sbjct  371  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWRNPEEFHPERF  430

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQ+FELLPPPG SKVDT
Sbjct  431  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQDFELLPPPGVSKVDT  490

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  491  TEKGGQFSLHILKHSTIVCKPRA  513



>ref|XP_006842509.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
 gb|ERN04184.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
Length=504

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D+VLGPG  +TEPDT+KLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHPHIQAKLRAELDSVLGPGVPITEPDTYKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKL GYDIPAESK+LVNAWWLANNP  W  PEEFRPERF
Sbjct  361  KETLRFRMAIPLLVPHMNLHDAKLTGYDIPAESKVLVNAWWLANNPDNWVRPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
              EE  VEANGNDFR+LPFGVGRRSCPGIILALPILG+ LGRLVQNFELLPPPG  KVDT
Sbjct  421  LAEEARVEANGNDFRYLPFGVGRRSCPGIILALPILGLTLGRLVQNFELLPPPGQDKVDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  481  TEKGGQFSLHILKHSTIVAKPRV  503



>ref|XP_009410039.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLR E+D VLGPG  +TEPD  KLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGVAELVNHPEIQRKLRQELDTVLGPGVPITEPDLQKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LG LVQ+FELLPPPG +KVDT
Sbjct  421  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGSLVQSFELLPPPGANKVDT  480

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  481  TEKGGQFSLHILKHSTIVCKPRA  503



>gb|ABE68874.1| cinnamate 4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  FEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EK GQFSL IL  STIVMKPR 
Sbjct  482  SEKSGQFSLQILNQSTIVMKPRA  504



>ref|XP_009374388.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=557

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLR+E+D VLG G Q+TEPD HKLP LQAV+
Sbjct  355  NINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPSLQAVV  414

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  415  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  474

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  475  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  534

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSLHILKHSTIVMKP
Sbjct  535  SEKGGQFSLHILKHSTIVMKP  555



>gb|AAT39513.1| cinnamate-4-hydroxylase [Camptotheca acuminata]
Length=505

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR EI  VLGPG Q+TEP+  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQQKLRHEIQTVLGPGTQVTEPEVQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNP+ W+ PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAHWQKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSLHILKHSTIV KP
Sbjct  482  SEKGGQFSLHILKHSTIVAKP  502



>sp|Q04468.1|TCMO_HELTU RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Helianthus 
tuberosus]
 emb|CAA78982.1| trans-cinnamate 4-monooxygenase [Helianthus tuberosus]
Length=505

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  DEKGGQFSLHILKHSTIVAKPRS  504



>gb|AGU91429.1| trans-cinnamate 4-monooxygenase [Chrysanthemum boreale]
Length=505

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>ref|XP_010542699.1| PREDICTED: trans-cinnamate 4-monooxygenase [Tarenaya hassleriana]
Length=505

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLG G Q+TEPD HKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQTKLRNELDTVLGHGVQITEPDIHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLH+ KLGGYD+PAESKILVNAW+LANNP+ WK P+EFRPERF
Sbjct  362  KETLRYRMAIPLLVPHMNLHEGKLGGYDVPAESKILVNAWFLANNPNNWKKPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S+VDT
Sbjct  422  LEEESNVEANGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSQVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHIL HSTIVMKPR 
Sbjct  482  TEKGGQFSLHILNHSTIVMKPRS  504



>gb|ADO16181.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=505

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>gb|ACF74449.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVDANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHST+V KPR 
Sbjct  482  AEKGGQFSLHILKHSTVVAKPRS  504



>ref|XP_008788521.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KL  E+D VLGPG Q+TEPDTHKLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLCKELDTVLGPGVQVTEPDTHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW LANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWLLANNPDHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             +EE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  ++DT
Sbjct  422  LQEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKQLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHILKHSTIV KPR 
Sbjct  482  AEKGGQFSLHILKHSTIVAKPRV  504



>emb|CBI15809.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAVI
Sbjct  276  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVI  335

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLGGYDIPAESKILVNAWWLAN+ S WK PEEFRPERF
Sbjct  336  KETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESKILVNAWWLANDSSKWKKPEEFRPERF  395

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DT
Sbjct  396  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDT  455

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            T KGGQFSLHILKHSTIV +P
Sbjct  456  TGKGGQFSLHILKHSTIVARP  476



>ref|XP_010931381.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEW IAELVN+P +Q+KLR+E+D  LGPG Q+TEPDT KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWAIAELVNHPEIQQKLRNELDTALGPGVQVTEPDTQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPEHWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VE  GNDFRFLPFGVGRRSCPGIILALPILGI +GRLVQNFELLPP G  K+DT
Sbjct  422  LEEEAKVEPTGNDFRFLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPAGQKKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRV  504



>gb|AHJ61295.1| cinnamate-4-hydroxylase [Hordeum vulgare]
Length=505

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGLAELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL  Y+IPAESKILVNAW+LA+NP  WK P+EFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLAAYNIPAESKILVNAWFLADNPEQWKRPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DT
Sbjct  422  LEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEKGGQFSLHILKHSTIV KPR 
Sbjct  482  TEKGGQFSLHILKHSTIVAKPRV  504



