BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015O15

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602281.1|  PREDICTED: uncharacterized protein LOC104097433    208   2e-63   Nicotiana tomentosiformis
ref|XP_009800007.1|  PREDICTED: uncharacterized protein LOC104245986    207   3e-63   Nicotiana sylvestris
ref|XP_006353669.1|  PREDICTED: uncharacterized protein LOC102581215    187   1e-55   Solanum tuberosum [potatoes]
ref|XP_010322724.1|  PREDICTED: uncharacterized protein LOC101265245    186   5e-55   
ref|XP_009624814.1|  PREDICTED: uncharacterized protein LOC104115808    181   5e-53   
ref|XP_010244875.1|  PREDICTED: uncharacterized protein LOC104588581    181   8e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010250328.1|  PREDICTED: uncharacterized protein LOC104592576    180   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_003633146.1|  PREDICTED: putative protein TPRXL                  174   2e-50   Vitis vinifera
ref|XP_010648721.1|  PREDICTED: uncharacterized protein LOC100266438    174   4e-50   Vitis vinifera
emb|CAN72752.1|  hypothetical protein VITISV_030561                     173   3e-49   Vitis vinifera
gb|AFK41588.1|  unknown                                                 169   1e-48   Medicago truncatula
ref|XP_009387687.1|  PREDICTED: uncharacterized protein LOC103974562    168   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ83954.1|  unknown                                                 168   4e-48   Medicago truncatula
gb|AFK45204.1|  unknown                                                 168   4e-48   Medicago truncatula
gb|ACJ84160.1|  unknown                                                 167   1e-47   Medicago truncatula
gb|ACJ86153.1|  unknown                                                 166   2e-47   Medicago truncatula
ref|XP_004508409.1|  PREDICTED: putative protein TPRXL-like             165   1e-46   Cicer arietinum [garbanzo]
ref|XP_009355793.1|  PREDICTED: uncharacterized protein LOC103946738    165   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_007155099.1|  hypothetical protein PHAVU_003G173100g             163   5e-46   Phaseolus vulgaris [French bean]
ref|XP_007013641.1|  Serine-rich protein-related                        163   6e-46   
ref|XP_003542665.1|  PREDICTED: trinucleotide repeat-containing g...    162   9e-46   Glycine max [soybeans]
ref|XP_008394152.1|  PREDICTED: dual specificity tyrosine-phospho...    162   2e-45   Malus domestica [apple tree]
gb|EPS66288.1|  hypothetical protein M569_08491                         162   2e-45   Genlisea aurea
gb|KJB64619.1|  hypothetical protein B456_010G057600                    160   4e-45   Gossypium raimondii
ref|XP_007202593.1|  hypothetical protein PRUPE_ppa011611mg             160   4e-45   Prunus persica
gb|AGV54226.1|  hypothetical protein                                    160   8e-45   Phaseolus vulgaris [French bean]
ref|XP_004139263.1|  PREDICTED: uncharacterized protein LOC101209...    160   8e-45   
gb|KJB53963.1|  hypothetical protein B456_009G013700                    160   8e-45   Gossypium raimondii
ref|XP_009393722.1|  PREDICTED: uncharacterized protein LOC103979335    159   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008242917.1|  PREDICTED: putative protein TPRXL                  159   1e-44   Prunus mume [ume]
ref|XP_007226111.1|  hypothetical protein PRUPE_ppa011080mg             160   1e-44   Prunus persica
ref|XP_003544605.1|  PREDICTED: uncharacterized protein LOC100814735    159   2e-44   Glycine max [soybeans]
ref|XP_009362322.1|  PREDICTED: uncharacterized protein JIP4-like       159   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_008219542.1|  PREDICTED: putative protein TPRXL                  158   6e-44   Prunus mume [ume]
ref|XP_009769290.1|  PREDICTED: uncharacterized protein LOC104220170    157   1e-43   Nicotiana sylvestris
ref|XP_008802034.1|  PREDICTED: uncharacterized protein LOC103715996    156   1e-43   Phoenix dactylifera
ref|XP_009403190.1|  PREDICTED: uncharacterized protein LOC103986811    156   2e-43   
ref|XP_010533108.1|  PREDICTED: uncharacterized protein LOC104808950    156   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_004146710.1|  PREDICTED: uncharacterized protein LOC101217...    156   2e-43   Cucumis sativus [cucumbers]
ref|XP_010913363.1|  PREDICTED: uncharacterized protein LOC105039072    156   4e-43   Elaeis guineensis
ref|XP_008443919.1|  PREDICTED: uncharacterized serine-rich prote...    155   5e-43   
emb|CDP10497.1|  unnamed protein product                                154   1e-42   Coffea canephora [robusta coffee]
gb|EYU20232.1|  hypothetical protein MIMGU_mgv1a018309mg                155   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_008366660.1|  PREDICTED: putative protein TPRXL                  155   1e-42   
gb|AFK42940.1|  unknown                                                 153   2e-42   Lotus japonicus
emb|CDP18810.1|  unnamed protein product                                154   2e-42   Coffea canephora [robusta coffee]
gb|KJB23691.1|  hypothetical protein B456_004G110000                    154   2e-42   Gossypium raimondii
ref|XP_003550193.1|  PREDICTED: uncharacterized serine-rich prote...    153   2e-42   Glycine max [soybeans]
gb|KHN48540.1|  hypothetical protein glysoja_041593                     153   2e-42   Glycine soja [wild soybean]
ref|XP_009622884.1|  PREDICTED: uncharacterized protein LOC104114...    153   3e-42   Nicotiana tomentosiformis
ref|XP_002324885.1|  hypothetical protein POPTR_0018s02140g             153   3e-42   
gb|KHN07053.1|  hypothetical protein glysoja_023236                     153   5e-42   Glycine soja [wild soybean]
ref|XP_010047203.1|  PREDICTED: homeobox protein Nkx-6.1-like           153   6e-42   Eucalyptus grandis [rose gum]
ref|XP_007161188.1|  hypothetical protein PHAVU_001G049400g             152   6e-42   Phaseolus vulgaris [French bean]
ref|XP_003522528.1|  PREDICTED: putative protein TPRXL-like             153   6e-42   
ref|XP_004235914.1|  PREDICTED: uncharacterized protein LOC101263595    150   8e-42   
ref|XP_003526301.1|  PREDICTED: putative protein TPRXL-like             152   8e-42   
gb|KHG27589.1|  Vitamin K-dependent S                                   152   9e-42   Gossypium arboreum [tree cotton]
ref|XP_006341382.1|  PREDICTED: uncharacterized protein LOC102606030    150   9e-42   
ref|XP_007136989.1|  hypothetical protein PHAVU_009G090900g             152   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004501356.1|  PREDICTED: 1-phosphatidylinositol 3-phosphat...    152   1e-41   
ref|XP_006359514.1|  PREDICTED: uncharacterized serine-rich prote...    152   1e-41   Solanum tuberosum [potatoes]
ref|XP_003549713.1|  PREDICTED: trinucleotide repeat-containing g...    151   2e-41   Glycine max [soybeans]
ref|XP_010519639.1|  PREDICTED: putative protein TPRXL                  151   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_011036619.1|  PREDICTED: putative protein TPRXL                  151   2e-41   Populus euphratica
ref|XP_010687825.1|  PREDICTED: uncharacterized protein LOC104901900    150   2e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU19325.1|  unknown                                                 151   3e-41   Glycine max [soybeans]
gb|KDP37028.1|  hypothetical protein JCGZ_06084                         150   4e-41   Jatropha curcas
ref|XP_010908362.1|  PREDICTED: uncharacterized protein LOC105034782    150   5e-41   
ref|XP_009778673.1|  PREDICTED: uncharacterized protein LOC104227990    150   5e-41   Nicotiana sylvestris
emb|CBI25574.3|  unnamed protein product                                151   5e-41   Vitis vinifera
ref|XP_009611326.1|  PREDICTED: uncharacterized protein LOC104104846    150   5e-41   Nicotiana tomentosiformis
ref|XP_008354346.1|  PREDICTED: uncharacterized protein LOC103417967    150   6e-41   
gb|KHG18275.1|  hypothetical protein F383_09858                         150   6e-41   Gossypium arboreum [tree cotton]
ref|XP_010691070.1|  PREDICTED: putative protein TPRXL                  149   7e-41   
gb|KCW80272.1|  hypothetical protein EUGRSUZ_C01627                     147   7e-41   Eucalyptus grandis [rose gum]
gb|KDP30200.1|  hypothetical protein JCGZ_16982                         149   1e-40   Jatropha curcas
ref|XP_010050691.1|  PREDICTED: uncharacterized protein LOC104439311    150   1e-40   
ref|XP_009358531.1|  PREDICTED: uncharacterized protein LOC103949156    149   1e-40   
ref|XP_009363915.1|  PREDICTED: uncharacterized protein LOC103953846    149   1e-40   Pyrus x bretschneideri [bai li]
emb|CDO98193.1|  unnamed protein product                                149   1e-40   Coffea canephora [robusta coffee]
ref|XP_009338399.1|  PREDICTED: uncharacterized protein LOC103930750    149   1e-40   
ref|XP_010048163.1|  PREDICTED: uncharacterized protein LOC104437010    149   2e-40   Eucalyptus grandis [rose gum]
ref|XP_002271365.1|  PREDICTED: uncharacterized protein LOC100242170    149   2e-40   Vitis vinifera
ref|XP_009798216.1|  PREDICTED: uncharacterized protein LOC104244483    149   2e-40   Nicotiana sylvestris
ref|XP_008788890.1|  PREDICTED: uncharacterized protein LOC103706534    149   2e-40   Phoenix dactylifera
ref|XP_003533861.1|  PREDICTED: uncharacterized protein LOC100794542    148   2e-40   Glycine max [soybeans]
ref|XP_004498757.1|  PREDICTED: vitellogenin-2-like                     148   2e-40   
ref|XP_009799051.1|  PREDICTED: uncharacterized protein LOC104245184    147   2e-40   Nicotiana sylvestris
ref|XP_002531449.1|  conserved hypothetical protein                     148   3e-40   Ricinus communis
ref|XP_010099865.1|  hypothetical protein L484_008522                   148   3e-40   Morus notabilis
ref|XP_003546585.1|  PREDICTED: putative protein TPRXL-like             147   4e-40   Glycine max [soybeans]
gb|AFK38729.1|  unknown                                                 148   4e-40   Medicago truncatula
ref|XP_006465228.1|  PREDICTED: vitellogenin-2-like                     147   6e-40   Citrus sinensis [apfelsine]
gb|EYU32362.1|  hypothetical protein MIMGU_mgv1a014368mg                147   6e-40   Erythranthe guttata [common monkey flower]
ref|XP_006450364.1|  hypothetical protein CICLE_v10009513mg             147   9e-40   Citrus clementina [clementine]
ref|XP_006483414.1|  PREDICTED: uncharacterized protein DDB_G0271...    147   1e-39   Citrus sinensis [apfelsine]
ref|XP_008336956.1|  PREDICTED: putative protein TPRXL                  146   1e-39   
ref|XP_011458842.1|  PREDICTED: putative protein TPRXL                  147   1e-39   Fragaria vesca subsp. vesca
gb|ABA40431.1|  unknown                                                 147   1e-39   Solanum tuberosum [potatoes]
ref|XP_006427484.1|  hypothetical protein CICLE_v10027309mg             146   2e-39   Citrus clementina [clementine]
ref|XP_010323270.1|  PREDICTED: uncharacterized protein LOC101254911    146   2e-39   Solanum lycopersicum
gb|KDP33557.1|  hypothetical protein JCGZ_07128                         146   2e-39   Jatropha curcas
ref|XP_004287242.1|  PREDICTED: uncharacterized protein LOC101298453    145   2e-39   Fragaria vesca subsp. vesca
ref|XP_003603342.1|  hypothetical protein MTR_3g106530                  147   2e-39   
gb|EYU25275.1|  hypothetical protein MIMGU_mgv1a014625mg                145   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_010557627.1|  PREDICTED: uncharacterized protein LOC104826566    145   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_009407367.1|  PREDICTED: mucin-1-like                            145   6e-39   
ref|XP_002309648.1|  serine-rich family protein                         145   7e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006356235.1|  PREDICTED: uncharacterized protein LOC102603646    144   7e-39   Solanum tuberosum [potatoes]
ref|XP_010927347.1|  PREDICTED: uncharacterized protein LOC105049415    144   1e-38   Elaeis guineensis
ref|XP_004507199.1|  PREDICTED: uncharacterized protein LOC101499615    143   1e-38   
ref|XP_008452898.1|  PREDICTED: putative protein TPRXL                  144   1e-38   Cucumis melo [Oriental melon]
ref|XP_011078547.1|  PREDICTED: uncharacterized protein LOC105162252    143   2e-38   Sesamum indicum [beniseed]
gb|AAN62344.1|AF506028_11  CTV.15                                       143   2e-38   Citrus trifoliata [hardy orange]
ref|XP_010555066.1|  PREDICTED: uncharacterized protein PB18E9.04...    143   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_010033986.1|  PREDICTED: uncharacterized protein LOC104423200    143   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006350113.1|  PREDICTED: uncharacterized protein LOC102599166    142   3e-38   Solanum tuberosum [potatoes]
ref|XP_011020249.1|  PREDICTED: uncharacterized protein LOC105122688    143   3e-38   Populus euphratica
ref|XP_008813132.1|  PREDICTED: uncharacterized protein LOC103723846    142   5e-38   
ref|XP_006381071.1|  hypothetical protein POPTR_0006s05980g             142   6e-38   
ref|XP_007224858.1|  hypothetical protein PRUPE_ppa022839mg             140   7e-38   
ref|XP_004251739.1|  PREDICTED: uncharacterized protein LOC101264293    140   9e-38   Solanum lycopersicum
gb|EYU25274.1|  hypothetical protein MIMGU_mgv1a014567mg                141   9e-38   Erythranthe guttata [common monkey flower]
ref|XP_007138468.1|  hypothetical protein PHAVU_009G211700g             141   1e-37   Phaseolus vulgaris [French bean]
ref|XP_002515469.1|  conserved hypothetical protein                     141   2e-37   
ref|XP_004157087.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    141   2e-37   
ref|XP_009596910.1|  PREDICTED: uncharacterized protein LOC104092917    139   3e-37   Nicotiana tomentosiformis
ref|XP_011073376.1|  PREDICTED: uncharacterized protein LOC105158345    140   3e-37   Sesamum indicum [beniseed]
ref|XP_011039624.1|  PREDICTED: uncharacterized serine-rich prote...    140   3e-37   Populus euphratica
ref|XP_004145523.1|  PREDICTED: uncharacterized protein LOC101218391    140   4e-37   Cucumis sativus [cucumbers]
ref|XP_010097160.1|  hypothetical protein L484_025705                   139   6e-37   Morus notabilis
ref|XP_011017923.1|  PREDICTED: uncharacterized protein LOC105121103    140   6e-37   Populus euphratica
ref|XP_002519910.1|  conserved hypothetical protein                     140   6e-37   Ricinus communis
ref|XP_006394776.1|  hypothetical protein EUTSA_v10004807mg             140   6e-37   
ref|XP_009616804.1|  PREDICTED: uncharacterized protein LOC104109268    139   7e-37   Nicotiana tomentosiformis
ref|XP_006852817.1|  hypothetical protein AMTR_s00033p00173430          137   1e-36   
emb|CDX87091.1|  BnaC09g04060D                                          139   1e-36   
ref|XP_010665660.1|  PREDICTED: uncharacterized serine-rich prote...    139   1e-36   
ref|XP_004488522.1|  PREDICTED: uncharacterized protein LOC101494844    137   4e-36   Cicer arietinum [garbanzo]
ref|XP_009125255.1|  PREDICTED: putative protein TPRXL                  137   4e-36   Brassica rapa
ref|XP_008445241.1|  PREDICTED: uncharacterized protein LOC103488327    137   4e-36   Cucumis melo [Oriental melon]
gb|KFK27780.1|  hypothetical protein AALP_AA8G427900                    137   5e-36   Arabis alpina [alpine rockcress]
ref|XP_008775758.1|  PREDICTED: uncharacterized protein LOC103696036    137   5e-36   Phoenix dactylifera
ref|XP_004241685.1|  PREDICTED: uncharacterized protein LOC101259944    136   1e-35   Solanum lycopersicum
ref|XP_008228742.1|  PREDICTED: uncharacterized serine-rich prote...    136   1e-35   Prunus mume [ume]
ref|XP_009401387.1|  PREDICTED: uncharacterized protein LOC103985422    134   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324583.1|  hypothetical protein POPTR_0018s12410g             135   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006399610.1|  hypothetical protein EUTSA_v10014629mg             135   4e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010421380.1|  PREDICTED: hypha-specific G1 cyclin-related ...    135   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007014526.1|  Serine-rich protein-related                        134   6e-35   
ref|XP_008364364.1|  PREDICTED: uncharacterized serine-rich prote...    134   8e-35   Malus domestica [apple tree]
ref|XP_008454197.1|  PREDICTED: putative protein TPRXL                  134   8e-35   Cucumis melo [Oriental melon]
emb|CDX70380.1|  BnaC03g04640D                                          134   9e-35   
gb|EYU21687.1|  hypothetical protein MIMGU_mgv1a024748mg                130   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_010493781.1|  PREDICTED: squamosa promoter-binding-like pr...    134   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009131193.1|  PREDICTED: cell wall integrity and stress re...    134   2e-34   Brassica rapa
ref|XP_006288644.1|  hypothetical protein CARUB_v10001949mg             133   2e-34   
ref|XP_007023329.1|  Serine-rich protein-related, putative              132   3e-34   Theobroma cacao [chocolate]
ref|XP_009151048.1|  PREDICTED: uncharacterized protein LOC103874389    132   4e-34   Brassica rapa
ref|XP_009111663.1|  PREDICTED: uncharacterized protein LOC103837086    131   6e-34   
ref|XP_010040344.1|  PREDICTED: uncharacterized protein LOC104429140    131   6e-34   
gb|ABL97972.1|  serine-rich protein                                     131   7e-34   Brassica rapa
gb|EPS66146.1|  hypothetical protein M569_08632                         130   1e-33   Genlisea aurea
ref|XP_010454851.1|  PREDICTED: putative protein TPRXL                  131   1e-33   Camelina sativa [gold-of-pleasure]
emb|CDX97080.1|  BnaC09g45450D                                          130   2e-33   
ref|XP_006288623.1|  hypothetical protein CARUB_v10001925mg             130   2e-33   Capsella rubella
ref|XP_009121994.1|  PREDICTED: putative protein TPRXL                  130   2e-33   Brassica rapa
ref|XP_009338490.1|  PREDICTED: putative protein TPRXL                  131   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_010419664.1|  PREDICTED: putative protein TPRXL                  130   3e-33   Camelina sativa [gold-of-pleasure]
emb|CDX69786.1|  BnaA10g21350D                                          129   4e-33   
gb|AFB32810.1|  hypothetical protein 0_3046_01                          127   5e-33   Pinus mugo [mountain pine]
emb|CDX85730.1|  BnaA02g00830D                                          130   5e-33   
ref|XP_002872151.1|  hypothetical protein ARALYDRAFT_489379             129   6e-33   
emb|CDX88167.1|  BnaA06g27580D                                          128   7e-33   
gb|AFG60223.1|  hypothetical protein 0_3046_01                          127   8e-33   Pinus taeda
ref|NP_196670.1|  serine-rich protein-like protein                      129   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152334.1|  PREDICTED: uncharacterized protein LOC101207294    127   1e-32   Cucumis sativus [cucumbers]
gb|AFB32809.1|  hypothetical protein 0_3046_01                          126   2e-32   Pinus mugo [mountain pine]
ref|NP_197910.1|  serine-rich protein-like protein                      128   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67211.1|  serine-rich protein                                     128   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491804.1|  PREDICTED: putative protein TPRXL                  128   2e-32   Camelina sativa [gold-of-pleasure]
gb|AFG60224.1|  hypothetical protein 0_3046_01                          125   3e-32   Pinus taeda
ref|XP_010456484.1|  PREDICTED: putative protein TPRXL                  127   4e-32   Camelina sativa [gold-of-pleasure]
emb|CDX80497.1|  BnaC07g29470D                                          127   4e-32   
ref|XP_002871454.1|  hypothetical protein ARALYDRAFT_487941             127   8e-32   
emb|CDY51107.1|  BnaCnng20100D                                          126   1e-31   Brassica napus [oilseed rape]
gb|AEW07499.1|  hypothetical protein 0_3046_01                          124   1e-31   Pinus radiata
ref|XP_002530465.1|  conserved hypothetical protein                     125   1e-31   Ricinus communis
gb|EYU34940.1|  hypothetical protein MIMGU_mgv1a024024mg                125   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_004138717.1|  PREDICTED: uncharacterized protein LOC101214709    125   2e-31   Cucumis sativus [cucumbers]
ref|XP_011084060.1|  PREDICTED: uncharacterized protein LOC105166416    124   6e-31   
gb|AEW07500.1|  hypothetical protein 0_3046_01                          121   1e-30   Pinus lambertiana
gb|ABK21216.1|  unknown                                                 121   2e-30   Picea sitchensis
gb|KCW81351.1|  hypothetical protein EUGRSUZ_C02733                     122   2e-30   Eucalyptus grandis [rose gum]
gb|ABR18379.1|  unknown                                                 120   5e-30   Picea sitchensis
ref|XP_010051172.1|  PREDICTED: forkhead box protein C1-like            122   7e-30   
ref|XP_010097175.1|  hypothetical protein L484_025721                   119   2e-29   
ref|XP_010097173.1|  hypothetical protein L484_025719                   118   6e-29   
ref|XP_010097172.1|  hypothetical protein L484_025718                   118   7e-29   
ref|XP_007150776.1|  hypothetical protein PHAVU_005G179600g             116   5e-28   Phaseolus vulgaris [French bean]
gb|ABR17408.1|  unknown                                                 114   9e-28   Picea sitchensis
gb|ADE76856.1|  unknown                                                 115   1e-27   Picea sitchensis
gb|KEH37892.1|  hypothetical protein MTR_2g450700                       112   2e-27   Medicago truncatula
ref|XP_009793128.1|  PREDICTED: uncharacterized protein LOC104240041    113   2e-27   Nicotiana sylvestris
ref|XP_011467044.1|  PREDICTED: uncharacterized protein LOC105352242    114   4e-27   Fragaria vesca subsp. vesca
gb|KHN22423.1|  hypothetical protein glysoja_024932                     112   7e-27   Glycine soja [wild soybean]
ref|XP_009600832.1|  PREDICTED: uncharacterized protein LOC104096200    111   2e-26   Nicotiana tomentosiformis
gb|ABK26255.1|  unknown                                                 109   1e-25   Picea sitchensis
gb|ABK27079.1|  unknown                                                 106   3e-24   Picea sitchensis
ref|XP_011468518.1|  PREDICTED: uncharacterized protein LOC105352658    105   5e-24   Fragaria vesca subsp. vesca
ref|XP_010236437.1|  PREDICTED: uncharacterized protein LOC104584037    101   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_004486636.1|  PREDICTED: probable serine/threonine-protein...    102   8e-23   Cicer arietinum [garbanzo]
ref|XP_010109762.1|  hypothetical protein L484_008438                 95.1    2e-20   
gb|AEX12199.1|  hypothetical protein 0_7218_01                        90.9    1e-19   Pinus taeda
gb|AEX12200.1|  hypothetical protein 0_7218_01                        89.4    4e-19   Pinus taeda
ref|XP_003597954.1|  hypothetical protein MTR_2g104380                89.7    3e-18   Medicago truncatula
gb|EAZ05724.1|  hypothetical protein OsI_27951                        87.4    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010520684.1|  PREDICTED: uncharacterized protein LOC104799741  86.7    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_009131795.1|  PREDICTED: uncharacterized protein LOC103856443  86.7    2e-17   Brassica rapa
gb|AFK36164.1|  unknown                                               86.7    5e-17   Medicago truncatula
gb|AFW57201.1|  hypothetical protein ZEAMMB73_692989                  84.3    1e-16   
emb|CDY51848.1|  BnaA03g56150D                                        82.8    4e-16   Brassica napus [oilseed rape]
gb|KFK26276.1|  hypothetical protein AALP_AA8G225800                  82.4    7e-16   Arabis alpina [alpine rockcress]
ref|XP_004954250.1|  PREDICTED: uncharacterized protein LOC101761531  82.4    9e-16   Setaria italica
ref|XP_002873994.1|  hypothetical protein ARALYDRAFT_910077           80.9    2e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006400605.1|  hypothetical protein EUTSA_v10015868mg           80.1    6e-15   Eutrema salsugineum [saltwater cress]
gb|AEX12216.1|  hypothetical protein 0_7218_01                        77.8    6e-15   Pinus radiata
ref|XP_010493142.1|  PREDICTED: uncharacterized protein LOC104770417  79.7    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002443921.1|  hypothetical protein SORBIDRAFT_07g004400        78.6    2e-14   
gb|KFK29077.1|  hypothetical protein AALP_AA7G085900                  77.0    3e-14   Arabis alpina [alpine rockcress]
ref|NP_197537.1|  serine-rich protein-like protein                    77.8    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454341.1|  PREDICTED: uncharacterized protein LOC104736112  77.4    4e-14   Camelina sativa [gold-of-pleasure]
gb|KJB53962.1|  hypothetical protein B456_009G013600                  75.5    6e-14   Gossypium raimondii
ref|XP_007202930.1|  hypothetical protein PRUPE_ppa016664mg           74.3    1e-13   
emb|CDX70925.1|  BnaC03g10090D                                        75.5    1e-13   
ref|XP_006286710.1|  hypothetical protein CARUB_v10002860mg           75.9    2e-13   Capsella rubella
emb|CDY68410.1|  BnaAnng27180D                                        73.9    5e-13   Brassica napus [oilseed rape]
ref|XP_009126442.1|  PREDICTED: uncharacterized protein LOC103851346  73.2    8e-13   Brassica rapa
gb|AEW08800.1|  hypothetical protein CL1668Contig1_02                 70.5    1e-12   Pinus radiata
ref|XP_010244874.1|  PREDICTED: uncharacterized protein LOC104588580  72.0    1e-12   
ref|NP_001237708.1|  uncharacterized protein LOC100306623             71.2    2e-12   
gb|AFG50839.1|  hypothetical protein CL1668Contig1_02                 69.7    2e-12   Pinus taeda
gb|KHN47128.1|  hypothetical protein glysoja_022429                   70.9    2e-12   Glycine soja [wild soybean]
gb|EAY87888.1|  hypothetical protein OsI_09309                        71.2    5e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001048411.1|  Os02g0799700                                     71.2    5e-12   
gb|EAZ24963.1|  hypothetical protein OsJ_08744                        71.2    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CDP06279.1|  unnamed protein product                              69.3    7e-12   Coffea canephora [robusta coffee]
ref|XP_009760525.1|  PREDICTED: uncharacterized protein LOC104212863  68.9    7e-12   Nicotiana sylvestris
ref|XP_007013642.1|  Serine-rich protein-related                      69.7    8e-12   
ref|XP_010250390.1|  PREDICTED: uncharacterized protein LOC104592655  69.3    9e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002531450.1|  conserved hypothetical protein                   68.9    1e-11   
gb|KHN18609.1|  hypothetical protein glysoja_007022                   68.9    1e-11   Glycine soja [wild soybean]
ref|XP_011020364.1|  PREDICTED: uncharacterized protein LOC105122774  68.9    1e-11   Populus euphratica
gb|ADR71309.1|  hypothetical protein 31                               68.6    2e-11   Hevea brasiliensis [jebe]
ref|XP_004158821.1|  PREDICTED: uncharacterized protein LOC101225219  68.6    2e-11   
ref|XP_004974402.1|  PREDICTED: uncharacterized protein DKFZp434B...  69.3    3e-11   Setaria italica
gb|KHN18312.1|  hypothetical protein glysoja_042632                   67.8    3e-11   Glycine soja [wild soybean]
ref|XP_009782553.1|  PREDICTED: uncharacterized protein LOC104231284  67.0    3e-11   Nicotiana sylvestris
ref|XP_006381070.1|  hypothetical protein POPTR_0006s05970g           67.8    4e-11   
ref|XP_006588084.1|  PREDICTED: uncharacterized protein LOC102666822  68.2    8e-11   
ref|XP_010541934.1|  PREDICTED: uncharacterized protein LOC104815293  66.6    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_008461151.1|  PREDICTED: uncharacterized protein LOC103499822  66.2    1e-10   Cucumis melo [Oriental melon]
ref|NP_001147376.1|  serine-rich protein                              67.0    1e-10   Zea mays [maize]
ref|XP_007023339.1|  Uncharacterized protein TCM_027325               65.5    2e-10   
ref|XP_002324582.1|  hypothetical protein POPTR_0018s12400g           64.7    4e-10   
gb|KJB23692.1|  hypothetical protein B456_004G110100                  64.3    4e-10   Gossypium raimondii
ref|XP_011073608.1|  PREDICTED: uncharacterized protein LOC105158524  63.9    6e-10   Sesamum indicum [beniseed]
ref|XP_009792193.1|  PREDICTED: uncharacterized protein LOC104239287  64.7    7e-10   Nicotiana sylvestris
ref|XP_008809760.1|  PREDICTED: uncharacterized protein LOC103721363  63.5    9e-10   
ref|NP_001152496.1|  serine-rich protein                              64.7    9e-10   
ref|XP_010323269.1|  PREDICTED: uncharacterized protein LOC104648150  63.2    1e-09   
gb|EAZ41642.1|  hypothetical protein OsJ_26176                        64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008228767.1|  PREDICTED: uncharacterized protein LOC103328152  63.2    2e-09   Prunus mume [ume]
ref|XP_008360803.1|  PREDICTED: putative protein TPRXL                64.3    2e-09   
ref|XP_007216798.1|  hypothetical protein PRUPE_ppa023541mg           62.8    2e-09   
ref|XP_006852816.1|  hypothetical protein AMTR_s00033p00172620        62.4    3e-09   
dbj|BAJ96323.1|  predicted protein                                    62.0    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006465240.1|  PREDICTED: uncharacterized protein LOC102617517  61.6    5e-09   
ref|XP_009385099.1|  PREDICTED: uncharacterized protein LOC103972467  61.6    5e-09   
ref|XP_007138467.1|  hypothetical protein PHAVU_009G211600g           61.6    5e-09   
gb|KJB64617.1|  hypothetical protein B456_010G057500                  60.8    7e-09   
ref|XP_003570325.1|  PREDICTED: uncharacterized protein LOC100836253  62.4    7e-09   
ref|XP_006427503.1|  hypothetical protein CICLE_v10027369mg           61.2    7e-09   
emb|CAN74150.1|  hypothetical protein VITISV_023981                   48.9    1e-08   
ref|XP_010050329.1|  PREDICTED: uncharacterized protein LOC104438870  59.7    2e-08   
ref|XP_004146739.1|  PREDICTED: uncharacterized protein LOC101204798  59.7    2e-08   
gb|KJB56576.1|  hypothetical protein B456_009G126000                  59.7    3e-08   
ref|XP_008377776.1|  PREDICTED: uncharacterized protein LOC103440850  58.9    3e-08   
gb|EMT18951.1|  hypothetical protein F775_11958                       60.1    3e-08   
ref|XP_008456582.1|  PREDICTED: putative protein TPRXL                58.5    9e-08   
ref|XP_008802029.1|  PREDICTED: uncharacterized protein LOC103715988  57.8    1e-07   
ref|XP_004139264.1|  PREDICTED: uncharacterized protein LOC101209...  58.2    1e-07   
ref|XP_009397724.1|  PREDICTED: uncharacterized protein LOC103982505  59.7    2e-07   
ref|XP_008443918.1|  PREDICTED: uncharacterized protein LOC103487396  56.6    3e-07   
gb|AFW64127.1|  hypothetical protein ZEAMMB73_142867                  56.2    4e-07   
ref|XP_010040345.1|  PREDICTED: uncharacterized protein LOC104429141  55.8    5e-07   
ref|XP_008679215.1|  PREDICTED: uncharacterized protein LOC103654170  55.8    1e-06   
gb|ABF96447.1|  hypothetical protein LOC_Os03g28100                   57.4    2e-06   
gb|AAP12938.1|  hypothetical protein Os03g28100                       57.4    2e-06   
ref|XP_004954249.1|  PREDICTED: uncharacterized protein LOC101761145  53.9    3e-06   
ref|XP_008356661.1|  PREDICTED: uncharacterized protein LOC103420373  53.1    5e-06   
dbj|BAC99537.1|  hypothetical protein                                 55.8    6e-06   
ref|NP_001147141.1|  serine-rich protein                              53.5    8e-06   
ref|XP_002454719.1|  hypothetical protein SORBIDRAFT_04g036170        53.5    1e-05   
gb|EEC75489.1|  hypothetical protein OsI_12085                        52.8    1e-05   
ref|XP_009362621.1|  PREDICTED: uncharacterized protein LOC103952691  51.6    2e-05   
ref|XP_004508408.1|  PREDICTED: uncharacterized protein LOC101509340  51.6    3e-05   
gb|AFW57202.1|  hypothetical protein ZEAMMB73_979990                  50.4    6e-05   
gb|EMS49515.1|  hypothetical protein TRIUR3_11808                     51.6    6e-05   
ref|XP_008646399.1|  PREDICTED: uncharacterized protein LOC103627864  49.7    1e-04   
ref|XP_007160342.1|  hypothetical protein PHAVU_002G313700g           48.9    1e-04   
ref|XP_006448005.1|  hypothetical protein CICLE_v10017139mg           49.3    2e-04   
gb|EMS46172.1|  hypothetical protein TRIUR3_29521                     50.4    3e-04   
ref|XP_009770895.1|  PREDICTED: uncharacterized protein LOC104221523  47.8    4e-04   