>ref|XP_002266238.1| PREDICTED: trans-cinnamate 4-monooxygenase [Vitis vinifera]
 emb|CAN77208.1| hypothetical protein VITISV_026676 [Vitis vinifera]
Length=505

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL+DAKLGGYDIPAESKILVNAWWLAN+ S WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLNDAKLGGYDIPAESKILVNAWWLANDSSKWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            T KGGQFSLHILKHSTIV +P
Sbjct  482  TGKGGQFSLHILKHSTIVARP  502



>ref|XP_010522015.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Tarenaya hassleriana]
Length=505

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q++LR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHQEIQRRLRNELDTVLGPGVQVTEPDIPKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAW+LANNP+ WK P+EFRPERF
Sbjct  362  KETLRYRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWYLANNPNNWKKPDEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S+VDT
Sbjct  422  LEEESQVEANGNDFRYIPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSQVDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHIL HSTIVMKP
Sbjct  482  TEKGGQFSLHILNHSTIVMKP  502



>gb|ACY78690.1| trans-cinnamate 4-monooxygenase [Cynara cardunculus var. scolymus]
Length=505

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLG YDIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGSYDIPAESKILVNAWWLANNPEQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+D 
Sbjct  422  FEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGMSKIDV  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSLHI  HSTIV KPR 
Sbjct  482  KEKGGQFSLHIXNHSTIVAKPRA  504



>ref|XP_009354880.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAELVN+P +QKKLR+E+DAVLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSMEWGIAELVNHPEIQKKLREELDAVLGRGVQITEPDIQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLQDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I +GRLV N ELLPP G SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILAITIGRLVHNLELLPPLGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EK GQFSLHILKHSTIVMKPR 
Sbjct  482  SEKSGQFSLHILKHSTIVMKPRA  504



>gb|AHG97392.1| C4H catalytic cinnamic acid-4-hydroxylase [Ageratina adenophora]
Length=505

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPEQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEA+GNDFR+LPFGVGRRSCPGIILA+PILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAKVEASGNDFRYLPFGVGRRSCPGIILAMPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLH LKHST+V KPR 
Sbjct  482  SEKGGQFSLHTLKHSTVVAKPRS  504



>gb|EYU36901.1| hypothetical protein MIMGU_mgv1a004876mg [Erythranthe guttata]
Length=506

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAEL+N+P +QKKLRDEID ++GPG Q+TEPDT++LPYLQAV+
Sbjct  303  NINVAAIETTLWSIEWGIAELINHPEIQKKLRDEIDTLVGPGVQITEPDTYRLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAW+LAN+ + WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWFLANDEAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DT
Sbjct  423  LEEESNVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGESKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            T K GQFSL ILKHSTIV+KPR 
Sbjct  483  TGKAGQFSLQILKHSTIVLKPRS  505



>gb|AAG09205.1|AF175275_1 trans-cinnamic acid hydroxylase [Pisum sativum]
Length=497

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHST  161
            +EKGGQFSLHILKHST
Sbjct  482  SEKGGQFSLHILKHST  497



>gb|ABR18390.1| unknown [Picea sitchensis]
Length=228

 Score =   293 bits (749),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EW IAELVN+  +Q K+R E++AVLG G Q+TEPDT +LPYLQAV+
Sbjct  24   NINVAAIETTLWSMEWAIAELVNHQDIQNKVRAELEAVLGHGVQITEPDTTRLPYLQAVV  83

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WKNP+EFRPERF
Sbjct  84   KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPENWKNPQEFRPERF  143

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEEK+ EANGNDF+FLPFGVGRRSCPGIILALP+L + +GRLVQNF LLPPPG SKVD 
Sbjct  144  FEEEKNTEANGNDFKFLPFGVGRRSCPGIILALPLLALSIGRLVQNFHLLPPPGQSKVDV  203

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHI+ HS IV KP
Sbjct  204  TEKGGQFSLHIVNHSLIVAKP  224



>gb|AGO03798.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=505

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  V+ANGNDFR+LPFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESKVDANGNDFRYLPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGVSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  482  SEKGGQFSLHILKHSTIVAKPRS  504



>sp|P37114.1|TCMO_MEDSA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Medicago 
sativa]
Length=506

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+R+E+D VLGPG Q+TEPD HKLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHQDIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHD KL G+DIPAESKILVNAWWL NNP+ WK PEEFRPERF
Sbjct  363  KETLRLRMAIPLLVPHMNLHDPKLNGFDIPAESKILVNAWWLPNNPAHWKKPEEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQN ELLPPPG SK+DT
Sbjct  423  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNVELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKHSTIV KPR 
Sbjct  483  SEKGGQFSLHILKHSTIVAKPRS  505



>gb|EMS54616.1| Trans-cinnamate 4-monooxygenase [Triticum urartu]
Length=436

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = -3

Query  733  AIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLR  554
            AIETTLWSIEWG+AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTHKLPYLQAVIKETLR
Sbjct  238  AIETTLWSIEWGLAELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHKLPYLQAVIKETLR  297

Query  553  LRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEK  374
            LRMAIPLLVPHMNLHDAKL GY+IPAESKILVNAW+LANNP  WK P+EFRPERF EEEK
Sbjct  298  LRMAIPLLVPHMNLHDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFRPERFLEEEK  357

Query  373  HVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGG  194
            HVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DTTEKGG
Sbjct  358  HVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFVLTPPPGQDKLDTTEKGG  417

Query  193  QFSLHILKHSTIVMKPRC  140
            QFSLHILKHSTIV KPR 
Sbjct  418  QFSLHILKHSTIVAKPRV  435



>ref|XP_006410151.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
 gb|ESQ51604.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
Length=505

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV A+ETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEP+  KLPYLQAV+
Sbjct  302  NINVAALETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPELQKLPYLQAVL  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM +PLLVPHMNL+DAKL GYDIPAESKILVNAWWLANNPS+WK PEEFRPERF
Sbjct  362  KETLRLRMGVPLLVPHMNLNDAKLAGYDIPAESKILVNAWWLANNPSSWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE HVE +GNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +KVD 
Sbjct  422  FEEESHVETSGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQTKVDN  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSL IL HSTIVMKPR 
Sbjct  482  SEKGGQFSLQILNHSTIVMKPRA  504



>dbj|BAJ17666.1| cinnamate 4-hydroxylase [Gynura bicolor]
Length=505

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWG+AELVN+P +Q KLR E+D  LGP  Q+TEPD   LPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGLAELVNHPKIQAKLRHELDTKLGPSVQITEPDVQNLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP  WKN  EFRPERF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDHWKNANEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I LGRLVQNFELLPPPG  K+D 
Sbjct  422  LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQDKIDM  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHILKH T+V KPR 
Sbjct  482  SEKGGQFSLHILKHYTVVAKPRS  504



>ref|XP_009132738.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=503

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q KLR+EID VLGPG Q+TEPD HKLPYLQ V+
Sbjct  300  NINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTVLGPGVQVTEPDLHKLPYLQVVL  359

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM +PLLVPHMNL DAKL GYDIPAESKILVNAWWL NN  +WK PEEFRPERF
Sbjct  360  KETLRLRMGVPLLVPHMNLKDAKLAGYDIPAESKILVNAWWLGNNSESWKKPEEFRPERF  419

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+LPFG+GRRSCPGI+LALPILGI +GRLVQNFEL PPPG SKVDT
Sbjct  420  LEEEAHVEANGNDFRYLPFGLGRRSCPGIVLALPILGITIGRLVQNFELFPPPGQSKVDT  479

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TE GGQFSL IL HSTIVMKPR 
Sbjct  480  TEIGGQFSLKILNHSTIVMKPRA  502



>sp|Q43033.1|TCMO_PETCR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Petroselinum 
crispum]
 gb|AAC41660.1| trans-cinnamate 4-monooxygenase [Petroselinum crispum]
Length=506

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +QKKLR E+D VLG G Q+ EPD  KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ W  P+EFRPERF
Sbjct  363  KETLRYRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWNKPDEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF+++PFGVGRRSCPGIILALPILGIV+GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEESKVEANGNDFKYIPFGVGRRSCPGIILALPILGIVIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSL ILKHSTIV KPR 
Sbjct  483  AEKGGQFSLQILKHSTIVCKPRS  505



>gb|AAG09207.1|AF175277_1 trans-cinnamic acid hydroxylase, partial [Pisum sativum]
Length=332

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV A+ETTLWSIEWGIAELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVI
Sbjct  137  NINVAAMETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVI  196

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHM+LHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  197  KETLRLRMAIPLLVPHMSLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERF  256

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR+L FGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  257  LEEEAHVEANGNDFRYLSFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  316

Query  208  TEKGGQFSLHILKHST  161
            +EKGGQFSLHILKHST
Sbjct  317  SEKGGQFSLHILKHST  332



>gb|AAO62904.1| cinnamate 4-hydroxylase [Ammi majus]
Length=506

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +QKKLR E+D VLG G Q+ EPD  KLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLH+AKL GYDIPAESKILVNAWWLANNP+ W  P+EFRPERF
Sbjct  363  KETLRYRMAIPLLVPHMNLHEAKLAGYDIPAESKILVNAWWLANNPAHWNKPDEFRPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF+++PFGVGRRSCPGIILALPILGIV+GRLVQNFELLPPPG SK+DT
Sbjct  423  LEEESKVEANGNDFKYIPFGVGRRSCPGIILALPILGIVIGRLVQNFELLPPPGQSKIDT  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EKGGQFSL ILKHSTIV KPR 
Sbjct  483  AEKGGQFSLQILKHSTIVCKPRS  505



>gb|AEA72281.1| cinnamate 4-hydroxylase [Angelica gigas]
Length=505

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +QKKLR+E+D VLG G Q+ EPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPEIQKKLRNEMDTVLGVGVQICEPDIQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNP EFRPERF
Sbjct  362  KETLRYRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKNPNEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF+++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFKYIPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGMSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EK GQFSL I KH TIV KPR 
Sbjct  482  AEKAGQFSLQISKHYTIVCKPRS  504