>ref|XP_009602281.1| PREDICTED: uncharacterized protein LOC104097433 [Nicotiana tomentosiformis]
Length=213

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LHG A   PTPSV+FSIDRSISPHRS++VS RDQVVRKQ   NPL  LPK+TC+CSPT+H
Sbjct  72   LHGFAPLAPTPSVKFSIDRSISPHRSMAVSSRDQVVRKQN-NNPLTKLPKRTCMCSPTTH  130

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCSLHKNMN+ PS+  PS RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH
Sbjct  131  PGSFRCSLHKNMNTAPSMYSPS-RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  189

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRR DFQPRPSRLSRMSKAE+
Sbjct  190  HQRRRADFQPRPSRLSRMSKAED  212



>ref|XP_009800007.1| PREDICTED: uncharacterized protein LOC104245986 [Nicotiana sylvestris]
Length=213

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LHG A   PTPSV+FSIDRSISPHRS++VS RDQVVRKQ   NPL  LPK+TC+CSPT+H
Sbjct  72   LHGFAPLAPTPSVKFSIDRSISPHRSMAVSSRDQVVRKQN-NNPLTKLPKRTCMCSPTTH  130

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCSLHKNMN+ PS+  PS RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH
Sbjct  131  PGSFRCSLHKNMNTAPSMYSPS-RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  189

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRR DFQPRPSRLSRMSKAE+
Sbjct  190  HQRRRADFQPRPSRLSRMSKAED  212



>ref|XP_006353669.1| PREDICTED: uncharacterized protein LOC102581215 [Solanum tuberosum]
Length=204

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 8/143 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LH  A    TPSVRFSIDRSISP RS++VS+RDQVVRKQ        +PK+TCLCSPT+H
Sbjct  69   LHALAPVNSTPSVRFSIDRSISPRRSMAVSQRDQVVRKQ--------IPKRTCLCSPTTH  120

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCS+HKN+ + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPSSH
Sbjct  121  PGSFRCSMHKNVKNIPSISYSPSRLNARRSAMTNSLVRIWSVEGDLVKRALAALIRPSSH  180

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRRGDFQPRPSRLSRMSKA+ 
Sbjct  181  HQRRRGDFQPRPSRLSRMSKADN  203



>ref|XP_010322724.1| PREDICTED: uncharacterized protein LOC101265245 [Solanum lycopersicum]
Length=204

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 8/143 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LH  A    +PSVRFSIDRSISP RS++VS+RDQVVRKQ        +PK+TCLCSPT+H
Sbjct  69   LHALAPVNSSPSVRFSIDRSISPRRSMAVSQRDQVVRKQ--------IPKRTCLCSPTTH  120