>gb|AJD22263.1| cinnamate 4-hydroxylase [Angelica dahurica]
Length=505

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVNNP +QKKLR+E+D VLG G Q+ EPD  KLPYLQAVI
Sbjct  302  NINVAAIETTLWSIEWGIAELVNNPEIQKKLRNEMDTVLGVGVQICEPDVQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNP EFRPERF
Sbjct  362  KETLRYRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKNPNEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDF+++PFGVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFKYIPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGMSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
             EK GQFSL I KH TIV KPR 
Sbjct  482  AEKAGQFSLQISKHYTIVCKPRS  504



>gb|ACY06865.2| cinnamate 4-hydroxylase [Astragalus chrysochlorus]
Length=506

 Score =   296 bits (759),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+  +Q K+RDEID++LGPG Q+TEPD  KLPYLQAVI
Sbjct  301  NINVAAIETTLWSIEWGIAELVNHQEIQNKVRDEIDSILGPGHQVTEPDIQKLPYLQAVI  360

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL G+DIPAESKILVNAWWLANNP  WKNPEEFRPERF
Sbjct  361  KETLRLRMAIPLLVPHMNLHDAKLAGFDIPAESKILVNAWWLANNPDHWKNPEEFRPERF  420

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiila--lpilgivlGRLVQNFELLPPPGHSKV  215
             EEE HVEANGNDFR+LPFGVGRRSCPGIILA  +  + +V+ +   NFELL PPG SK+
Sbjct  421  LEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLVVCKFGSNFELLSPPGQSKL  480

Query  214  DTTEKGGQFSLHILKHSTIVMKPRC  140
            DT+EKGGQFSLHILKHSTIV KPR 
Sbjct  481  DTSEKGGQFSLHILKHSTIVAKPRS  505



>gb|AID69233.1| cinnamate 4-hydroxylase [Garcinia mangostana]
Length=505

 Score =   296 bits (759),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  730  IETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRL  551
            + +TLWSIEWGIAELVN+P +QKKL  E+D +LGPG Q+TEPDT KLPYLQAVIKETLRL
Sbjct  308  LRSTLWSIEWGIAELVNHPEIQKKLHHELDTILGPGNQITEPDTQKLPYLQAVIKETLRL  367

Query  550  RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKH  371
            RMAIPLLVPHMNL+DAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  
Sbjct  368  RMAIPLLVPHMNLNDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESK  427

Query  370  VEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQ  191
            VEANGND+++LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S++DT+EKGGQ
Sbjct  428  VEANGNDYKYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSRIDTSEKGGQ  487

Query  190  FSLHILKHSTIVMKPRC  140
            FSLHILKHSTIV KPR 
Sbjct  488  FSLHILKHSTIVAKPRS  504



>gb|AEN19718.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 176/208 (85%), Gaps = 11/208 (5%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQKKLR E+D VLG G  +TEPDTHKLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEVQKKLRHEMDTVLGVGHLVTEPDTHKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGY+IPAESKILVNAWWLANNP+ WKN         
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLGGYEIPAESKILVNAWWLANNPAQWKN------PEE  416

Query  388  feeEKHVEANG-----NDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGH  224
            F  E+ +E  G     NDFRFLPFG GRRSCPGIILALPILGI +GR+VQNFELLPPPG 
Sbjct  417  FRPERFLEEGGKSGGRNDFRFLPFGSGRRSCPGIILALPILGITIGRMVQNFELLPPPGQ  476

Query  223  SKVDTTEKGGQFSLHILKHSTIVMKPRC  140
            SK+DT+EKGGQFSLHILKHSTIV KPR 
Sbjct  477  SKIDTSEKGGQFSLHILKHSTIVAKPRS  504



>gb|ABX75854.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 176/208 (85%), Gaps = 11/208 (5%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P VQKKLR E+D VLG G  +TEPDTHKLPYLQAVI
Sbjct  303  NINVAAIETTLWSIEWGIAELVNHPEVQKKLRHEMDTVLGVGHLVTEPDTHKLPYLQAVI  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGY+IPAESKILVNAWWLANNP+ WKN         
Sbjct  363  KETLRLRMAIPLLVPHMNLHDAKLGGYEIPAESKILVNAWWLANNPAQWKN------PEE  416

Query  388  feeEKHVEANG-----NDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGH  224
            F  E+ +E  G     NDFRFLPFG GRRSCPGIILALPILGI +GR+VQNFELLPPPG 
Sbjct  417  FRPERFLEEGGKSGGRNDFRFLPFGSGRRSCPGIILALPILGITIGRMVQNFELLPPPGQ  476

Query  223  SKVDTTEKGGQFSLHILKHSTIVMKPRC  140
            SK+DT+EKGGQFSLHILKHSTIV KPR 
Sbjct  477  SKIDTSEKGGQFSLHILKHSTIVAKPRS  504



>gb|AFU54390.1| cinnamate 4-hydroxylase [Fagopyrum tataricum]
Length=504

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDE+D VLG G  +TEPD  KLPYLQAV+
Sbjct  302  NINVAAIETTLWSIEWGIAELVNHPEIQRKLRDELDTVLGKGVPITEPDLPKLPYLQAVV  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRP RF
Sbjct  362  KETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAQWKKPEEFRPGRF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI++GRLVQNFE+ PPPG  K+DT
Sbjct  422  FEEEVKVEANGNDFRYLPFGVGRRSCPGIILALPILGIIIGRLVQNFEMFPPPGEDKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            +EKGGQFSL ILKH TIVMKP
Sbjct  482  SEKGGQFSLPILKHFTIVMKP  502