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCS+HKN+ + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPSSH
Sbjct  121  PGSFRCSMHKNVKNTPSISYSPSRLNARRSAMTNSLVRICSVEGDLVKRALAALIRPSSH  180

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRRGDFQPRPSRLSRMSKA+ 
Sbjct  181  HQRRRGDFQPRPSRLSRMSKADN  203



>ref|XP_009624814.1| PREDICTED: uncharacterized protein LOC104115808 [Nicotiana tomentosiformis]
 ref|XP_009624815.1| PREDICTED: uncharacterized protein LOC104115808 [Nicotiana tomentosiformis]
Length=194

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 8/140 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LH  A    TPSV+F IDRS SP RSV+VS+RDQVVRKQ        +PK+TCLCSPT+H
Sbjct  62   LHALAPVNSTPSVKFFIDRSSSPRRSVAVSQRDQVVRKQ--------IPKRTCLCSPTTH  113

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCS+HKNM + PSISY  +RLNARRSAMTNSLVRI +VEGDLVKRALAALIRPSSH
Sbjct  114  PGSFRCSMHKNMRNTPSISYSPSRLNARRSAMTNSLVRIWSVEGDLVKRALAALIRPSSH  173

Query  319  QQRRRGDFQPRPSRLSRMSK  260
             QRRRGDFQPRPSRLSRMSK
Sbjct  174  HQRRRGDFQPRPSRLSRMSK  193



>ref|XP_010244875.1| PREDICTED: uncharacterized protein LOC104588581 [Nelumbo nucifera]
Length=210

 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCSPT  506
            L+G A   P+PSVRFSI RSISP RS++VS R+QVV+KQ   NPL+  +  KKTC+CSPT
Sbjct  69   LYGPA--PPSPSVRFSIGRSISPSRSIAVSPRNQVVKKQS--NPLSGPSSQKKTCMCSPT  124

Query  505  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            +HPGSFRCSLHKN N+  ++SYPSNRLNARRSAMTNSLVRIGTVEGD VKRALAALIRPS
Sbjct  125  THPGSFRCSLHKNFNNHHAVSYPSNRLNARRSAMTNSLVRIGTVEGDWVKRALAALIRPS  184

Query  325  SHQQRRRGDFQPRPSRLSRMSKAE  254
            SH QRRR  FQPRPSRLS MSKAE
Sbjct  185  SHHQRRRAAFQPRPSRLSFMSKAE  208



>ref|XP_010250328.1| PREDICTED: uncharacterized protein LOC104592576 [Nelumbo nucifera]
Length=207

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 5/135 (4%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCSPTSHPGSFRCSL  476
            PSVRFS+DRSISP+RS++V+ R+QVVRK  + NPL+  +  K+TCLCSPTSHPGSFRCSL
Sbjct  75   PSVRFSLDRSISPNRSIAVAPRNQVVRK--LSNPLSAPSSQKRTCLCSPTSHPGSFRCSL  132

Query  475  HKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            HKNMN++ ++SYPSNRLNARRSAMTNSLVRIGTVEG+ VKRALAALIRPSSHQQRRR  F
Sbjct  133  HKNMNNQ-AVSYPSNRLNARRSAMTNSLVRIGTVEGEWVKRALAALIRPSSHQQRRRAAF  191

Query  295  QPRPSRLSRMSKAEE  251
            QPRPSRLS MSKAE+
Sbjct  192  QPRPSRLSIMSKAED  206



>ref|XP_003633146.1| PREDICTED: putative protein TPRXL [Vitis vinifera]
Length=201

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 119/145 (82%), Gaps = 7/145 (5%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA--NLPKKTCLCSPT  506
            L+G A S+P  SVRFS+DR ISP RS+S + R QVV+K    NPL+  + PK++C+CSPT
Sbjct  61   LYGSAPSSP--SVRFSLDRPISPSRSISATPRTQVVKKHT--NPLSAPSTPKRSCMCSPT  116

Query  505  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            +HPGSFRCSLHK  N+  S  Y SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS
Sbjct  117  THPGSFRCSLHKGFNNH-SAPYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  175

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SHQQRRR  FQPRPSRLS MSKAE+
Sbjct  176  SHQQRRRSGFQPRPSRLSNMSKAED  200



>ref|XP_010648721.1| PREDICTED: uncharacterized protein LOC100266438 [Vitis vinifera]
Length=207

 Score =   174 bits (440),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 113/133 (85%), Gaps = 9/133 (7%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            SVRFSIDRSISP RS++V RRDQ+VRK        + PKK C+CSPT+HPGSFRCSLHKN
Sbjct  82   SVRFSIDRSISPSRSIAVPRRDQIVRK--------STPKKRCMCSPTTHPGSFRCSLHKN  133

Query  466  MN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  290
             N S  +ISY SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  FQP
Sbjct  134  FNNSSHTISYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRAAFQP  193

Query  289  RPSRLSRMSKAEE  251
            RPSRLS MSKAE+
Sbjct  194  RPSRLSIMSKAED  206



>emb|CAN72752.1| hypothetical protein VITISV_030561 [Vitis vinifera]
Length=269

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 119/145 (82%), Gaps = 13/145 (9%)
 Frame = -1

Query  679  LHGXASSTP-TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTS  503
            L+G   STP   SVRFSIDRSISP RS++V RRDQ+VRK        + PKK C+CSPT+
Sbjct  73   LYG---STPLASSVRFSIDRSISPSRSIAVPRRDQIVRK--------STPKKRCMCSPTT  121

Query  502  HPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            HPGSFRCSLHKN N S  +ISY SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS
Sbjct  122  HPGSFRCSLHKNFNNSSHTISYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  181

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SHQQRRR  FQPRPSRLS MSKAE+
Sbjct  182  SHQQRRRAAFQPRPSRLSIMSKAED  206



>gb|AFK41588.1| unknown [Medicago truncatula]
 gb|KEH32154.1| plant/F18G18-20 protein [Medicago truncatula]
Length=203

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 112/144 (78%), Gaps = 9/144 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT+H
Sbjct  67   LYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPTTH  118

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSS
Sbjct  119  PGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSS  178

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQ+RRGDF PRPSRLS M+KA++
Sbjct  179  HQQKRRGDFHPRPSRLSVMTKAQD  202



>ref|XP_009387687.1| PREDICTED: uncharacterized protein LOC103974562 [Musa acuminata 
subsp. malaccensis]
Length=193

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 104/144 (72%), Gaps = 26/144 (18%)
 Frame = -1

Query  658  TPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK-------TCLCSPTSH  500
            TP P VRF+IDRS SP                  G  LA   K+       TCLCSPT+H
Sbjct  67   TPAPGVRFTIDRSTSP------------------GRSLATANKRSSASVHRTCLCSPTTH  108

Query  499  PGSFRCSLHKNMNSR-PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK ++SR  ++S PSN LNARRSAMTNSLVRIGTVEGD VKRALAALIRPSS
Sbjct  109  PGSFRCSLHKGLSSRSAAVSAPSNCLNARRSAMTNSLVRIGTVEGDWVKRALAALIRPSS  168

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQRRR DFQPRPSRLSRMSKA++
Sbjct  169  HQQRRRVDFQPRPSRLSRMSKADD  192



>gb|ACJ83954.1| unknown [Medicago truncatula]
Length=203

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 112/144 (78%), Gaps = 9/144 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT+H
Sbjct  67   LYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPTTH  118

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSS
Sbjct  119  PGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSS  178

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQ+RRGDF P+PSRLS M+KA++
Sbjct  179  HQQKRRGDFHPKPSRLSVMTKAQD  202



>gb|AFK45204.1| unknown [Medicago truncatula]
Length=202

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 111/144 (77%), Gaps = 9/144 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT+H
Sbjct  66   LYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPTTH  117

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR +++ Y  NR NARRSAMTNSLVRI  VEGDLVKRALAALIRPSS
Sbjct  118  PGSFRCSLHKGFGSRAAVTPYSQNRFNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSS  177

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQ+RRGDF PRPSRLS M+KA++
Sbjct  178  HQQKRRGDFHPRPSRLSVMTKAQD  201



>gb|ACJ84160.1| unknown [Medicago truncatula]
Length=202

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 111/144 (77%), Gaps = 9/144 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+ C+CSPT+H
Sbjct  66   LYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRICMCSPTTH  117

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSS
Sbjct  118  PGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSS  177

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQ+RRGDF PRPSRLS M+KA++
Sbjct  178  HQQKRRGDFHPRPSRLSVMTKAQD  201



>gb|ACJ86153.1| unknown [Medicago truncatula]
Length=203

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 111/144 (77%), Gaps = 9/144 (6%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G  SS    SVRFS+DRSISP+RS+S         + GV    ++ PK+TC+CSPT+H
Sbjct  67   LYG--SSPSASSVRFSLDRSISPNRSISAVP------RTGVKKQSSSQPKRTCMCSPTTH  118

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR +++ Y  NRLNARRSAMTNSLV I  VEGDLVKRALAALIRPSS
Sbjct  119  PGSFRCSLHKGFGSRAAVTPYSQNRLNARRSAMTNSLVGIRGVEGDLVKRALAALIRPSS  178

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQ+RRGDF PRPSRLS M+KA++
Sbjct  179  HQQKRRGDFHPRPSRLSVMTKAQD  202



>ref|XP_004508409.1| PREDICTED: putative protein TPRXL-like [Cicer arietinum]
Length=201

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 7/144 (5%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L+G + S    SVRFS+DRSISP+RS+SV+       + G     ++  K+TC+CSPT+H
Sbjct  63   LYGSSPSVSASSVRFSLDRSISPNRSISVTP------RTGGKKQSSSQQKRTCMCSPTTH  116

Query  499  PGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRCSLHK   SR S + Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSS
Sbjct  117  PGSFRCSLHKGFGSRASTTPYSQNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSS  176

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQRRRGDF+PRPSRLS MSKAE+
Sbjct  177  HQQRRRGDFRPRPSRLSVMSKAED  200



>ref|XP_009355793.1| PREDICTED: uncharacterized protein LOC103946738 [Pyrus x bretschneideri]
Length=226

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  93   SSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPGSF  146

Query  487  RCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQQR
Sbjct  147  RCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQQR  206

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQPRPSRLS MS A+E
Sbjct  207  RRAGFQPRPSRLSVMSTAQE  226



>ref|XP_007155099.1| hypothetical protein PHAVU_003G173100g [Phaseolus vulgaris]
 gb|ESW27093.1| hypothetical protein PHAVU_003G173100g [Phaseolus vulgaris]
Length=196

 Score =   163 bits (412),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 107/137 (78%), Gaps = 10/137 (7%)
 Frame = -1

Query  661  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  482
            S+  PSVRFS+DRS+SP+RS++ +       +QG   P  + PK+TC+CSPT+HPGSFRC
Sbjct  69   SSAAPSVRFSLDRSVSPNRSIAAAS------RQGSIKP--HQPKRTCMCSPTTHPGSFRC  120

Query  481  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            SLHK   S     Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQ+RRG
Sbjct  121  SLHKK--SHAPAPYSPNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQKRRG  178

Query  301  DFQPRPSRLSRMSKAEE  251
            DF PRPSRLS M+KAE+
Sbjct  179  DFHPRPSRLSVMTKAED  195



>ref|XP_007013641.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY31260.1| Serine-rich protein-related [Theobroma cacao]
Length=206

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            SVRFS+D R ISP+RS++  RR+     + + N  +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  75   SVRFSLDNRPISPNRSITTVRRNT----EALKNLQSKQPKRTCMCSPTTHPGSFRCSLHK  130

Query  469  NMNSRPSI-SY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
              NS  ++ SY PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F
Sbjct  131  GFNSSHAVTSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAF  190

Query  295  QPRPSRLSRMSKAEE  251
            QPRPSRLS MSKAE+
Sbjct  191  QPRPSRLSLMSKAED  205



>ref|XP_003542665.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Glycine max]
Length=204

 Score =   162 bits (410),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            PSVRFS+DRS+SP+RS+SV+ R  V R+ G   P  +  K+TC+CSPT+HPGSFRCSLHK
Sbjct  73   PSVRFSLDRSVSPNRSISVAPRTGVSRQSG--GPHHHQQKRTCMCSPTTHPGSFRCSLHK  130

Query  469  NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  290
              ++     Y  +RLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQRRRGDF P
Sbjct  131  KSHAPAPAPYSPHRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQRRRGDFHP  190

Query  289  RPSRLSRMSKAEE  251
            RPSRLS MSKAE+
Sbjct  191  RPSRLSVMSKAED  203



>ref|XP_008394152.1| PREDICTED: dual specificity tyrosine-phosphorylation-regulated 
kinase 1A-like [Malus domestica]
Length=224

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 108/140 (77%), Gaps = 8/140 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  91   SSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KSG---PIS-MPKKTCMCSPTSHPGSF  144

Query  487  RCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQQR
Sbjct  145  RCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQQR  204

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQPRPSRLS MS A +
Sbjct  205  RRAGFQPRPSRLSVMSTAHD  224



>gb|EPS66288.1| hypothetical protein M569_08491 [Genlisea aurea]
Length=214

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 106/144 (74%), Gaps = 12/144 (8%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            PT SVRFSIDRSISP RS++       V ++  G   +++ K+TCLCSPT+HPGSFRCSL
Sbjct  70   PTSSVRFSIDRSISPSRSIAAPPPRNPVIQRSCG---SSIQKRTCLCSPTTHPGSFRCSL  126

Query  475  HKNMNS---------RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            H+N              SI Y  NRLN RRSAMTNSLVRIGTVEGDLVKRALAALI PSS
Sbjct  127  HRNSYGSSSGGGRGGEQSIPYSPNRLNMRRSAMTNSLVRIGTVEGDLVKRALAALIHPSS  186

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQRRR DFQ RPSRLS MSKA+E
Sbjct  187  HQQRRRVDFQARPSRLSVMSKADE  210



>gb|KJB64619.1| hypothetical protein B456_010G057600 [Gossypium raimondii]
Length=205

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = -1

Query  661  STPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            S+  PSVRFS+D R ISP+RS++  R++       V N      K+TC+CSPT+HPGSFR
Sbjct  69   SSSAPSVRFSLDNRPISPNRSIATIRKNT----DAVQNLEKRQQKRTCMCSPTTHPGSFR  124

Query  484  CSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            CSLHK  N+  ++S   PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQR
Sbjct  125  CSLHKGFNNSNAVSSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQR  184

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQPRPSRLS MSKAE+
Sbjct  185  RRSAFQPRPSRLSVMSKAED  204



>ref|XP_007202593.1| hypothetical protein PRUPE_ppa011611mg [Prunus persica]
 gb|EMJ03792.1| hypothetical protein PRUPE_ppa011611mg [Prunus persica]
Length=203

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = -1

Query  667  ASSTPTP-SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            ASS+P+  SVRFS+DR ISP RS+SV+          V +   +  K+TC+CSPT+HPGS
Sbjct  62   ASSSPSAQSVRFSLDRPISPSRSISVTPHGNSNHHNAVKSRQISNQKRTCMCSPTNHPGS  121

Query  490  FRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  317
            FRCSLHKN +S  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH 
Sbjct  122  FRCSLHKNFSSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHS  181

Query  316  QRRRGDFQPRPSRLSRMSKAEE  251
            QRRR DF+PRPSRLS MSK+ E
Sbjct  182  QRRRADFRPRPSRLSTMSKSHE  203



>gb|AGV54226.1| hypothetical protein [Phaseolus vulgaris]
Length=228

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 112/156 (72%), Gaps = 16/156 (10%)
 Frame = -1

Query  661  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  482
            S+  PSVRFS+DRS+SP+RS++ +       +QG   P  + PK+TC+CSPT+HPGSFRC
Sbjct  69   SSAAPSVRFSLDRSVSPNRSIAAAS------RQGSIKP-HHQPKRTCMCSPTTHPGSFRC  121

Query  481  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            SLHK   S     Y  NRLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQ+RRG
Sbjct  122  SLHKK--SHAPAPYSPNRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQKRRG  179

Query  301  DFQPRPSRLSRMSKAEEDl*vlll*VCIDYSVWIPA  194
            DF PRPSRLS M+KAE              ++W+P+
Sbjct  180  DFHPRPSRLSVMTKAERGPLN-------STTLWLPS  208



>ref|XP_004139263.1| PREDICTED: uncharacterized protein LOC101209679 isoform 1 [Cucumis 
sativus]
 ref|XP_004159410.1| PREDICTED: uncharacterized protein LOC101229451 isoform 1 [Cucumis 
sativus]
 gb|KGN60756.1| hypothetical protein Csa_2G009440 [Cucumis sativus]
Length=202

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 110/143 (77%), Gaps = 3/143 (2%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LHG + S   PSVRFS+DR+ SP+RSVSVS        + V    +   K+TC+CSPT+H
Sbjct  60   LHG-SPSVSVPSVRFSLDRATSPNRSVSVSSSRSGGTNRVVQRQSST--KRTCMCSPTTH  116

Query  499  PGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            PGSFRCSLHK + S+P   Y  +RLNARRSAMTNSLVRIG VEGDLVKRALAALIRPSSH
Sbjct  117  PGSFRCSLHKGIISQPPALYSPSRLNARRSAMTNSLVRIGGVEGDLVKRALAALIRPSSH  176

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
            QQRRR DF+P+ SRLS MSKA+E
Sbjct  177  QQRRRVDFRPKRSRLSIMSKADE  199



>gb|KJB53963.1| hypothetical protein B456_009G013700 [Gossypium raimondii]
Length=205

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 108/135 (80%), Gaps = 7/135 (5%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            SVRFS+D R ISP+RS+S  RR+     + + N  +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  75   SVRFSLDSRPISPNRSISAVRRNT----EALRNLQSKQPKRTCMCSPTTHPGSFRCSLHK  130

Query  469  NMN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
              N S  S  Y PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F
Sbjct  131  GFNNSHASSGYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAF  190

Query  295  QPRPSRLSRMSKAEE  251
            QPRPSRLS MSKAE+
Sbjct  191  QPRPSRLSVMSKAED  205



>ref|XP_009393722.1| PREDICTED: uncharacterized protein LOC103979335 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 8/139 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            A+ + TP+VRFS+DRS SP RS++ + +       G   P+    ++TCLC+PT+HPGSF
Sbjct  63   AAPSQTPAVRFSLDRSTSPGRSLAAADKRSPSTTAG---PV----RRTCLCAPTNHPGSF  115

Query  487  RCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RC LHK ++    ++S PSNRLNARRSAMTNSLVRIG VEG+ VKRALAALIRPSSHQQR
Sbjct  116  RCRLHKGLHIHHAAVSSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALAALIRPSSHQQR  175

Query  310  RRGDFQPRPSRLSRMSKAE  254
            RR DF PRPSRLSRMSKA+
Sbjct  176  RRADFHPRPSRLSRMSKAD  194



>ref|XP_008242917.1| PREDICTED: putative protein TPRXL [Prunus mume]
Length=203

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = -1

Query  664  SSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            SS+   SVRFS+DR ISP RS+SV+          V +   +  K+TC+CSPT+HPGSFR
Sbjct  64   SSSSAQSVRFSLDRPISPSRSISVTPHGNGNHHNAVKSRQISNQKRTCMCSPTNHPGSFR  123

Query  484  CSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            CSLHKN +S  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH QR
Sbjct  124  CSLHKNFSSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHSQR  183

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR DF+PRPSRLS MSK+ E
Sbjct  184  RRADFRPRPSRLSTMSKSHE  203



>ref|XP_007226111.1| hypothetical protein PRUPE_ppa011080mg [Prunus persica]
 gb|EMJ27310.1| hypothetical protein PRUPE_ppa011080mg [Prunus persica]
Length=224

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 9/140 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS P+PSVRFSID RSISP+ S       +   K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  92   SSAPSPSVRFSIDHRSISPNHSNRSITVSK---KNG---PIS-MPKKTCMCSPTSHPGSF  144

Query  487  RCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN+    + + YP+NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQQR
Sbjct  145  RCSLHKNIGGGHNAAPYPTNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQQR  204

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQPRPSRLS MS A++
Sbjct  205  RRAGFQPRPSRLSAMSTADK  224



>ref|XP_003544605.1| PREDICTED: uncharacterized protein LOC100814735 [Glycine max]
Length=196

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 8/137 (6%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            P+ SVRF++DRSISP+RS  ++       ++   +      KKTC+CSPT+HPGSFRCSL
Sbjct  66   PSHSVRFALDRSISPNRSHVIA-------RKHQHHRHVTAQKKTCMCSPTTHPGSFRCSL  118

Query  475  HKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            HKN N      S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  
Sbjct  119  HKNNNQNAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSA  178

Query  298  FQPRPSRLSRMSKAEED  248
            F+PRPSRLS MSKAEE+
Sbjct  179  FEPRPSRLSIMSKAEEE  195



>ref|XP_009362322.1| PREDICTED: uncharacterized protein JIP4-like [Pyrus x bretschneideri]
Length=226

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 106/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS+P+PSVRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  93   SSSPSPSVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPGSF  146

Query  487  RCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRP +HQQR
Sbjct  147  RCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPCAHQQR  206

Query  310  RRGDFQPRPSRLSRMSKAE  254
            RR  FQPRPSRLS MS A 
Sbjct  207  RRAGFQPRPSRLSAMSTAH  225



>ref|XP_008219542.1| PREDICTED: putative protein TPRXL [Prunus mume]
Length=225

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS P+PSVRFSID RSISP+ S       +   K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  92   SSAPSPSVRFSIDHRSISPNHSNRSITVSK---KNG---PIS-MPKKTCMCSPTSHPGSF  144

Query  487  RCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN+    + + YP+NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRP +HQQR
Sbjct  145  RCSLHKNVGGGHNAAPYPTNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPCAHQQR  204

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQPRPSRLS MS  ++
Sbjct  205  RRAGFQPRPSRLSAMSTTDD  224



>ref|XP_009769290.1| PREDICTED: uncharacterized protein LOC104220170 [Nicotiana sylvestris]
Length=203

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFS+DRS SP RS+S   R+ VV+ +   +  +++ KKTC+CSPT+HPGSFRCSLHKN+
Sbjct  70   VRFSLDRSTSPSRSISALNRNHVVQNRSYKSLPSSVQKKTCMCSPTNHPGSFRCSLHKNI  129

Query  463  NSRPSISYPS---NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
             +  S + PS   N+L+ RRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ
Sbjct  130  AASGSRA-PSCNPNQLHMRRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  188

Query  292  PRPSRLSRMSKAEE  251
             RPSRLS MSKAE+
Sbjct  189  HRPSRLSVMSKAED  202



>ref|XP_008802034.1| PREDICTED: uncharacterized protein LOC103715996, partial [Phoenix 
dactylifera]
Length=199

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 99/135 (73%), Gaps = 6/135 (4%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPL----ANLPKKTCLCSPTSHPGSFRC  482
            PSVRFSIDR  SP    S++   Q    Q V  P+        +KTC+CSPT+HPGSFRC
Sbjct  64   PSVRFSIDRPTSP--GRSLAVDRQHQHHQAVRQPIPSASGGGQRKTCMCSPTTHPGSFRC  121

Query  481  SLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            SLHK      ++S  SNRLNARRSAMTNSLVRIGTVEG+ V+RALAALIRPSSHQQRRR 
Sbjct  122  SLHKGFGHNHAVSSSSNRLNARRSAMTNSLVRIGTVEGEWVRRALAALIRPSSHQQRRRE  181

Query  301  DFQPRPSRLSRMSKA  257
             FQPRPSRLS MSKA
Sbjct  182  AFQPRPSRLSIMSKA  196



>ref|XP_009403190.1| PREDICTED: uncharacterized protein LOC103986811 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 103/143 (72%), Gaps = 11/143 (8%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            A+  PTPSVR S DRS SP       R      K+ V    A   ++TCLCSP++HPGSF
Sbjct  65   AAHPPTPSVRLSFDRSTSP------GRSLAAPDKRSVAPAAAPA-RRTCLCSPSTHPGSF  117

Query  487  RCSLHKNMN----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            RCSLHK +N       + S PSNRLNARRSAMTNSLVRIG VEG+ VKRALAALIRPSSH
Sbjct  118  RCSLHKGLNLHHHGHVAASSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALAALIRPSSH  177

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
            QQRRR  FQPRPSRLSRMSKA++
Sbjct  178  QQRRRAGFQPRPSRLSRMSKADD  200



>ref|XP_010533108.1| PREDICTED: uncharacterized protein LOC104808950 [Tarenaya hassleriana]
Length=214

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            +VRFSIDR  SP RS+S          Q V N + +  K+TC+CSPT+HPGSFRCSLHK 
Sbjct  76   TVRFSIDRPTSPGRSISAVGHSPRTAGQIVRNQIPSQQKRTCMCSPTNHPGSFRCSLHKA  135

Query  466  MNSR----PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
              +R    PS   P+NRL+ARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQRRR D
Sbjct  136  AAARGSHAPSSYSPNNRLHARRSAMTNSLVRICGVEGDLVKRALAALIRPSSHQQRRRAD  195

Query  298  FQPRPSRLSRMSKAEE  251
            F+PR SRLS MSKA+E
Sbjct  196  FRPRQSRLSVMSKADE  211



>ref|XP_004146710.1| PREDICTED: uncharacterized protein LOC101217053 isoform 1 [Cucumis 
sativus]
 ref|XP_004146711.1| PREDICTED: uncharacterized protein LOC101217053 isoform 2 [Cucumis 
sativus]
 ref|XP_004165350.1| PREDICTED: uncharacterized protein LOC101229924 isoform 1 [Cucumis 
sativus]
 ref|XP_004165351.1| PREDICTED: uncharacterized protein LOC101229924 isoform 2 [Cucumis 
sativus]
 gb|KGN65199.1| hypothetical protein Csa_1G264020 [Cucumis sativus]
Length=203

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFS+DRSISP+R +SV  R      Q V     +  K+TC+CSPT+HPGSFRCSLHK +
Sbjct  75   VRFSLDRSISPNRPISVLSRASGN-HQVVKK--QSQQKRTCMCSPTTHPGSFRCSLHKGV  131

Query  463  NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRP  284
             S+PS  Y SNRLNARRSAMTNSLVRIG VEGD+++RALA+LIRPSSH QRRR DF PRP
Sbjct  132  QSQPSTPYSSNRLNARRSAMTNSLVRIGGVEGDILRRALASLIRPSSHSQRRRVDFCPRP  191

Query  283  SRLSRMSKAEE  251
            SRLS MSKA++
Sbjct  192  SRLSIMSKADD  202



>ref|XP_010913363.1| PREDICTED: uncharacterized protein LOC105039072 [Elaeis guineensis]
Length=218

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 108/143 (76%), Gaps = 9/143 (6%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP----KKTCLCSPTSHPGSF  488
            P PSVRFSIDR  SP RS++V R+ Q    Q V  P+ + P    +KTC+CSPT+HPGSF
Sbjct  74   PKPSVRFSIDRPTSPGRSLAVERQHQQQHHQAVRQPIPSAPGGGKRKTCMCSPTTHPGSF  133

Query  487  RCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            RC+LHK   +       ++S PS RLNARRSAMTNSLVRIGTVEG+ ++RALAALIRPSS
Sbjct  134  RCNLHKGFAAHGGGHNHAVSSPSYRLNARRSAMTNSLVRIGTVEGEWLRRALAALIRPSS  193

Query  322  HQQRRRGDFQPRPSRLSRMSKAE  254
            HQQRRR  FQPRPSRLS MSKA+
Sbjct  194  HQQRRRAAFQPRPSRLSIMSKAD  216



>ref|XP_008443919.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
 ref|XP_008443920.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
Length=203

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 11/135 (8%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGN----PLANLPKKTCLCSPTSHPGSFRCSL  476
            VRFS+DRSISP+R +SV         +  GN       +  K+TC+CSPT+HPGSFRCSL
Sbjct  75   VRFSLDRSISPNRPISVLS-------RATGNHQVVKKQSHQKRTCMCSPTTHPGSFRCSL  127

Query  475  HKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            HK + S PS  Y SNRLNARRSAMTNSLVRIG VEGD+++RALA+LIRPSSH QRRR DF
Sbjct  128  HKGVQSHPSTPYSSNRLNARRSAMTNSLVRIGGVEGDILRRALASLIRPSSHSQRRRVDF  187

Query  295  QPRPSRLSRMSKAEE  251
             PRPSRLS MSKA++
Sbjct  188  CPRPSRLSIMSKADD  202



>emb|CDP10497.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 15/138 (11%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            +VRFS+DR ISP+RS+S+  +   V ++          K+TC+CSPT+HPGSFRCSLHK+
Sbjct  77   TVRFSLDRPISPNRSISMVNKKNQVVQKS--------QKRTCMCSPTNHPGSFRCSLHKS  128

Query  466  MNSRPSIS-------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            +    S S       Y +NRLN RRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH QRR
Sbjct  129  IGHSSSSSSHTQTAPYNANRLNMRRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHHQRR  188

Query  307  RGDFQPRPSRLSRMSKAE  254
            RGDF PRPSRLS MSKAE
Sbjct  189  RGDFHPRPSRLSAMSKAE  206



>gb|EYU20232.1| hypothetical protein MIMGU_mgv1a018309mg [Erythranthe guttata]
Length=221

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            LH  +   P+PSVRFSIDRSISP RS++ + R+QVV+++G  N   N+ K+TCLCSP++H
Sbjct  80   LHALSPPPPSPSVRFSIDRSISPRRSIAATPRNQVVQRKGGNN---NIQKRTCLCSPSTH  136

Query  499  PGSFRCSLHKNMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            PGSFRC+LHK+       ++   NRLN RRSAMTNSLVRIGTVEGDLVKRALA+LIRPSS
Sbjct  137  PGSFRCALHKSSFGGVGGNHSVPNRLNMRRSAMTNSLVRIGTVEGDLVKRALASLIRPSS  196

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQRRR +F+ RPSRLS M+KAE+
Sbjct  197  HQQRRRVNFRARPSRLSVMTKAED  220



>ref|XP_008366660.1| PREDICTED: putative protein TPRXL [Malus domestica]
Length=225

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS+P+  VRFSID RSISP+   + S       K G   P++ +PKKTC+CSPTSHPGSF
Sbjct  92   SSSPSRYVRFSIDHRSISPNHHSNRSIAVSK--KTG---PIS-MPKKTCMCSPTSHPGSF  145

Query  487  RCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            RCSLHKN   S+ + S+PSNRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRP +HQQR
Sbjct  146  RCSLHKNQGGSQNTGSFPSNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPCAHQQR  205

Query  310  RRGDFQPRPSRLSRMSKAE  254
            RR  FQPRPSRLS MS A+
Sbjct  206  RRAGFQPRPSRLSAMSTAD  224



>gb|AFK42940.1| unknown [Lotus japonicus]
Length=189

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 15/139 (11%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA-----NLPKKTCLCSPTSHPGSFRC  482
            S+RFS+DRS+SP+RS+SV+         G G   A     N  K+TC+C+PTSHPGSFRC
Sbjct  57   SLRFSLDRSVSPNRSISVA---------GTGAVPAVTRKNNQQKRTCMCAPTSHPGSFRC  107

Query  481  SLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  305
            SLHK+  SR   + Y  NRLNARRSAMTNSLVRI  VEG+LVK+ALAALIRPSSHQQRRR
Sbjct  108  SLHKSSGSRVVAAPYSPNRLNARRSAMTNSLVRIRGVEGELVKKALAALIRPSSHQQRRR  167

Query  304  GDFQPRPSRLSRMSKAEED  248
            G+F+PRPSRL+ MSKAE +
Sbjct  168  GEFRPRPSRLAAMSKAEGE  186



>emb|CDP18810.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 110/152 (72%), Gaps = 16/152 (11%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsr----rdqvvRKQGVGNPLANLPKKTCLCS  512
            LH  A  +PTPSVR SIDRSISP RSV++S       QVVRKQ          K+TCLCS
Sbjct  69   LHRLAPISPTPSVRMSIDRSISPRRSVAMSSPRDHHHQVVRKQSSC-------KRTCLCS  121

Query  511  PTSHPGSFRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRAL  347
            PTSHPGSFRCSLHKN+N+ P     S SY    L  +RSAM NSLVRIGTVEGDLVKRAL
Sbjct  122  PTSHPGSFRCSLHKNLNNAPPPQQQSPSYSLKNLTIQRSAMKNSLVRIGTVEGDLVKRAL  181

Query  346  AALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            AALIRPSSHQ RRR DFQ RPSRLS MSKA +
Sbjct  182  AALIRPSSHQIRRRSDFQRRPSRLSAMSKAGD  213



>gb|KJB23691.1| hypothetical protein B456_004G110000 [Gossypium raimondii]
Length=208

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 104/134 (78%), Gaps = 7/134 (5%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFS+D R ISP+RS++  RR      + + N  +   K+TC+CSPT+HPGSFRCSLHK+
Sbjct  78   VRFSLDNRPISPNRSITTVRRTT----EALKNLQSKQTKRTCMCSPTTHPGSFRCSLHKS  133

Query  466  MN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
             N S P   Y PSNRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSHQQRRR  F 
Sbjct  134  FNTSHPGTGYAPSNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHQQRRREAFH  193

Query  292  PRPSRLSRMSKAEE  251
            PRPSRLS MSKAE 
Sbjct  194  PRPSRLSVMSKAEN  207



>ref|XP_003550193.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=204

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            A+  P+ SVRF++DRSISP+R+VS     +               KK+C+CSPT+HPGSF
Sbjct  69   AAPLPSHSVRFALDRSISPNRTVSSHVIAKHRH--------VTAQKKSCMCSPTTHPGSF  120

Query  487  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            RCSLHKN +S  + S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRR
Sbjct  121  RCSLHKNSHSAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRR  180

Query  307  RGDFQPRPSRLSRMSKAEED  248
            R  F+PR SRLS MSKA+++
Sbjct  181  RTAFEPRQSRLSIMSKADDE  200



>gb|KHN48540.1| hypothetical protein glysoja_041593 [Glycine soja]
Length=205

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 8/140 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            A+  P+ SVRF++DRSISP+R+VS     +               KK+C+CSPT+HPGSF
Sbjct  70   AAPLPSHSVRFALDRSISPNRTVSSHVIAKHRH--------VTAQKKSCMCSPTTHPGSF  121

Query  487  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            RCSLHKN +S  + S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRR
Sbjct  122  RCSLHKNSHSAQTGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRR  181

Query  307  RGDFQPRPSRLSRMSKAEED  248
            R  F+PR SRLS MSKA+++
Sbjct  182  RTAFEPRQSRLSIMSKADDE  201



>ref|XP_009622884.1| PREDICTED: uncharacterized protein LOC104114205 isoform X1 [Nicotiana 
tomentosiformis]
Length=203

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFS+DRS SP RS+S   R+ VV+ +   +  ++  KKTC+CSPT+HPGSFRCSLHKN+
Sbjct  70   VRFSLDRSTSPSRSISALNRNHVVQNRSYKSLPSSGQKKTCMCSPTNHPGSFRCSLHKNI  129

Query  463  ---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
               +SR     P N+L+ RRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ
Sbjct  130  VASSSRAPSCNP-NQLHMRRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  188

Query  292  PRPSRLSRMSKAEE  251
             RPSRLS MSK E+
Sbjct  189  HRPSRLSVMSKVED  202



>ref|XP_002324885.1| hypothetical protein POPTR_0018s02140g [Populus trichocarpa]
 gb|EEF03450.1| hypothetical protein POPTR_0018s02140g [Populus trichocarpa]
Length=208

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 112/144 (78%), Gaps = 15/144 (10%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            ++ST +PS RFSIDRSISP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSF
Sbjct  74   STSTLSPSFRFSIDRSISPNRSISVS-------KKNHSHPIS-APKRTCMCSPTTHRGSF  125

Query  487  RCSLHKNMNSRPSISYPS----NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            RCSLHKN    PS + P+    NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSH
Sbjct  126  RCSLHKNT---PSSANPAPFTPNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSH  182