>gb|AFP89925.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=188

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  700  GIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPH  521
            GIAELVN+P VQ+KLR+EID VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPLLVPH
Sbjct  1    GIAELVNHPRVQRKLREEIDTVLGPGVQVTEPDTNKLPYLQAVIKETLRLRMAIPLLVPH  60

Query  520  MNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRF  341
            MNL+DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+
Sbjct  61   MNLYDAKLGGHDIPAESKILVNAWWLANNPENWKKPEEFRPERFLEEESKVEANGNDFRY  120

Query  340  LPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  161
            LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHST
Sbjct  121  LPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHST  180

Query  160  IVMKPRC  140
            IV+KPR 
Sbjct  181  IVLKPRS  187



>gb|ABF58026.1| cinnamate-4-hydroxylate-like [Hibiscus cannabinus]
 gb|ACR08417.1| cinnamate 4-hydroxylase [Hibiscus cannabinus]
 gb|ACU86960.1| cinnamate 4-hydroxylase 2 [Hibiscus cannabinus]
Length=444

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLRDEID VLGPG Q+TEPDTHKLPYLQAV+
Sbjct  258  NINVAAIETTLWSIEWGIAELVNHPRIQQKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVV  317

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  318  KETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERF  377

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
            FEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGR+VQNFELLPP G SK+DT
Sbjct  378  FEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRMVQNFELLPPNGQSKIDT  437

Query  208  TEKGGQF  188
            TEKGGQF
Sbjct  438  TEKGGQF  444



>emb|CDP18607.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            N+N   +ET LW++EWGIAELVN+P +Q KLRDEIDAVLGPG Q+TEPD  KLPYLQAVI
Sbjct  33   NMNFMVMETPLWTLEWGIAELVNHPQIQSKLRDEIDAVLGPGVQITEPDIDKLPYLQAVI  92

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETL+ R+ +P LVPHMNL+DAKLGGYD+PAESKILVN WWLANNP  WK PEEFRP+RF
Sbjct  93   KETLQFRVPVPFLVPHMNLNDAKLGGYDVPAESKILVNTWWLANNPENWKRPEEFRPQRF  152

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGI+LA+PIL + LG LVQNFELLPPPG SK+DT
Sbjct  153  LEEESKVEANGNDFRYLPFGVGRRSCPGIVLAMPILSLTLGCLVQNFELLPPPGQSKIDT  212

Query  208  TEKGGQFSLHILKHSTIVMKPR  143
            TEK GQFS H+L HSTIV+KPR
Sbjct  213  TEKSGQFSSHLLNHSTIVLKPR  234



>gb|AAW70021.1| cinnamic acid 4-hydroxylase [Ginkgo biloba]
Length=505

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWG+AE+VN+P +Q+K+R E+D VLGPG ++TEPDT +LPYLQAV+
Sbjct  303  NINVAAIETTLWSMEWGLAEIVNHPDIQQKIRKELDTVLGPGVEITEPDTTRLPYLQAVV  362

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRL MAIPLLVPHMNL+ AKLGGYDIPAESKILVNAWWLANNP  W  PEEF PERF
Sbjct  363  KETLRLHMAIPLLVPHMNLNQAKLGGYDIPAESKILVNAWWLANNPEWWNKPEEFIPERF  422

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             E+E+ +EANGNDFRFLPFGVGRRSCPGIILALPIL + LGRLVQNF+L PPPGHSKVD 
Sbjct  423  LEDEQKIEANGNDFRFLPFGVGRRSCPGIILALPILALSLGRLVQNFDLSPPPGHSKVDV  482

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HS +V KPR 
Sbjct  483  SEKGGQFSLHILNHSVVVAKPRV  505



>gb|AFX98061.1| cinnamate 4-hydroxylase [Cunninghamia lanceolata]
Length=508

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NIN  AIETTLWSIEWGIAELVN+P +Q KLR+E+D VLG G Q+TEPD  +LPYLQAV+
Sbjct  305  NINAAAIETTLWSIEWGIAELVNHPHIQNKLREELDIVLGRGVQITEPDIIRLPYLQAVV  364

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMA PLLVPHMNL+DAKLGGYDIPAESKILVN+W+LANNP+ W NP++FRPERF
Sbjct  365  KETLRLRMATPLLVPHMNLYDAKLGGYDIPAESKILVNSWYLANNPAEWDNPQQFRPERF  424

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEEK  EANGNDFR+LPFGVGRRSCPG+ILALPILG+ LGRLVQNFELLPPPGH+++DT
Sbjct  425  LEEEKKTEANGNDFRYLPFGVGRRSCPGVILALPILGLSLGRLVQNFELLPPPGHTRLDT  484

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEK GQFSL IL HS IV KPR 
Sbjct  485  TEKAGQFSLKILNHSLIVAKPRV  507



>gb|AFP89917.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89918.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89919.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89920.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89921.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89922.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89923.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89926.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89927.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
 gb|AFP89928.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=188