Query  319  QQRRRGDFQPRPSRLSRMSKAEED  248
            QQRRRG FQPRPSRLS +S A+++
Sbjct  183  QQRRRGAFQPRPSRLSIISNADDE  206



>gb|KHN07053.1| hypothetical protein glysoja_023236 [Glycine soja]
Length=208

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRCSLHK
Sbjct  79   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCSLHK  132

Query  469  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  133  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  192

Query  295  QPRPSRLSRMSKAEE  251
            +PRPSRLS MSKA++
Sbjct  193  EPRPSRLSVMSKAQD  207



>ref|XP_010047203.1| PREDICTED: homeobox protein Nkx-6.1-like [Eucalyptus grandis]
 gb|KCW79031.1| hypothetical protein EUGRSUZ_C00453 [Eucalyptus grandis]
Length=217

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 111/153 (73%), Gaps = 15/153 (10%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvR-------KQGVGNPLANLPKKTC  521
            LH  A   P+PS+RF++DR  SP RS+SVS++ +          + G   P    P++TC
Sbjct  69   LHSPA--QPSPSIRFALDRPTSPSRSISVSQQQRRGGTGGGQLVRSGGQKPA---PRRTC  123

Query  520  LCSPTSHPGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRAL  347
            +CSPT+HPGSFRCSLHK   S PS S  Y  NRLNARRSAMTNSLVRIG VEGDLVKRAL
Sbjct  124  MCSPTNHPGSFRCSLHKGCGS-PSASAGYAPNRLNARRSAMTNSLVRIGGVEGDLVKRAL  182

Query  346  AALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            AALIRPSSHQQRRR  FQPR SRLS MSKA E+
Sbjct  183  AALIRPSSHQQRRRAAFQPRQSRLSIMSKAAEE  215



>ref|XP_007161188.1| hypothetical protein PHAVU_001G049400g [Phaseolus vulgaris]
 gb|ESW33182.1| hypothetical protein PHAVU_001G049400g [Phaseolus vulgaris]
Length=197

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = -1

Query  661  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  482
            + P+PSVRF++DRSISP RSVS     +   +         + KKTC+CSPT+HPGSFRC
Sbjct  64   TAPSPSVRFALDRSISPSRSVSSHVIVKKHHRH------VTVQKKTCMCSPTNHPGSFRC  117

Query  481  SLHKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  305
            SLHKN +   S  S+PSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR
Sbjct  118  SLHKNNHHHASAGSFPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRR  177

Query  304  GDFQPRPSRLSRMSKAEED  248
              F+PRPSRLS MS +EED
Sbjct  178  SAFEPRPSRLSIMSNSEED  196



>ref|XP_003522528.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=218

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFSID RSISP+RS+S         +   G       KKTC+CSPT HPGSFRCSLHKN
Sbjct  90   VRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTMHPGSFRCSLHKN  143

Query  466  M--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
            +  N+  S SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+
Sbjct  144  IGNNNHHSDSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGFE  203

Query  292  PRPSRLSRMSKAEE  251
            PRPSRLS MSKA++
Sbjct  204  PRPSRLSVMSKAQD  217



>ref|XP_004235914.1| PREDICTED: uncharacterized protein LOC101263595 [Solanum lycopersicum]
Length=148

 Score =   150 bits (379),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 102/145 (70%), Gaps = 20/145 (14%)
 Frame = -1

Query  664  SSTPTPSVRFSID--RSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  497
            S +P+P+VRFS    RSIS  PH+            ++    PL +  KKTC+CSPT+HP
Sbjct  15   SVSPSPNVRFSTSAGRSISVYPHQ------------QKQTSRPLPSHQKKTCMCSPTTHP  62

Query  496  GSFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            GSFRCSLHKNM+       S    S  LN RRSAMTNSLVRIGTVEG+LVKRALAALIRP
Sbjct  63   GSFRCSLHKNMSQNRSHSNSSYRSSYHLNMRRSAMTNSLVRIGTVEGELVKRALAALIRP  122

Query  328  SSHQQRRRGDFQPRPSRLSRMSKAE  254
            SSHQ RRR DFQPRPSRLS MSKAE
Sbjct  123  SSHQLRRRDDFQPRPSRLSVMSKAE  147



>ref|XP_003526301.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=215

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRCSLHK
Sbjct  86   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCSLHK  139

Query  469  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  140  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  199

Query  295  QPRPSRLSRMSKAEE  251
            +PRPSRLS MSKA++
Sbjct  200  EPRPSRLSVMSKAQD  214



>gb|KHG27589.1| Vitamin K-dependent S [Gossypium arboreum]
Length=223

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  661  STPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            S+  PSVRFS+D R ISP+RS++  RR+       V N      K+TC+CSPT+HPGSFR
Sbjct  71   SSSAPSVRFSLDNRPISPNRSIATIRRNT----DAVQNLEKRQQKRTCMCSPTTHPGSFR  126

Query  484  CSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            CSLHK  N+  ++S   PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQR
Sbjct  127  CSLHKGFNNSNAVSSYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQR  186

Query  310  RRGDFQPRPSRLSRM  266
            RR  FQPRPSRLS M
Sbjct  187  RRAAFQPRPSRLSVM  201



>ref|XP_006341382.1| PREDICTED: uncharacterized protein LOC102606030 [Solanum tuberosum]
Length=148

 Score =   150 bits (379),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 101/145 (70%), Gaps = 20/145 (14%)
 Frame = -1

Query  664  SSTPTPSVRFSID--RSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  497
            S +P+P+VRFS    RSIS  PH+            ++    PL +  KKTC+CSPT+HP
Sbjct  15   SVSPSPNVRFSASAGRSISVYPHQ------------QKQTSRPLPSNQKKTCMCSPTTHP  62

Query  496  GSFRCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            GSFRCS HKNM+       S    S  LN RRSAMTNSLVRIGTVEGDLVKRALAALIRP
Sbjct  63   GSFRCSFHKNMSQNRSHSNSSYRSSYHLNMRRSAMTNSLVRIGTVEGDLVKRALAALIRP  122

Query  328  SSHQQRRRGDFQPRPSRLSRMSKAE  254
            SSHQ RRR DFQPRPSRLS MSKAE
Sbjct  123  SSHQLRRRDDFQPRPSRLSVMSKAE  147



>ref|XP_007136989.1| hypothetical protein PHAVU_009G090900g [Phaseolus vulgaris]
 gb|ESW08983.1| hypothetical protein PHAVU_009G090900g [Phaseolus vulgaris]
Length=220

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 103/138 (75%), Gaps = 10/138 (7%)
 Frame = -1

Query  655  PTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCS  479
            P+ +VRFSID RSISP+RS+S     +        N   +  KKTC+CSPTSHPGSFRCS
Sbjct  89   PSSAVRFSIDPRSISPNRSISNQIITK-------NNRPISAHKKTCMCSPTSHPGSFRCS  141

Query  478  LHKNM--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  305
            LHKN   N   + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR
Sbjct  142  LHKNAGNNHHHADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRR  201

Query  304  GDFQPRPSRLSRMSKAEE  251
              F+PRPSRLS MSKA++
Sbjct  202  AAFEPRPSRLSVMSKAQD  219



>ref|XP_004501356.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501357.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501358.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501359.1| PREDICTED: 1-phosphatidylinositol 3-phosphate 5-kinase-like isoform 
X4 [Cicer arietinum]
Length=219

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 101/133 (76%), Gaps = 8/133 (6%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFSID RSISP+R +S         +     P++   KKTC+CSPT+HPGSFRCSLHKN
Sbjct  92   VRFSIDSRSISPNRPISNQIITTKKNR-----PIS-AQKKTCMCSPTNHPGSFRCSLHKN  145

Query  466  M-NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  290
              N+  + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+P
Sbjct  146  NGNNNSADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSAFEP  205

Query  289  RPSRLSRMSKAEE  251
            RPSRLS MSKAE+
Sbjct  206  RPSRLSVMSKAED  218



>ref|XP_006359514.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Solanum 
tuberosum]
Length=206

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 103/137 (75%), Gaps = 14/137 (10%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN-  467
            VRFS+DRS SP RS+S   R+ VV+ +          KK+C+CSPT+HPGSFRCSLHKN 
Sbjct  77   VRFSLDRSTSPSRSISAVNRNHVVQNRS--------QKKSCMCSPTTHPGSFRCSLHKNR  128

Query  466  -----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
                   SR + +Y  N+L  RRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR 
Sbjct  129  SGSGSTGSRTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRA  188

Query  301  DFQPRPSRLSRMSKAEE  251
            DFQ RPSRLS MSKA++
Sbjct  189  DFQRRPSRLSAMSKADD  205



>ref|XP_003549713.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Glycine max]
Length=203

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            PSVRFS+DRS+SP+RS+SV+ R    R+    +   +  K+TC+CSPT+HPGSFRCSLHK
Sbjct  72   PSVRFSLDRSVSPNRSISVAPRTGASRQSSSPH---HQQKRTCMCSPTTHPGSFRCSLHK  128

Query  469  NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  290
               S     Y  +RLNARRSAMTNSLVRI  VEGDLVKRALAALIRPSSHQQRRRGDF P
Sbjct  129  K--SHAPAPYSPHRLNARRSAMTNSLVRIRGVEGDLVKRALAALIRPSSHQQRRRGDFYP  186

Query  289  RPSRLSRMSKAE  254
            RPSRLS MS AE
Sbjct  187  RPSRLSVMSMAE  198



>ref|XP_010519639.1| PREDICTED: putative protein TPRXL [Tarenaya hassleriana]
Length=208

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 13/139 (9%)
 Frame = -1

Query  655  PTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCS  479
            PT S RFSID RSISP+RS++ S+       +         P+K C+CSPT+HPGSFRCS
Sbjct  78   PTQSFRFSIDTRSISPNRSIAFSKPSSHQISE---------PRKRCMCSPTTHPGSFRCS  128

Query  478  LHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            LHKN+   + + S SYPSNRLN RRSAMTNSLVRIG VEG+ V+RAL ALIRPSSHQ RR
Sbjct  129  LHKNLANPHGQGSASYPSNRLNMRRSAMTNSLVRIGGVEGEWVRRALTALIRPSSHQLRR  188

Query  307  RGDFQPRPSRLSRMSKAEE  251
            R  FQPRPSRLS MSKA+ 
Sbjct  189  RAAFQPRPSRLSVMSKADN  207



>ref|XP_011036619.1| PREDICTED: putative protein TPRXL [Populus euphratica]
Length=209

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 15/139 (11%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PS RFSIDRSISP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSFRCSLH
Sbjct  80   SPSFRFSIDRSISPNRSISVS-------KKNHSHPIS-APKRTCMCSPTTHRGSFRCSLH  131

Query  472  KNMNSRPSISYPS----NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  305
            KN    PS + P+    NRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQ RRR
Sbjct  132  KNT---PSSTNPAPFTPNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQLRRR  188

Query  304  GDFQPRPSRLSRMSKAEED  248
            G FQPRPSRLS MS A++D
Sbjct  189  GAFQPRPSRLSIMSNADDD  207



>ref|XP_010687825.1| PREDICTED: uncharacterized protein LOC104901900 [Beta vulgaris 
subsp. vulgaris]
Length=193

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = -1

Query  550  PLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGT  377
            P     K+TC+CSPT+HPGSFRCSLHKN  +R   +  Y SNRL ARRSAMTNSLVRIGT
Sbjct  94   PTTTGQKRTCMCSPTNHPGSFRCSLHKNSANRTVSAQPYQSNRLFARRSAMTNSLVRIGT  153

Query  376  VEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            VEGDLVKRALAALIRPSSHQQ+RRGDFQPR SRLS MS A
Sbjct  154  VEGDLVKRALAALIRPSSHQQKRRGDFQPRKSRLSNMSAA  193



>gb|ACU19325.1| unknown [Glycine max]
Length=215

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            +VRFSID RSISP+RS+S         +   G       KKTC+CSPT+HPGSFRC LHK
Sbjct  86   AVRFSIDPRSISPNRSISNQIITTKNNRPISGQ------KKTCMCSPTTHPGSFRCGLHK  139

Query  469  NMNS--RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            N+ S    + SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F
Sbjct  140  NIGSSNHNADSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRAGF  199

Query  295  QPRPSRLSRMSKAEE  251
            +PRPSRLS MSKA++
Sbjct  200  EPRPSRLSVMSKAQD  214



>gb|KDP37028.1| hypothetical protein JCGZ_06084 [Jatropha curcas]
Length=211

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 108/149 (72%), Gaps = 13/149 (9%)
 Frame = -1

Query  676  HGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  497
            H   ++  TPS+RFSIDR ISP+RS+S+ R          GN ++N  K+TC CSPT+HP
Sbjct  70   HRQNTNQSTPSLRFSIDRPISPNRSLSMKRNASN------GNAVSN-QKRTCACSPTTHP  122

Query  496  GSFRCSLHK-----NMNSRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            GSFRC+ H+     N  S  S SY  S+RLN RRSAMTNSLVRIG VEG+LVKRAL+ALI
Sbjct  123  GSFRCAFHRALMRNNGYSTQSASYHSSSRLNFRRSAMTNSLVRIGGVEGELVKRALSALI  182

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            RPSSHQ RRR DFQPRPSRLS MSKA + 
Sbjct  183  RPSSHQLRRRADFQPRPSRLSVMSKASDS  211



>ref|XP_010908362.1| PREDICTED: uncharacterized protein LOC105034782 [Elaeis guineensis]
Length=205

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 12/146 (8%)
 Frame = -1

Query  667  ASSTPTPSVRFSID----RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            AS +P PSVRFS+D    R  SP            +  + + +P     ++TC+CSPT+H
Sbjct  64   ASPSPVPSVRFSLDHHRHRPTSP---GRSLAVADHLSSRPIASPAPQ--RRTCMCSPTTH  118

Query  499  PGSFRCSLHKNMN---SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            PGSFRCSLHK ++   +  ++S PSNRLNARRSAM NSLVRIGTVEG+ VKRAL ALIRP
Sbjct  119  PGSFRCSLHKGLHLQHNHNAVSSPSNRLNARRSAMANSLVRIGTVEGEWVKRALTALIRP  178

Query  328  SSHQQRRRGDFQPRPSRLSRMSKAEE  251
            SSHQQRRR  FQPRPSRLS MSKA++
Sbjct  179  SSHQQRRRAAFQPRPSRLSVMSKADD  204



>ref|XP_009778673.1| PREDICTED: uncharacterized protein LOC104227990 [Nicotiana sylvestris]
Length=201

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 104/145 (72%), Gaps = 17/145 (12%)
 Frame = -1

Query  664  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            S++P+PSVRFS    RSIS + S            Q    PLA+  KK C+CSPT+HPGS
Sbjct  66   SASPSPSVRFSTSPGRSISAYPSY----------PQQNRRPLASNQKKHCMCSPTTHPGS  115

Query  490  FRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            FRC+LHKN       SR S  + S++LN RRSAMTNSLVRIGTVEGDL+KRALAALIRPS
Sbjct  116  FRCNLHKNTTQNRGQSRTSSYHSSHQLNMRRSAMTNSLVRIGTVEGDLLKRALAALIRPS  175

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SHQ RRR DFQPR SRLS MSKA++
Sbjct  176  SHQLRRRDDFQPRLSRLSAMSKAQD  200



>emb|CBI25574.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  344
            C+CSPT+HPGSFRCSLHK  N+  S  Y SNRLNARRSAMTNSLVRIGTVEGDLVKRALA
Sbjct  84   CMCSPTTHPGSFRCSLHKGFNNH-SAPYSSNRLNARRSAMTNSLVRIGTVEGDLVKRALA  142

Query  343  ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            ALIRPSSHQQRRR  FQPRPSRLS MSKAE+
Sbjct  143  ALIRPSSHQQRRRSGFQPRPSRLSNMSKAED  173



>ref|XP_009611326.1| PREDICTED: uncharacterized protein LOC104104846 [Nicotiana tomentosiformis]
Length=202

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 103/147 (70%), Gaps = 21/147 (14%)
 Frame = -1

Query  664  SSTPTPSVRFS--IDRSIS--PHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHP  497
            S +P+P+VRFS    RSIS  PH+            KQ    PL +  KKTC+CSPT+HP
Sbjct  67   SVSPSPNVRFSASTSRSISVYPHQQ-----------KQN-SRPLQSNQKKTCMCSPTTHP  114

Query  496  GSFRCSLHKNMNSR-----PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIR  332
            GSFRCSLHKNMN        S    S+ LN RRSAMTNSLVRIGTVEG+LVKRALAALIR
Sbjct  115  GSFRCSLHKNMNQNRGHSNSSSYRSSHHLNMRRSAMTNSLVRIGTVEGELVKRALAALIR  174

Query  331  PSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            PSSH  RRR DFQPRPSRLS MSKAE+
Sbjct  175  PSSHHLRRRDDFQPRPSRLSVMSKAED  201



>ref|XP_008354346.1| PREDICTED: uncharacterized protein LOC103417967 [Malus domestica]
Length=208

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 98/142 (69%), Gaps = 14/142 (10%)
 Frame = -1

Query  646  SVRFSIDR--------SISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            SVRFS DR        S+SP  +           K G      + PK+ C+CSPT+HPGS
Sbjct  71   SVRFSFDRPTSPSRSISVSPRGTGGHHHHHHTAVKSGRN---ISQPKRXCMCSPTTHPGS  127

Query  490  FRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  317
            FRCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH 
Sbjct  128  FRCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHS  186

Query  316  QRRRGDFQPRPSRLSRMSKAEE  251
            QRRR DF+PRPSRLS MSK+ E
Sbjct  187  QRRRADFRPRPSRLSTMSKSNE  208



>gb|KHG18275.1| hypothetical protein F383_09858 [Gossypium arboreum]
Length=227

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 102/128 (80%), Gaps = 7/128 (5%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            SVRFS+D R ISP+RS+S  RR+     + + N  +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  75   SVRFSLDSRPISPNRSISAVRRNT----EALRNLQSKQPKRTCMCSPTTHPGSFRCSLHK  130

Query  469  NMN-SRPSISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
              N S  S  Y PSNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F
Sbjct  131  GFNNSHASSGYAPSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAF  190