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -3

Query  700  GIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPH  521
            GIAELVN+P VQ+KLR+EID VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPLLVPH
Sbjct  1    GIAELVNHPRVQRKLREEIDTVLGPGVQVTEPDTNKLPYLQAVIKETLRLRMAIPLLVPH  60

Query  520  MNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRF  341
            MNL+DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+
Sbjct  61   MNLNDAKLGGHDIPAESKILVNAWWLANNPENWKKPEEFRPERFLEEESKVEANGNDFRY  120

Query  340  LPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  161
            LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHST
Sbjct  121  LPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHST  180

Query  160  IVMKPRC  140
            IV+KPR 
Sbjct  181  IVLKPRS  187



>emb|CDY29671.1| BnaA04g17560D [Brassica napus]
Length=505

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTL S+EWGIAELVN+P +Q KLR+EID VLGPG  +TEP  HKLPYLQAVI
Sbjct  302  NINVAAIETTLTSMEWGIAELVNHPEIQSKLRNEIDTVLGPGVHVTEPALHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KET+R RMA+PLLVPHMNL DAKL GYDIPAES+IL+NAWWLANNP +W +PEEFRPERF
Sbjct  362  KETIRRRMAVPLLVPHMNLKDAKLAGYDIPAESRILINAWWLANNPDSWNSPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EK GQFSL IL  STIVMKPR 
Sbjct  482  SEKSGQFSLQILNQSTIVMKPRA  504



>ref|XP_009141067.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTL S+EWGIAELVN+P +Q KLR+EID VLGPG  +TEP  HKLPYLQAVI
Sbjct  302  NINVAAIETTLTSMEWGIAELVNHPEIQSKLRNEIDTVLGPGVHVTEPALHKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KET+R RMA+PLLVPHMNL DAKL GYDIPAES+IL+NAWWLANNP +W +PEEFRPERF
Sbjct  362  KETIRRRMAVPLLVPHMNLKDAKLAGYDIPAESRILINAWWLANNPDSWNSPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR++PFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAHVEANGNDFRYVPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EK GQFSL IL  STIVMKPR 
Sbjct  482  SEKSGQFSLQILNQSTIVMKPRA  504



>gb|ACN40359.1| unknown [Picea sitchensis]
Length=506

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 181/203 (89%), Gaps = 1/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWGIAE+VN+P +Q+K+RDE+DAV+G G  LTEPDT +LPYLQAV+
Sbjct  305  NINVAAIETTLWSMEWGIAEIVNHPEIQQKIRDELDAVVGRGVPLTEPDTVRLPYLQAVV  364

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRL MAIPLLVPHMNLH AKLGGYDIPAESKILVNAW+LANNP  WKNPEEF PERF
Sbjct  365  KETLRLHMAIPLLVPHMNLHQAKLGGYDIPAESKILVNAWFLANNPEWWKNPEEFIPERF  424

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             E+EK +EA+GNDFRFLPFGVGRRSCPGIILALPIL + +GRLVQNFELLPPPG S VD 
Sbjct  425  LEDEK-IEASGNDFRFLPFGVGRRSCPGIILALPILSLAIGRLVQNFELLPPPGQSNVDV  483

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EKGGQFSLHIL HS +V KPR 
Sbjct  484  SEKGGQFSLHILNHSVVVAKPRA  506



>gb|AIT52343.1| cinammate 4-hydroxylase 2 [Daucus carota]
Length=312

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -3

Query  733  AIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLR  554
            AI+TTL SIEW IAEL+N+P VQKKLR EID+VLG G Q+TEPDTHKLPYL+AVIKETLR
Sbjct  114  AIDTTLRSIEWAIAELINHPEVQKKLRHEIDSVLGVGVQVTEPDTHKLPYLEAVIKETLR  173

Query  553  LRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEK  374
            LRM +PLLVPHMNL DAKLGGYDIPA+SK++VNAWWLANNP+ WKNPEEFRPERF EEE 
Sbjct  174  LRMGVPLLVPHMNLDDAKLGGYDIPAKSKVVVNAWWLANNPAHWKNPEEFRPERFMEEES  233

Query  373  HVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGG  194
            +VEANGNDFRFLPFG GRRSCPGI+ ALPI+GI LGRLVQNFELLPPPG SK+DT EK G
Sbjct  234  NVEANGNDFRFLPFGAGRRSCPGIMTALPIMGITLGRLVQNFELLPPPGQSKIDTAEKRG  293

Query  193  QFSLHILKHSTIVMKPRC  140
            QF L ILKHST+V KPR 
Sbjct  294  QFLLQILKHSTVVAKPRS  311



>gb|AHY28686.1| cinnamate 4-hydroxylase 1, partial [Pinus echinata]
 gb|AHY28689.1| cinnamate 4-hydroxylase 1, partial [Pinus echinata]
 gb|AHY28691.1| cinnamate 4-hydroxylase 1, partial [Pinus elliottii]
 gb|AHY28694.1| cinnamate 4-hydroxylase 1, partial [Pinus elliottii]
 gb|AHY28697.1| cinnamate 4-hydroxylase 1, partial [Pinus palustris]
 gb|AHY28699.1| cinnamate 4-hydroxylase 1, partial [Pinus palustris]
 gb|AHY28702.1| cinnamate 4-hydroxylase 1, partial [Pinus taeda]
 gb|AHY28704.1| cinnamate 4-hydroxylase 1, partial [Pinus taeda]
Length=199