Query  295  QPRPSRLS  272
            QPRPSRLS
Sbjct  191  QPRPSRLS  198



>ref|XP_010691070.1| PREDICTED: putative protein TPRXL [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 110/149 (74%), Gaps = 13/149 (9%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPT  506
            ++G +  T + SVRFSI+  R+ SP+RS S   R++        NP     KKTC+CSPT
Sbjct  55   IYGSSPQTTSSSVRFSINNNRNTSPNRSFSAVNRNR--------NPFPAGKKKTCMCSPT  106

Query  505  SHPGSFRCSLHKNMNSR--PSISYPSNRLNARRSAMTNSLVRIGTVEG-DLVKRALAALI  335
            +HPGSFRC+ HKN+ S+   + SY  NRLN RRSAMTNSLVRIG+VEG + VKRAL+ LI
Sbjct  107  THPGSFRCNFHKNLESKRQNTPSYQPNRLNMRRSAMTNSLVRIGSVEGGESVKRALSMLI  166

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            RP +HQQRRRGDFQPRPSRLS MSKAE++
Sbjct  167  RPCAHQQRRRGDFQPRPSRLSVMSKAEDE  195



>gb|KCW80272.1| hypothetical protein EUGRSUZ_C01627 [Eucalyptus grandis]
Length=137

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 104/140 (74%), Gaps = 12/140 (9%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PSVRFSIDRS SP RS++V  R  V+R+QG         KKTC+CSPTSHPGSFRCSLH
Sbjct  2    SPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG------GPAKKTCMCSPTSHPGSFRCSLH  55

Query  472  KN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            KN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPSSH  R
Sbjct  56   KNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPSSHHLR  115

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RRG F+ RPSRLS MSKAE+
Sbjct  116  RRGAFETRPSRLSVMSKAED  135



>gb|KDP30200.1| hypothetical protein JCGZ_16982 [Jatropha curcas]
Length=211

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 105/134 (78%), Gaps = 5/134 (4%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            PSVR S+DR  SP+RS+S     +    Q V    ++ PK+TC+CSPTSHPGSFRCSLHK
Sbjct  80   PSVRISLDRPSSPNRSISTINPSRG--HQVVRK--SSTPKRTCMCSPTSHPGSFRCSLHK  135

Query  469  NMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
              N+  S +Y S  RLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRRG FQ
Sbjct  136  GFNNSSSANYSSNTRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRGAFQ  195

Query  292  PRPSRLSRMSKAEE  251
            PRPSRLS MSKAE+
Sbjct  196  PRPSRLSVMSKAED  209



>ref|XP_010050691.1| PREDICTED: uncharacterized protein LOC104439311 [Eucalyptus grandis]
Length=247

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 108/145 (74%), Gaps = 12/145 (8%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            +SS  +PSVRFSIDRS SP RS++V  R  V+R+QG   P     KKTC+CSPTSHPGSF
Sbjct  107  SSSQMSPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG--GP----AKKTCMCSPTSHPGSF  160

Query  487  RCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            RCSLHKN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPS
Sbjct  161  RCSLHKNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPS  220

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SH  RRRG F+ RPSRLS MSKAE+
Sbjct  221  SHHLRRRGAFETRPSRLSVMSKAED  245



>ref|XP_009358531.1| PREDICTED: uncharacterized protein LOC103949156 [Pyrus x bretschneideri]
Length=196

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 99/134 (74%), Gaps = 11/134 (8%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL-PKKTCLCSPTSHPGSFRCSLHK  470
            SVRFS DR  SP        R   V  +G G+   +  PK+TC+CSPT+HPGSFRCSLHK
Sbjct  71   SVRFSFDRPTSP-------SRSISVAPRGTGSHHHHTAPKRTCMCSPTTHPGSFRCSLHK  123

Query  469  NMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            N NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALA+LIRPSSH QRRR DF
Sbjct  124  N-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALASLIRPSSHSQRRRADF  182

Query  295  QPRPSRLSRMSKAE  254
             PRPSRLS MSK++
Sbjct  183  CPRPSRLSAMSKSD  196



>ref|XP_009363915.1| PREDICTED: uncharacterized protein LOC103953846 [Pyrus x bretschneideri]
Length=207

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 102/141 (72%), Gaps = 13/141 (9%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvs-------rrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SVRFS DR  SP RS+SVS              K G      + PK+TC+CSPT+HPGSF
Sbjct  71   SVRFSFDRPTSPSRSISVSPRGTGAHHHHHTAVKSGRN---ISQPKRTCMCSPTTHPGSF  127

Query  487  RCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            RCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RAL+ALIRPSSH Q
Sbjct  128  RCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALSALIRPSSHSQ  186

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            RRR DF+PRPSRLS MSK+ E
Sbjct  187  RRRADFRPRPSRLSTMSKSNE  207



>emb|CDO98193.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 99/144 (69%), Gaps = 16/144 (11%)
 Frame = -1

Query  664  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            S +PTPSVRFS    RSI               + +    P+ +  KKTCLCSPT+HPGS
Sbjct  61   SVSPTPSVRFSTSPGRSI----------VVSPRQSRQSNRPVPSNQKKTCLCSPTTHPGS  110

Query  490  FRCSLHKNMNSRP----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            FRCSLHKN N       S +  S++LN RRSAMTNSLVRIGTVEGDLVKRAL ALIRPSS
Sbjct  111  FRCSLHKNTNRNDHHTGSYNRSSHQLNMRRSAMTNSLVRIGTVEGDLVKRALTALIRPSS  170

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            H  RRRGDF PRPSRLS MSKAE+
Sbjct  171  HNLRRRGDFHPRPSRLSIMSKAED  194



>ref|XP_009338399.1| PREDICTED: uncharacterized protein LOC103930750 [Pyrus x bretschneideri]
Length=205

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA---NLPKKTCLCSPTSHPGSFRCSL  476
            SVRFS DR  SP RS+SV+ R           P     + PK+TC+CSPT+HPGSFRCSL
Sbjct  71   SVRFSFDRPTSPSRSISVAPRGTGSHHHHTAVPSGRNISQPKRTCMCSPTTHPGSFRCSL  130

Query  475  HKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            HKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALA+LIRPSSH QRRR 
Sbjct  131  HKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALASLIRPSSHSQRRRA  189

Query  301  DFQPRPSRLSRMSKAE  254
            DF PRPSRLS MSK++
Sbjct  190  DFCPRPSRLSAMSKSD  205



>ref|XP_010048163.1| PREDICTED: uncharacterized protein LOC104437010 [Eucalyptus grandis]
 gb|KCW80339.1| hypothetical protein EUGRSUZ_C01705 [Eucalyptus grandis]
 gb|KCW80340.1| hypothetical protein EUGRSUZ_C01705 [Eucalyptus grandis]
Length=216

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 12/145 (8%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            +SS  +PSVRFSIDRS SP RS++V  R  V+R+QG         KKTC+CSPTSHPGSF
Sbjct  76   SSSQMSPSVRFSIDRSTSPGRSIAVPPRQHVIRRQG------GPAKKTCMCSPTSHPGSF  129

Query  487  RCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            RCSLHKN             S+PSNRLN RRSAMTNS+VRIG VEG+L++R+L ALIRPS
Sbjct  130  RCSLHKNSVAGGSGGGGQQASFPSNRLNMRRSAMTNSIVRIGGVEGELMRRSLTALIRPS  189

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SH  RRRG F+ RPSRLS MSKAE+
Sbjct  190  SHHLRRRGAFETRPSRLSVMSKAED  214



>ref|XP_002271365.1| PREDICTED: uncharacterized protein LOC100242170 [Vitis vinifera]
Length=203

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 7/135 (5%)
 Frame = -1

Query  640  RFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNMN  461
            RFSI+   SP RS+SVS RDQVVRKQ  G   ++  K+TCLCSPT+HPGSFRCS+HKN N
Sbjct  70   RFSIEPQTSPRRSISVSPRDQVVRKQNTG---SSRQKRTCLCSPTTHPGSFRCSMHKNAN  126

Query  460  SRPSIS----YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
            +         Y SNRLNARRSAMTNSLVRIG VEGDLVKRAL+ALIRPSSHQQRRR  F+
Sbjct  127  TGAGSGSGGAYQSNRLNARRSAMTNSLVRIGGVEGDLVKRALSALIRPSSHQQRRRAAFE  186

Query  292  PRPSRLSRMSKAEED  248
            PR SRLS MS A  D
Sbjct  187  PRLSRLSIMSMAGSD  201



>ref|XP_009798216.1| PREDICTED: uncharacterized protein LOC104244483 [Nicotiana sylvestris]
Length=202

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 100/143 (70%), Gaps = 17/143 (12%)
 Frame = -1

Query  658  TPTPSVRFS--IDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            +P+P+VRFS    RSIS H             KQ    PL +  KKTC+CSPT+HPGSFR
Sbjct  69   SPSPNVRFSASTSRSISVHPHQQ---------KQN-SRPLQSNQKKTCMCSPTTHPGSFR  118

Query  484  CSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            CSLHKNM     +S  S    S  LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSH
Sbjct  119  CSLHKNMSQNRGHSNSSSYRSSYHLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSH  178

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
              RRR DFQPRPSRLS MSKAE+
Sbjct  179  HLRRRDDFQPRPSRLSVMSKAED  201



>ref|XP_008788890.1| PREDICTED: uncharacterized protein LOC103706534 [Phoenix dactylifera]
Length=213

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 104/149 (70%), Gaps = 16/149 (11%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP----KKTCLCSPTSHPGSF  488
            PT SVRFSIDR  SP RS++ +   +    Q    P+   P    +KTC+CSPT+HPGSF
Sbjct  66   PTSSVRFSIDRPTSPGRSLAFASPRKHHSPQR--RPITAAPAGGQRKTCMCSPTNHPGSF  123

Query  487  RCSLHKNMNS----------RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  338
            RC+LHK   +          R ++S PSNRLNARRSAMTNSLVRIGTVEG+ V+RALAAL
Sbjct  124  RCNLHKGFAAHGVGGRHHYHRQAVSSPSNRLNARRSAMTNSLVRIGTVEGEWVRRALAAL  183

Query  337  IRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            I PSSH QRRR  F PRPSRLS MSKA++
Sbjct  184  IHPSSHHQRRRAAFHPRPSRLSIMSKADD  212



>ref|XP_003533861.1| PREDICTED: uncharacterized protein LOC100794542 [Glycine max]
Length=191

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 2/96 (2%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP--SNRLNARRSAMTNSLVRIGTVEGDLV  359
            K+TC+CSPTSHPGSFRCSLHK+  SR ++S    SNRLNARRSAMTNSLVRI  VEG+LV
Sbjct  96   KRTCMCSPTSHPGSFRCSLHKSFGSRSAVSAAPASNRLNARRSAMTNSLVRIRGVEGELV  155

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            KRALAALIRPSSHQQRRRGDF+PRPSRLS M  A++
Sbjct  156  KRALAALIRPSSHQQRRRGDFRPRPSRLSVMFTAKD  191



>ref|XP_004498757.1| PREDICTED: vitellogenin-2-like [Cicer arietinum]
Length=205

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
             RFSID RSISP+R+V      Q        +    + KKTC+CSPT+HPGSFRCSLHKN
Sbjct  75   FRFSIDHRSISPNRTVPSHVISQKNHHHNHNS----IQKKTCMCSPTTHPGSFRCSLHKN  130

Query  466  MNSRP---SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
              S     S SYPSNRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQ+RR  F
Sbjct  131  SGSNSIHHSDSYPSNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQKRRSAF  190

Query  295  QPRPSRLSRMSKAEE  251
            + RPSRLS MSKA+E
Sbjct  191  ESRPSRLSVMSKADE  205



>ref|XP_009799051.1| PREDICTED: uncharacterized protein LOC104245184 [Nicotiana sylvestris]
Length=172

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            S RFS+DR IS   S S+S  ++          +++  K TC+CSPT+HPGSFRCS+HK 
Sbjct  35   SKRFSLDREISTSPSRSISVMNRESTTNRQYKSMSSQKKMTCMCSPTTHPGSFRCSMHKK  94

Query  466  MNSRPSISYPSNR--LNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
            M+ R SI   S+   LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR  FQ
Sbjct  95   MDVRRSIQTASSSYSLNTRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRYGFQ  154

Query  292  PRPSRLSRMSKAEE  251
             RPSRLS MS+ ++
Sbjct  155  RRPSRLSNMSRTDD  168



>ref|XP_002531449.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30936.1| conserved hypothetical protein [Ricinus communis]
Length=203

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 106/144 (74%), Gaps = 10/144 (7%)
 Frame = -1

Query  673  GXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  494
            G A++    SVRFS+DR ISP+RS++ S        Q V  P     KKTC+CSPT+HPG
Sbjct  63   GSATTRSASSVRFSLDRPISPNRSITSSVSRAP--HQVVRKP----SKKTCMCSPTTHPG  116

Query  493  SFRCSLHKNMNSRPSISY----PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            SFRCSLHKN N+  S S     PS RLNARRSAMTNSLVRI  VEGDLVKRAL++LIRPS
Sbjct  117  SFRCSLHKNFNNNNSNSVNYPSPSTRLNARRSAMTNSLVRICGVEGDLVKRALSSLIRPS  176

Query  325  SHQQRRRGDFQPRPSRLSRMSKAE  254
            SHQQ+RR  FQPRPSRLS MSKAE
Sbjct  177  SHQQKRRAAFQPRPSRLSVMSKAE  200



>ref|XP_010099865.1| hypothetical protein L484_008522 [Morus notabilis]
 gb|EXB80742.1| hypothetical protein L484_008522 [Morus notabilis]
Length=214

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 107/136 (79%), Gaps = 15/136 (11%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            SVRFSID RSISP+RS++VS       KQ    P++ + K+TC+CSPT+HPGSFRCSLHK
Sbjct  89   SVRFSIDHRSISPNRSITVS-------KQ---RPIS-MTKRTCMCSPTTHPGSFRCSLHK  137

Query  469  NMNSRPS---ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N++S  S    SYPSNRLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  
Sbjct  138  NVSSGGSHNAASYPSNRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSA  197

Query  298  FQPRPSRLSRMSKAEE  251
            FQP  SRLS MSKA++
Sbjct  198  FQPTRSRLSVMSKADD  213



>ref|XP_003546585.1| PREDICTED: putative protein TPRXL-like [Glycine max]
Length=190

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS-NRLNARRSAMTNSLVRIGTVEGDLVK  356
            K+TC+CSPTSHPGSFRCSLHK+  SR +++  S NRLNARRSAMTNSLVRI  VEG+LVK
Sbjct  96   KRTCMCSPTSHPGSFRCSLHKSFGSRSAVAAASPNRLNARRSAMTNSLVRIRGVEGELVK  155

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RALAALIRPSSHQQRRRGDF+PRPSRLS M  A++
Sbjct  156  RALAALIRPSSHQQRRRGDFRPRPSRLSIMFTAKD  190



>gb|AFK38729.1| unknown [Medicago truncatula]
 gb|AES73593.2| plant/F18G18-20 protein [Medicago truncatula]
Length=223

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 98/133 (74%), Gaps = 10/133 (8%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFSID RSISP+RS+S               P+    KKTC+CSPT+HPGSFRCSLHKN
Sbjct  97   VRFSIDSRSISPNRSISNHVITTK------NRPIP-AQKKTCMCSPTNHPGSFRCSLHKN  149

Query  466  M--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
               NS  + SYPS RLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+
Sbjct  150  NGNNSSNADSYPSTRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSAFE  209

Query  292  PRPSRLSRMSKAE  254
            PRPSRLS MSKAE
Sbjct  210  PRPSRLSVMSKAE  222



>ref|XP_006465228.1| PREDICTED: vitellogenin-2-like [Citrus sinensis]
 gb|KDO52317.1| hypothetical protein CISIN_1g048815mg [Citrus sinensis]
Length=206

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPSRSISYTRQISKSNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  475  HKNMNSRPSIS------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            HK  NS  S        + S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYNSHKTASCSHHSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSNMSKADD  205



>gb|EYU32362.1| hypothetical protein MIMGU_mgv1a014368mg [Erythranthe guttata]
Length=192

 Score =   147 bits (370),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 5/101 (5%)
 Frame = -1

Query  538  LPKKTCLCSPTSHPGSFRCSLHKNMNSR-----PSISYPSNRLNARRSAMTNSLVRIGTV  374
            L K+TC+CSPT+HPGSFRC+LHKN ++R      S+ Y  NRLN RRSAMTNSLVRIGTV
Sbjct  90   LHKRTCMCSPTTHPGSFRCALHKNSSTRRGSSDHSLPYSPNRLNMRRSAMTNSLVRIGTV  149

Query  373  EGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            EGDL+KRALAALIRPSSHQQRRR  FQ +PSRLS MSKAE+
Sbjct  150  EGDLMKRALAALIRPSSHQQRRRAGFQSQPSRLSVMSKAED  190



>ref|XP_006450364.1| hypothetical protein CICLE_v10009513mg [Citrus clementina]
 gb|ESR63604.1| hypothetical protein CICLE_v10009513mg [Citrus clementina]
 gb|KDO61818.1| hypothetical protein CISIN_1g028670mg [Citrus sinensis]
 gb|KDO61819.1| hypothetical protein CISIN_1g028670mg [Citrus sinensis]
Length=205

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
             S++PTPS RFSIDRSISP+RS+SV        KQ   N   +  KKTC+CSPT+HPGSF
Sbjct  72   TSASPTPSFRFSIDRSISPNRSISVP-------KQ---NNHISFQKKTCMCSPTTHPGSF  121

Query  487  RCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            RCSLHKN     +S  + SY SN LN RRSAMTNSLVRIG VEG+ +KR+L  LIRPSSH
Sbjct  122  RCSLHKNSGVNSHSNGTGSYQSNSLNMRRSAMTNSLVRIGGVEGEWMKRSLRDLIRPSSH  181

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRR  FQPRPSRL   SK E+
Sbjct  182  HQRRRSAFQPRPSRLCITSKYED  204



>ref|XP_006483414.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=205

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
             S++PTPS RFSIDRSISP+RS+SV        KQ   N   +  KKTC+CSPT+HPGSF
Sbjct  72   TSASPTPSFRFSIDRSISPNRSISVP-------KQ---NNHISFQKKTCMCSPTTHPGSF  121