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -3

Query  730  IETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRL  551
            IETTLWS+EWGIAELVN+  +Q K+R E+DAVLGPG Q+TEPDT +LPYLQAV+KETLRL
Sbjct  1    IETTLWSMEWGIAELVNHQDIQSKVRAELDAVLGPGVQITEPDTTRLPYLQAVVKETLRL  60

Query  550  RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKH  371
            RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  
Sbjct  61   RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFFEEEXX  120

Query  370  VEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQ  191
                 NDF+FLPFGVGRRSCPGIILALP+L + +GRLVQNF LLPPPG SKVD TEKGGQ
Sbjct  121  XXXXXNDFKFLPFGVGRRSCPGIILALPLLALSIGRLVQNFHLLPPPGQSKVDVTEKGGQ  180

Query  190  FSLHILKHSTIVMKP  146
            FSLHIL HS IV KP
Sbjct  181  FSLHILNHSLIVAKP  195



>gb|AFP89924.1| cinnamate 4-hydroxylase, partial [Neolamarckia cadamba]
Length=188

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -3

Query  700  GIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPH  521
            GIAELVN+P VQ+KLR+EID VLGPG Q+TEPDT+KL YLQAVIKETLRLRMAIPLLVPH
Sbjct  1    GIAELVNHPRVQRKLREEIDTVLGPGVQVTEPDTNKLLYLQAVIKETLRLRMAIPLLVPH  60

Query  520  MNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRF  341
            MNL+DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+
Sbjct  61   MNLNDAKLGGHDIPAESKILVNAWWLANNPENWKKPEEFRPERFLEEESKVEANGNDFRY  120

Query  340  LPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  161
            LPFGVGRRSCPGI+LALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHST
Sbjct  121  LPFGVGRRSCPGIVLALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHST  180

Query  160  IVMKPRC  140
            IV+KPR 
Sbjct  181  IVLKPRS  187



>ref|XP_009354901.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NIN  AIE+TL SIEWGIAELVN+P  QKKLR+E+D VLG G Q+TEPD  KLPYLQAVI
Sbjct  302  NINAAAIESTLLSIEWGIAELVNHPDSQKKLREELDTVLGRGVQITEPDIQKLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRM IPLL+PHMNL DAKL G+DIPA SKILVNAWWLANNP+ WK PEEFRPERF
Sbjct  362  KETLRLRMTIPLLLPHMNLKDAKLSGFDIPAGSKILVNAWWLANNPAMWKKPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPIL I +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILCITIGRLVQNFELLPPPGQSKLDT  481

Query  208  TEKGGQFSLHILKHSTIVMKP  146
             EK GQFSLHILKHSTIVMKP
Sbjct  482  LEKCGQFSLHILKHSTIVMKP  502



>gb|AIE16481.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16482.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16483.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16484.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16485.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16486.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16487.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16488.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16489.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16490.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16491.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16492.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16493.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16494.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16495.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16496.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16497.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16498.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16499.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16500.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16501.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16502.1| cinnamate 4-hydroxylase, partial [Glycine soja]
 gb|AIE16503.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16504.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16505.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16506.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16507.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16508.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16509.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16510.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16511.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16512.1| cinnamate 4-hydroxylase, partial [Glycine max]
 gb|AIE16513.1| cinnamate 4-hydroxylase, partial [Glycine max]
Length=184

 Score =   275 bits (704),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  730  IETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRL  551
            IETTLWSIEWGIAELVN+P +Q+K+RDEID VL  G Q+TEPD  KLPYLQAV+KETLRL
Sbjct  1    IETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVVKETLRL  60

Query  550  RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKH  371
            RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE H
Sbjct  61   RMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEELH  120

Query  370  VEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQ  191
            VEANGNDFR+LPFGVGRRSCPGIILALPIL I LGRLVQNFELLPPPG S++DT+EKGGQ
Sbjct  121  VEANGNDFRYLPFGVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQSQIDTSEKGGQ  180

Query  190  FSLH  179
            FSLH
Sbjct  181  FSLH  184



>ref|XP_004151467.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
 ref|XP_004173174.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=507

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EW IAELVN+P +Q K+RDE+D+VL  G Q+TEPD  KLPYLQAVI
Sbjct  304  NINVAAIETTLWSMEWAIAELVNHPNIQSKVRDELDSVLKDGVQITEPDIRKLPYLQAVI  363

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGGYDIPAESKILVNAWWLANNP  W  P+EFRPERF
Sbjct  364  KETLRLRMAIPLLVPHMNLQDAKLGGYDIPAESKILVNAWWLANNPDHWNKPQEFRPERF  423

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE +VE +GNDFR+LPFG GRRSCPGIILALPIL I LGRL+QNFEL+PPPG SK+DT
Sbjct  424  LEEEGNVEPSGNDFRYLPFGAGRRSCPGIILALPILAITLGRLLQNFELMPPPGQSKIDT  483

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEK GQFSL I  HSTIV KPR 
Sbjct  484  TEKPGQFSLQIFNHSTIVAKPRS  506