Query  487  RCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            RCSLHKN     +S  + SY SN LN RRSAMTNSLVRIG VEG+ +KR+L  LIRPSSH
Sbjct  122  RCSLHKNSGVNGHSNGTGSYQSNSLNMRRSAMTNSLVRIGGVEGEWMKRSLRDLIRPSSH  181

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
             QRRR  FQPRPSRL   SK E+
Sbjct  182  HQRRRSAFQPRPSRLCITSKYED  204



>ref|XP_008336956.1| PREDICTED: putative protein TPRXL [Malus domestica]
Length=207

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 98/144 (68%), Gaps = 21/144 (15%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLA-----------NLPKKTCLCSPTSH  500
            SVRFS DR  SP        R   V  +G G               + PK+TC+CSPT+H
Sbjct  72   SVRFSFDRPTSP-------SRSISVSPRGTGXHHHHHTAVPSGRNISQPKRTCMCSPTTH  124

Query  499  PGSFRCSLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            PGSFRCSLHKN NS  + S  Y  NRLNARRSAMTNSLVRIG VEGDLV+RALAALIRPS
Sbjct  125  PGSFRCSLHKN-NSHVTASAPYSQNRLNARRSAMTNSLVRIGGVEGDLVRRALAALIRPS  183

Query  325  SHQQRRRGDFQPRPSRLSRMSKAE  254
            SH QRRR DF PRPSRLS MSK++
Sbjct  184  SHSQRRRADFCPRPSRLSAMSKSD  207



>ref|XP_011458842.1| PREDICTED: putative protein TPRXL [Fragaria vesca subsp. vesca]
Length=224

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 104/142 (73%), Gaps = 15/142 (11%)
 Frame = -1

Query  664  SSTPTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            SS  +P+VRFSI+ RSISP+RS++ S+      K G   P+A   +KTC+CSPT+HPGSF
Sbjct  92   SSALSPAVRFSIEHRSISPNRSITASK------KNG---PIA-ASRKTCMCSPTTHPGSF  141

Query  487  RCSLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            RCSLHKN  S         YP+NRLN RRSAMTNSLVRI  VEG+ VKRAL ALIRPSSH
Sbjct  142  RCSLHKNQGSSNQHHNHTPYPNNRLNMRRSAMTNSLVRISGVEGEWVKRALTALIRPSSH  201

Query  319  QQRRRGDFQPRPSRLSRMSKAE  254
            QQRRR  FQPR SRLS MSKA 
Sbjct  202  QQRRRAGFQPRQSRLSVMSKAN  223



>gb|ABA40431.1| unknown [Solanum tuberosum]
Length=242

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 101/137 (74%), Gaps = 14/137 (10%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN-  467
            VRFS+DRS SP RS+S   R+ VV+ +          KK+C+CSPT+HPGSFRCSLHKN 
Sbjct  77   VRFSLDRSTSPSRSISAVNRNHVVQNRS--------QKKSCMCSPTTHPGSFRCSLHKNR  128

Query  466  -----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
                   SR + +Y  N+L  RRSAMTNSLVRIGTVEGDLV+RALAALIRPSSHQQRRR 
Sbjct  129  SGSGSTGSRTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVRRALAALIRPSSHQQRRRA  188

Query  301  DFQPRPSRLSRMSKAEE  251
            DFQ RPSRLS M KA+ 
Sbjct  189  DFQRRPSRLSAMFKADN  205



>ref|XP_006427484.1| hypothetical protein CICLE_v10027309mg [Citrus clementina]
 gb|ESR40724.1| hypothetical protein CICLE_v10027309mg [Citrus clementina]
Length=206

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPGRSISYTRQISKCNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  475  HKNMNSRPSIS------YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            HK  NS  S        + S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYNSHKTASCSHHSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSNMSKADD  205



>ref|XP_010323270.1| PREDICTED: uncharacterized protein LOC101254911 [Solanum lycopersicum]
Length=206

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 102/137 (74%), Gaps = 14/137 (10%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFS++RS SP RS++   R+ VV+ +          KK+C+CSPT+HPGSFRCSLHKN 
Sbjct  77   VRFSLERSTSPSRSIAAVNRNHVVQNRS--------QKKSCMCSPTTHPGSFRCSLHKNK  128

Query  463  NSRPSI------SYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            +   S       +Y  N+L  RRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR 
Sbjct  129  SGSGSTGRGTAATYSPNQLILRRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRA  188

Query  301  DFQPRPSRLSRMSKAEE  251
            DFQ RPSRLS MSKA++
Sbjct  189  DFQCRPSRLSVMSKADD  205



>gb|KDP33557.1| hypothetical protein JCGZ_07128 [Jatropha curcas]
Length=209

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 100/131 (76%), Gaps = 14/131 (11%)
 Frame = -1

Query  631  IDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRP  452
            IDRSISP+RS+SVS++          NP++ L KKTC+CSPT+HPGSFRCSLHKN+ S+ 
Sbjct  88   IDRSISPNRSISVSKK---------NNPIS-LSKKTCMCSPTTHPGSFRCSLHKNIGSQS  137

Query  451  ----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRP  284
                S  Y  NRLN  RSAM NSLVRIG VEG+ VKRAL ALIRPSSH QRRR DFQPRP
Sbjct  138  HGSSSAPYTPNRLNMMRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHHQRRRADFQPRP  197

Query  283  SRLSRMSKAEE  251
            SRLS MSKA++
Sbjct  198  SRLSIMSKADD  208



>ref|XP_004287242.1| PREDICTED: uncharacterized protein LOC101298453 [Fragaria vesca 
subsp. vesca]
Length=205

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  646  SVRFSI-DRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            SVRFS+ DR  SP RS+SVS        +       N  K+TC+CSPTSHPGSFRCSLHK
Sbjct  74   SVRFSLLDRPTSPSRSISVSPHGSGCHHRSAMKKQINTTKRTCMCSPTSHPGSFRCSLHK  133

Query  469  NMNSRPS--ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            N ++  S  + Y  NRLNARRSAMTNSLVRIG VEG+++KRALAALIRPSSH QRRR DF
Sbjct  134  NTSASSSSAVPYSQNRLNARRSAMTNSLVRIGGVEGEIMKRALAALIRPSSHSQRRRADF  193

Query  295  QPRPSRLSRMSK  260
            +PRPSRLS+ S+
Sbjct  194  RPRPSRLSKCSE  205



>ref|XP_003603342.1| hypothetical protein MTR_3g106530 [Medicago truncatula]
Length=275

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 98/133 (74%), Gaps = 10/133 (8%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFSID RSISP+RS+S               P+    KKTC+CSPT+HPGSFRCSLHKN
Sbjct  97   VRFSIDSRSISPNRSISNHVITTK------NRPIP-AQKKTCMCSPTNHPGSFRCSLHKN  149

Query  466  M--NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
               NS  + SYPS RLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQQRRR  F+
Sbjct  150  NGNNSSNADSYPSTRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRSAFE  209

Query  292  PRPSRLSRMSKAE  254
            PRPSRLS MSKAE
Sbjct  210  PRPSRLSVMSKAE  222



>gb|EYU25275.1| hypothetical protein MIMGU_mgv1a014625mg [Erythranthe guttata]
Length=184

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 11/135 (8%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PS+RFS+DR  SP+RS+S + R         G P A   K+TC+CSPT+HPGSFRCSLH
Sbjct  58   SPSLRFSMDRPGSPNRSISFTTRS--------GKPAAAPQKRTCMCSPTNHPGSFRCSLH  109

Query  472  KN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRG  302
            K      SR +    S+RLN RRSAM NSLVRIGTVEGDLV RALAALIRPSSH QRRRG
Sbjct  110  KANKPTASRTASCGSSSRLNMRRSAMKNSLVRIGTVEGDLVTRALAALIRPSSHNQRRRG  169

Query  301  DFQPRPSRLSRMSKA  257
            +F+PRPSRLS M+K+
Sbjct  170  EFRPRPSRLSAMAKS  184



>ref|XP_010557627.1| PREDICTED: uncharacterized protein LOC104826566 [Tarenaya hassleriana]
Length=206

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = -1

Query  646  SVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            +VRFS++R  SP      +        Q V +      K+TCLCSPT+HPGSFRCSLHK 
Sbjct  70   TVRFSLERPTSP-GRSISAVGHSPRAGQIVRSQTPPQQKRTCLCSPTNHPGSFRCSLHKA  128

Query  466  MNSRPS---ISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
              +R S    SY P+NRL+ARRSAMTNSLVRI  VEG+LVKRALAALIRPSSH QRRR D
Sbjct  129  AAARGSHAQTSYSPNNRLHARRSAMTNSLVRICGVEGELVKRALAALIRPSSHHQRRRAD  188

Query  298  FQPRPSRLSRMSKAEED  248
            F PRPSRLS MSKAE+ 
Sbjct  189  FHPRPSRLSVMSKAEDS  205



>ref|XP_009407367.1| PREDICTED: mucin-1-like [Musa acuminata subsp. malaccensis]
Length=214

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 103/149 (69%), Gaps = 11/149 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            L G   S  TPSV FS+DRS SP           V R++      A   ++TC+CSPT+H
Sbjct  70   LVGSTPSPRTPSVHFSLDRSTSP-----GRSLAVVDRRRPASASAAAPARRTCMCSPTTH  124

Query  499  PGSFRCSLHKNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  338
            PGSFRCSLHK +      N   + S PSNRLNARRSAMTNSLVRIG VEG+ VKRALA+L
Sbjct  125  PGSFRCSLHKGLRFPPHHNQHAASSSPSNRLNARRSAMTNSLVRIGAVEGEWVKRALASL  184

Query  337  IRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            IRPSSHQQRRR DF+PR SRLS MS+A++
Sbjct  185  IRPSSHQQRRRADFRPRLSRLSVMSRADD  213



>ref|XP_002309648.1| serine-rich family protein [Populus trichocarpa]
 gb|ABK95959.1| unknown [Populus trichocarpa]
 gb|EEE93171.1| serine-rich family protein [Populus trichocarpa]
Length=210

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 11/137 (8%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PS RFSIDRS SP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSFRCSLH
Sbjct  81   SPSFRFSIDRSTSPNRSISVS-------KKNHSHPIS-APKRTCMCSPTTHRGSFRCSLH  132

Query  472  KNMNSR--PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            KN +S   P++  P +RLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRRG 
Sbjct  133  KNSSSSSNPAMFTP-HRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRGA  191

Query  298  FQPRPSRLSRMSKAEED  248
            FQPR SRLS MSKA+++
Sbjct  192  FQPRQSRLSIMSKADDE  208



>ref|XP_006356235.1| PREDICTED: uncharacterized protein LOC102603646 [Solanum tuberosum]
Length=189

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 102/144 (71%), Gaps = 16/144 (11%)
 Frame = -1

Query  664  SSTPTPSVRF--SIDRSISPHrsvsvsrrdqvvRKQGVGNPL--ANLPKKTCLCSPTSHP  497
            S +P+PSVRF  S  RSIS              + Q   +PL  A+  KK C CSPT+HP
Sbjct  56   SVSPSPSVRFFSSPSRSIS----------VFPRKPQQNSHPLPSASNQKKHCTCSPTTHP  105

Query  496  GSFRCSLHKNMN--SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            GSFRCSLHKN    SR    + S++LN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSS
Sbjct  106  GSFRCSLHKNTTNRSRGQSYHSSHQLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSS  165

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQ RRR DFQP+PSRLS MSKAE+
Sbjct  166  HQLRRRCDFQPKPSRLSVMSKAED  189



>ref|XP_010927347.1| PREDICTED: uncharacterized protein LOC105049415 [Elaeis guineensis]
Length=218

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHr-svsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            AS  P PSVRFS+D+   P     S++  D  +  + + +P     ++TC+CSPT+HPGS
Sbjct  75   ASPAPVPSVRFSLDQHRRPTSPGRSLAVADHHLSPRPIASPAPQ--RRTCMCSPTNHPGS  132

Query  490  FRCSLHKNMNSRPS----ISY-PSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            FRCSLHK ++  P      S+ PSNRLNARRSAMTNSLVRIGTVEG+ VKRAL ALIRPS
Sbjct  133  FRCSLHKGLHLHPHHQNHASFSPSNRLNARRSAMTNSLVRIGTVEGEWVKRALTALIRPS  192

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SHQQRRR  FQPR SRLS MSKA++
Sbjct  193  SHQQRRRAAFQPRRSRLSVMSKADD  217



>ref|XP_004507199.1| PREDICTED: uncharacterized protein LOC101499615, partial [Cicer 
arietinum]
Length=175

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 10/142 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL---PKKTCLCSP  509
             H    S    SV FS D  +SP+ S+S +         G G  +  L    K+TC+CSP
Sbjct  40   FHRSTFSVQASSVLFSFDSCVSPNSSISFTV-------SGTGETVKRLNHRKKRTCMCSP  92

Query  508  TSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            ++HPGSFRCS HK++ S  +++Y  NRLNARRSAMTNSLVRI  VEG+LVK+ALA+LIRP
Sbjct  93   STHPGSFRCSFHKSLGSGAAVTYAPNRLNARRSAMTNSLVRIRGVEGELVKKALASLIRP  152

Query  328  SSHQQRRRGDFQPRPSRLSRMS  263
            SSH QRRR DFQPRPS+ S M+
Sbjct  153  SSHNQRRRYDFQPRPSQKSLMT  174



>ref|XP_008452898.1| PREDICTED: putative protein TPRXL [Cucumis melo]
 gb|ADN34124.1| serine-rich protein [Cucumis melo subsp. melo]
Length=213

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 105/139 (76%), Gaps = 15/139 (11%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            TPSVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPGSFRCSL
Sbjct  84   TPSVRFFIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPGSFRCSL  133

Query  475  HKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            HKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPSSHQQRR
Sbjct  134  HKNVSSGGGHSQMVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPSSHQQRR  193

Query  307  RGDFQPRPSRLSRMSKAEE  251
            R  FQPR SRLS MSKA++
Sbjct  194  RAAFQPRSSRLSVMSKADD  212



>ref|XP_011078547.1| PREDICTED: uncharacterized protein LOC105162252 [Sesamum indicum]
Length=203

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 17/142 (12%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRCS  479
            +PS+ FS+DR  SP+RS+S+S R +        +P +  P  K+TC+CSPT+HPGSFRCS
Sbjct  69   SPSLSFSLDRPGSPNRSISMSTRVE-------NSPASTAPSQKRTCMCSPTNHPGSFRCS  121

Query  478  LHKN---MNSRPSISYP-----SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            LHK     N  PS S       S+RLN RRSAMTNSLVRIGTVEGDLV+RALAALIRPSS
Sbjct  122  LHKAGFANNGVPSSSQAATCGSSSRLNMRRSAMTNSLVRIGTVEGDLVRRALAALIRPSS  181

Query  322  HQQRRRGDFQPRPSRLSRMSKA  257
            HQQRRRG+F+PRPSRLS MSKA
Sbjct  182  HQQRRRGEFRPRPSRLSVMSKA  203



>gb|AAN62344.1|AF506028_11 CTV.15 [Citrus trifoliata]
Length=206

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            +PSVRFSID R ISP RS+S +R+              N PK+TC CSPT+HPGSFRC+L
Sbjct  69   SPSVRFSIDNRPISPGRSISYTRQISKSNNAAS----FNAPKRTCACSPTTHPGSFRCAL  124

Query  475  HKNMNSRPS------ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            HK  NS  S        Y S+RLN RRSAMTNSLVRIG VEG+LVKRAL ALIRPSSHQQ
Sbjct  125  HKRTNSYSSHKTASSSHYSSSRLNYRRSAMTNSLVRIGGVEGELVKRALTALIRPSSHQQ  184

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            RRR  F+PRPSRLS MSKA++
Sbjct  185  RRRAAFEPRPSRLSIMSKADD  205



>ref|XP_010555066.1| PREDICTED: uncharacterized protein PB18E9.04c-like [Tarenaya 
hassleriana]
Length=202

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 13/140 (9%)
 Frame = -1

Query  655  PTPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCS  479
            PT S RFSID RSISP+RS++VS+  +    +          +K C+CSPT+HPGSFRCS
Sbjct  72   PTQSFRFSIDSRSISPNRSIAVSKPSRHQISEQ---------RKRCMCSPTTHPGSFRCS  122

Query  478  LHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            LHKN+   + + + SYPSNRLN RRSAMTNSLVRIG VEG+ V+RAL ALIRPSSH  RR
Sbjct  123  LHKNVANPHGQGAASYPSNRLNMRRSAMTNSLVRIGGVEGEWVRRALTALIRPSSHHLRR  182

Query  307  RGDFQPRPSRLSRMSKAEED  248
            R  FQPRPS+LS MS+A++ 
Sbjct  183  RAAFQPRPSKLSVMSQADDQ  202



>ref|XP_010033986.1| PREDICTED: uncharacterized protein LOC104423200 [Eucalyptus grandis]
 gb|KCW53871.1| hypothetical protein EUGRSUZ_J03089 [Eucalyptus grandis]
Length=204

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 4/98 (4%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRP---SISYPSNR-LNARRSAMTNSLVRIGTVEGD  365
            KKTC+CSPTSHPGSFRC+LHKN  S P   S +Y S+R LN RRSAMTNSLVRIG VEGD
Sbjct  106  KKTCMCSPTSHPGSFRCALHKNSRSNPQHHSGTYNSSRSLNFRRSAMTNSLVRIGGVEGD  165

Query  364  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            LVKRALAALIRPSSHQ RRR DF+PRPSRLS MS AE+
Sbjct  166  LVKRALAALIRPSSHQLRRRADFKPRPSRLSTMSSAED  203



>ref|XP_006350113.1| PREDICTED: uncharacterized protein LOC102599166 [Solanum tuberosum]
Length=164

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 14/132 (11%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            +RF++DR  SP RS+SV  R +          +A+  KKTC+CSPT+HPGSFRCS+HK M
Sbjct  37   IRFTLDRETSPSRSISVMNRQKT---------MASSQKKTCMCSPTNHPGSFRCSMHKKM  87

Query  463  NSRPS-----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            ++R S      +  S RL+ RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR D
Sbjct  88   DNRRSSNTSQTASNSIRLHMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRSD  147