>ref|XP_008457287.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis melo]
Length=507

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EW IAELVN+P +Q K+RDE+D+VL  G Q+TEPD   LPYLQAVI
Sbjct  304  NINVAAIETTLWSMEWAIAELVNHPNIQSKVRDELDSVLKDGVQITEPDIRNLPYLQAVI  363

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNL DAKLGGYDIPAESKILVNAWWLANNP  W  P+EFRPERF
Sbjct  364  KETLRLRMAIPLLVPHMNLQDAKLGGYDIPAESKILVNAWWLANNPDHWNKPQEFRPERF  423

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE++VE +GNDFR+LPFG GRRSCPGIILALPIL I LGRL+QNFEL+PPPG SK+DT
Sbjct  424  LEEEENVEPSGNDFRYLPFGAGRRSCPGIILALPILAITLGRLLQNFELMPPPGQSKIDT  483

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEK GQFSL I  HSTIV KPR 
Sbjct  484  TEKPGQFSLQIFNHSTIVAKPRS  506



>emb|CDX97827.1| BnaC04g41120D [Brassica napus]
Length=505

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTL S+EWGIAELVN+P +Q KLR+EID VLG G Q+TEP+ H+LPYLQAVI
Sbjct  302  NINVAAIETTLTSMEWGIAELVNHPDIQSKLRNEIDTVLGLGVQVTEPELHRLPYLQAVI  361

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KET+R RMA+PLLVPHMNL DAKL GYDIP ES+IL+NAWWLANNP +W +PEEFRPERF
Sbjct  362  KETIRRRMAVPLLVPHMNLKDAKLAGYDIPEESRILINAWWLANNPDSWNSPEEFRPERF  421

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE HVEANGNDFR++PFG GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  422  LEEEAHVEANGNDFRYVPFGAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDT  481

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            +EK GQFSL IL  STIVMKPR 
Sbjct  482  SEKRGQFSLQILNQSTIVMKPRA  504



>gb|AAD23378.1|AF096998_1 trans-cinnamate 4-hydroxylase [Pinus taeda]
Length=506

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 178/201 (89%), Gaps = 1/201 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWS+EWG+AE+VN+P +Q+K+R E+DAV+G G  LTEPDT KLPYLQAV+
Sbjct  305  NINVAAIETTLWSMEWGLAEIVNHPEIQQKIRAELDAVIGRGVPLTEPDTTKLPYLQAVV  364

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRL MAIPLLVPHMNLH AKLGGYDIPAESKILVNAW+LANNP  W+ PEEF PERF
Sbjct  365  KETLRLHMAIPLLVPHMNLHQAKLGGYDIPAESKILVNAWFLANNPEWWEKPEEFIPERF  424

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
              EEK +EA+GNDFRFLPFGVGRRSCPGIILALPIL + LGRLVQNFELLPPPG SKVD 
Sbjct  425  LGEEK-IEASGNDFRFLPFGVGRRSCPGIILALPILALALGRLVQNFELLPPPGQSKVDV  483

Query  208  TEKGGQFSLHILKHSTIVMKP  146
            TEKGGQFSLHIL HS +V KP
Sbjct  484  TEKGGQFSLHILNHSVVVAKP  504



>emb|CAK95274.1| cinnamate-4-hydroxylase [Cucumis melo]
Length=189

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV AIETTLWSIEWGIAELVN+P +Q+KLR+E+D VLGPG  +TEP+THKLPYLQAVI
Sbjct  9    NINVAAIETTLWSIEWGIAELVNHPEIQRKLRNELDTVLGPGVLITEPETHKLPYLQAVI  68

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF
Sbjct  69   KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERF  128

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT
Sbjct  129  LEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDT  188

Query  208  T  206
            +
Sbjct  189  S  189



>gb|AHF20175.1| cinnamate 4-hydroxylase, partial [Musa acuminata AAA Group]
Length=393

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 178/203 (88%), Gaps = 1/203 (0%)
 Frame = -3

Query  748  NINVXAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVI  569
            NINV A+ETTLWSIEWGIAELVNNP +Q+KL  E+D VLG   Q+TEPD  +LPYLQAV+
Sbjct  191  NINVAALETTLWSIEWGIAELVNNPEIQRKLGAELDVVLGRD-QITEPDLQRLPYLQAVV  249

Query  568  KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperf  389
            KETLR RMAIPLLVPHMNL+ AKLGG+DIP ESKILVNAWWLANNP+ W+ PEEFRPERF
Sbjct  250  KETLRYRMAIPLLVPHMNLNHAKLGGFDIPGESKILVNAWWLANNPAHWRKPEEFRPERF  309

Query  388  feeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDT  209
             EEE  VEA+GNDFR+LPFG GRRSCPGIILALPI+GI LGRLVQNFELLPPPG +K+DT
Sbjct  310  LEEEAKVEASGNDFRYLPFGAGRRSCPGIILALPIIGITLGRLVQNFELLPPPGQAKIDT  369

Query  208  TEKGGQFSLHILKHSTIVMKPRC  140
            TEK GQFSL I+KHST+V KPR 
Sbjct  370  TEKAGQFSLQIMKHSTVVCKPRV  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840