Query  298  FQPRPSRLSRMS  263
            FQ RPSRLS +S
Sbjct  148  FQRRPSRLSVIS  159



>ref|XP_011020249.1| PREDICTED: uncharacterized protein LOC105122688 [Populus euphratica]
Length=212

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 10/148 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            ++G  S + +PSVR +   +ISP+RS+S     +    Q V     + PK+TC+CSPT+H
Sbjct  70   MYGHTSQSSSPSVRLN---AISPNRSISTVNPSRSHHHQVVKK--QSTPKRTCMCSPTTH  124

Query  499  PGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            PGSFRCSLHK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALA+LI
Sbjct  125  PGSFRCSLHKGVGFGSSPSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALASLI  184

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RPSSHQQRRR  FQPRPSRLS MSK+E+
Sbjct  185  RPSSHQQRRRSAFQPRPSRLSVMSKSED  212



>ref|XP_008813132.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
 ref|XP_008813133.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
 ref|XP_008813135.1| PREDICTED: uncharacterized protein LOC103723846 [Phoenix dactylifera]
Length=218

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 102/145 (70%), Gaps = 8/145 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHr-svsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            AS  P PSVRFS+D+   P     S++  D  +  + + +P     ++TC+CSPT+HPGS
Sbjct  75   ASPAPVPSVRFSLDQHRRPTSPGRSLAVADHHLSPRPISSPAPQ--RRTCMCSPTNHPGS  132

Query  490  FRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            FRCSLHK +   P     +   PSNRLNARRSAMTNSLVRIGTVEG+ VKRAL ALIRPS
Sbjct  133  FRCSLHKGIQLHPYRQNHAAFSPSNRLNARRSAMTNSLVRIGTVEGEWVKRALTALIRPS  192

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEE  251
            SHQQRRR  F PR SRLS MSKA++
Sbjct  193  SHQQRRRAAFHPRQSRLSVMSKADD  217



>ref|XP_006381071.1| hypothetical protein POPTR_0006s05980g [Populus trichocarpa]
 gb|ERP58868.1| hypothetical protein POPTR_0006s05980g [Populus trichocarpa]
Length=212

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 10/147 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            ++G  S + +PSVR +   +ISP+RS+S     +    Q V     + PK+TC+CSPT+H
Sbjct  70   MYGHTSQSSSPSVRLN---AISPNRSISTVNPSRSHHHQVVKK--QSTPKRTCMCSPTTH  124

Query  499  PGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            PGSFRCSLHK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALA+LI
Sbjct  125  PGSFRCSLHKGVGFGGSPSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALASLI  184

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            RPSSHQQRRR  FQPRPSRLS MSK+E
Sbjct  185  RPSSHQQRRRSAFQPRPSRLSVMSKSE  211



>ref|XP_007224858.1| hypothetical protein PRUPE_ppa022839mg, partial [Prunus persica]
 gb|EMJ26057.1| hypothetical protein PRUPE_ppa022839mg, partial [Prunus persica]
Length=146

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -1

Query  538  LPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS-YPSNRLNARRSAMTNSLVRIGTVEGDL  362
            +PKKTC+CSP SHPGSFRCSLHKN+    + + YP+NRLN RRS MTNSLVRIG VEG+ 
Sbjct  50   MPKKTCMCSPMSHPGSFRCSLHKNIGGGHNAAPYPTNRLNMRRSTMTNSLVRIGGVEGEW  109

Query  361  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            VK+AL ALIRP +HQQRRR  FQPRPSRLS MS A++
Sbjct  110  VKQALTALIRPCAHQQRRRAGFQPRPSRLSAMSTADK  146



>ref|XP_004251739.1| PREDICTED: uncharacterized protein LOC101264293 [Solanum lycopersicum]
Length=164

 Score =   140 bits (353),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 96/132 (73%), Gaps = 14/132 (11%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            +RF++DR  SP RS+SV  R            LA+  KK C+CSPT+HPGSFRCS+HK M
Sbjct  37   IRFTLDRETSPSRSISVMNRQ---------KTLASSQKKRCMCSPTNHPGSFRCSMHKKM  87

Query  463  NSRPSISYP-----SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            + R S S       S RL+ RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSHQQRRR D
Sbjct  88   DIRRSSSTSQTASNSIRLHMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSHQQRRRSD  147

Query  298  FQPRPSRLSRMS  263
            FQ RPSRLS +S
Sbjct  148  FQRRPSRLSVIS  159



>gb|EYU25274.1| hypothetical protein MIMGU_mgv1a014567mg [Erythranthe guttata]
Length=185

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK-TCLCSPTSHPGSFRCSL  476
            +PS+RFS+DR  SP+RS+S + R         G P A   KK TC+CSPT+HPGSFRCSL
Sbjct  58   SPSLRFSMDRPGSPNRSISFTTRS--------GKPAAAPQKKQTCMCSPTNHPGSFRCSL  109

Query  475  HKN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRR  305
            HK      SR +    S+RLN RRSAM NSLVRIGTVEGDLV RALAALIRPSSH QRRR
Sbjct  110  HKPNKPTASRTASCGSSSRLNMRRSAMKNSLVRIGTVEGDLVTRALAALIRPSSHNQRRR  169

Query  304  GDFQPRPSRLSRMSKA  257
            G+F+PRPSRLS M+K+
Sbjct  170  GEFRPRPSRLSAMAKS  185



>ref|XP_007138468.1| hypothetical protein PHAVU_009G211700g [Phaseolus vulgaris]
 gb|ESW10462.1| hypothetical protein PHAVU_009G211700g [Phaseolus vulgaris]
Length=196

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSI-SYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            K+TC+CSPT+HPGSFRCSLHKN  SRP+   Y  N  N RRSAMTNSLVRI  VEGDLVK
Sbjct  100  KRTCMCSPTTHPGSFRCSLHKNFASRPTPPQYSPNGFNVRRSAMTNSLVRIRGVEGDLVK  159

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RALA+LIRPSSHQQRRRGDF+   SRLS MSKAEE
Sbjct  160  RALASLIRPSSHQQRRRGDFRQLRSRLSLMSKAEE  194



>ref|XP_002515469.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46918.1| conserved hypothetical protein [Ricinus communis]
Length=205

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 99/142 (70%), Gaps = 16/142 (11%)
 Frame = -1

Query  664  SSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            +S PT S R SI RS SP+RS++            V     N  KKTC+CSPT HPGSFR
Sbjct  74   TSIPTTSFRVSIGRSSSPNRSIT------------VTKQHQNNNKKTCMCSPTMHPGSFR  121

Query  484  CSLHKNMNSRPS----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  317
            CSLHKN N+  S     SY  NRLN RRSAM NSLVRIG VEG+ VKRAL ALIRPSSHQ
Sbjct  122  CSLHKNSNNNNSHSGLDSYTPNRLNMRRSAMKNSLVRIGGVEGEWVKRALTALIRPSSHQ  181

Query  316  QRRRGDFQPRPSRLSRMSKAEE  251
            QRRR DFQPRPSRLS M+KA++
Sbjct  182  QRRRCDFQPRPSRLSIMAKADD  203



>ref|XP_004157087.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218391 
[Cucumis sativus]
Length=214

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 15/139 (11%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            T SVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPGSFRCSL
Sbjct  84   TSSVRFXIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPGSFRCSL  133

Query  475  HKNMNSRPS----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            HKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPSSHQQRR
Sbjct  134  HKNVSSGGGHSQVVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPSSHQQRR  193

Query  307  RGDFQPRPSRLSRMSKAEE  251
            R  FQPR SRLS MSKA +
Sbjct  194  RASFQPRSSRLSVMSKAAD  212



>ref|XP_009596910.1| PREDICTED: uncharacterized protein LOC104092917 [Nicotiana tomentosiformis]
Length=178

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 8/107 (7%)
 Frame = -1

Query  547  LANLPKKTCLCSPTSHPGSFRCSLHKNMNSR------PSISYPSN--RLNARRSAMTNSL  392
            +++  K TC+CSPT+HPGSFRCS+HK M+ R       S+SY SN  RLN RRSAMTNSL
Sbjct  68   MSSQKKMTCMCSPTTHPGSFRCSMHKKMDVRRSSATTSSLSYGSNSNRLNTRRSAMTNSL  127

Query  391  VRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            VRI TVEG++VKRALAALIRPSSHQQRRR  FQ RPSRLS MS+ ++
Sbjct  128  VRIVTVEGEIVKRALAALIRPSSHQQRRRYGFQRRPSRLSNMSRTDD  174



>ref|XP_011073376.1| PREDICTED: uncharacterized protein LOC105158345 [Sesamum indicum]
Length=203

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 83/109 (76%), Gaps = 10/109 (9%)
 Frame = -1

Query  547  LANLPKKTCLCSPTSHPGSFRCSLHKN----------MNSRPSISYPSNRLNARRSAMTN  398
            L + PKKTC+CSPT+HPGSFRCSLHKN            S  S    S+ LN RRSAMTN
Sbjct  94   LNSGPKKTCMCSPTTHPGSFRCSLHKNSIVPGYGTGNHTSSSSSYRSSHHLNMRRSAMTN  153

Query  397  SLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            SLVRIGTVEGDLVKRALAALIRPSSH  RRR DFQPRPSRLS MSKAE+
Sbjct  154  SLVRIGTVEGDLVKRALAALIRPSSHSLRRRADFQPRPSRLSVMSKAED  202



>ref|XP_011039624.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Populus 
euphratica]
Length=210

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 11/137 (8%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PS RFSIDRS SP+RS+SVS       K+   +P++  PK+TC+CSPT+H GSFRCSLH
Sbjct  81   SPSFRFSIDRSTSPNRSISVS-------KKNRSHPIS-APKRTCMCSPTTHRGSFRCSLH  132

Query  472  KNMNSR--PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            K  +S   P +  P +RLN RRSAMTNSLVRIG VEG+ VKRAL ALIRPSSHQQRRRG 
Sbjct  133  KKSSSSSNPEMFTP-HRLNMRRSAMTNSLVRIGGVEGEWVKRALTALIRPSSHQQRRRGA  191

Query  298  FQPRPSRLSRMSKAEED  248
            FQPR SRLS M KA+++
Sbjct  192  FQPRQSRLSIMYKADDE  208



>ref|XP_004145523.1| PREDICTED: uncharacterized protein LOC101218391 [Cucumis sativus]
 gb|KGN55469.1| hypothetical protein Csa_4G652810 [Cucumis sativus]
Length=214

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 103/139 (74%), Gaps = 15/139 (11%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            T SVRF ID RS SP+RSV VSR+           P++N+ K+TC+CSPT+HPGSFRCSL
Sbjct  84   TSSVRFFIDNRSSSPNRSVIVSRK---------NRPVSNV-KRTCMCSPTTHPGSFRCSL  133

Query  475  HKNMNSRPS----ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            HKN++S       +S+PS RLN  RSAM NS+VRIG VEG+LVKRAL  LIRPSSHQQRR
Sbjct  134  HKNVSSGGGHSQVVSFPSTRLNMWRSAMANSIVRIGGVEGELVKRALTTLIRPSSHQQRR  193

Query  307  RGDFQPRPSRLSRMSKAEE  251
            R  FQPR SRLS MSKA +
Sbjct  194  RASFQPRSSRLSVMSKAAD  212



>ref|XP_010097160.1| hypothetical protein L484_025705 [Morus notabilis]
 gb|EXB67227.1| hypothetical protein L484_025705 [Morus notabilis]
Length=199

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISP-HrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTS  503
            ++G +SS  + SVRF++DR+ISP  RS+SV+++       G GN   +  +KTC+CSPT+
Sbjct  50   MYGGSSSPSSRSVRFAVDRTISPGRRSMSVTKQRNGGAGNGNGNGTVSKQRKTCMCSPTT  109

Query  502  HPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  338
            HPGSFRCSLHK+          S++  S RLN  RSAM NSL+RIG VEGDL+KR+L+AL
Sbjct  110  HPGSFRCSLHKSSPRGGGLQTSSLNSNSRRLNLMRSAMVNSLIRIGVVEGDLMKRSLSAL  169

Query  337  IRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            IRPSSHQQRRR  FQPRPSRLS MS+AE+
Sbjct  170  IRPSSHQQRRRAAFQPRPSRLSVMSRAED  198



>ref|XP_011017923.1| PREDICTED: uncharacterized protein LOC105121103 [Populus euphratica]
Length=212

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 10/147 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            ++G ++ +P+ SVR +   ++SP+RS+S     +    Q V  P  + PK+TC+CSPT+H
Sbjct  70   MYGHSTPSPSSSVRLN---AVSPNRSISTVNPSRSHHHQVVRKP--STPKQTCMCSPTTH  124

Query  499  PGSFRCSLHKNMN-----SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            PGSFRCS HK +      S  + S  +NRLNARRSAMTNSLVRIG VEGDLV+RALAALI
Sbjct  125  PGSFRCSRHKGIGLGSSTSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALAALI  184

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            RPSSHQQRRR  FQ RPSRLS MSKAE
Sbjct  185  RPSSHQQRRRSAFQSRPSRLSVMSKAE  211



>ref|XP_002519910.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42514.1| conserved hypothetical protein [Ricinus communis]
Length=219

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = -1

Query  526  TCLCSPTSHPGSFRCSLHKNMNSRPSIS---YPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            TC+CSPT+HPGSFRCSLHKN NS    S   Y  NRLN RRSAM NSLVRIG VEG+ VK
Sbjct  122  TCMCSPTTHPGSFRCSLHKNNNSHQGNSLHSYTPNRLNMRRSAMKNSLVRIGGVEGEWVK  181

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            RAL  LIRPSSHQQRRR DFQPRPSRLS MSKA +D
Sbjct  182  RALTTLIRPSSHQQRRRCDFQPRPSRLSIMSKAGDD  217



>ref|XP_006394776.1| hypothetical protein EUTSA_v10004807mg [Eutrema salsugineum]
 gb|ESQ32062.1| hypothetical protein EUTSA_v10004807mg [Eutrema salsugineum]
Length=253

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 19/141 (13%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTSHPGSFR  485
            T S R+SID RSISP+RS+             V  P +N +P  ++ C+CSPT+HPGSFR
Sbjct  124  TQSFRYSIDNRSISPNRSI------------AVSKPSSNKIPDSRRRCMCSPTTHPGSFR  171

Query  484  CSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            CSLHKN+   + + +++YP+N LN RRSAMTNSLVRIG VEG+ V+RAL ALIRPSSHQ 
Sbjct  172  CSLHKNVANPHGQGAVTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTALIRPSSHQL  231

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            +RR  +QPRPSRLS MSKA++
Sbjct  232  KRRSAYQPRPSRLSSMSKADD  252



>ref|XP_009616804.1| PREDICTED: uncharacterized protein LOC104109268 [Nicotiana tomentosiformis]
Length=201

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 99/144 (69%), Gaps = 17/144 (12%)
 Frame = -1

Query  664  SSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            S++P+PSVRFS    RSIS +              Q    P A+  KK C+CSPT+HPGS
Sbjct  66   SASPSPSVRFSTSPGRSISAYPRQ----------PQQNRRPFASNQKKHCMCSPTTHPGS  115

Query  490  FRCSLHKNMNSR-----PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            FRCSLHKN N        S  + S++LN RRSAM NSLVRIGTVEGDL+KRALAALIRPS
Sbjct  116  FRCSLHKNTNQNRGQSHTSSYHSSHQLNMRRSAMKNSLVRIGTVEGDLLKRALAALIRPS  175

Query  325  SHQQRRRGDFQPRPSRLSRMSKAE  254
            SH  RRR +FQPRPSRLS MSKA+
Sbjct  176  SHHLRRRDNFQPRPSRLSIMSKAQ  199



>ref|XP_006852817.1| hypothetical protein AMTR_s00033p00173430 [Amborella trichopoda]
 gb|ERN14284.1| hypothetical protein AMTR_s00033p00173430 [Amborella trichopoda]
Length=139

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 11/140 (8%)
 Frame = -1

Query  649  PSVRFSIDRSISPHrsvsvsrrdq-----vvRKQGVGNPLANL-PKKTCLCSPTSHPGSF  488
            P+VRFS+DRS SP RS++             ++  +GN    L P++TCLC+PT+HPGSF
Sbjct  3    PTVRFSLDRSRSPSRSIAGVMVSTRDRVLKKQQSPIGNRTPPLQPRRTCLCAPTNHPGSF  62

Query  487  RCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            RCSLHK           + RL+ARRS+M NSLVRIG+VEG+ V+RAL ALIRPSSH Q+R
Sbjct  63   RCSLHKG-----GFGASNARLDARRSSMVNSLVRIGSVEGEWVRRALTALIRPSSHSQKR  117

Query  307  RGDFQPRPSRLSRMSKAEED  248
            R  FQPRPSRLS MSKA++D
Sbjct  118  RMSFQPRPSRLSVMSKADDD  137



>emb|CDX87091.1| BnaC09g04060D [Brassica napus]
Length=196

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 14/139 (10%)
 Frame = -1

Query  646  SVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            S R+SID  RSISP+             K   GN + +  ++ C+CSPT+HPGSFRCSLH
Sbjct  64   SFRYSIDNTRSISPNHRSIAVS------KPSGGNKIPD-SRRRCMCSPTTHPGSFRCSLH  116

Query  472  KNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            KN+         + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL ALIRPSSHQ +R
Sbjct  117  KNVANPHGQGAAAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTALIRPSSHQLKR  176

Query  307  RGDFQPRPSRLSRMSKAEE  251
            R  +QPRPSRLS MSKAE+
Sbjct  177  RSAYQPRPSRLSSMSKAED  195



>ref|XP_010665660.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Beta 
vulgaris subsp. vulgaris]
Length=217

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 103/146 (71%), Gaps = 15/146 (10%)
 Frame = -1

Query  667  ASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSF  488
            +S+T  PS R S++RS SP+  VS+         Q V  P   + K+TC+CSPT+HPGSF
Sbjct  79   SSTTTVPSFRISLNRSHSPNSRVSIR-------DQVVSKPA--ITKRTCMCSPTNHPGSF  129

Query  487  RCSLHKNMNSRP------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            RC++H+N +         S+S   +RLN RRSAMTNSLVRIGTVEGD VKRAL ALIRPS
Sbjct  130  RCAIHRNNSRNGGNSNSHSVSCSPSRLNLRRSAMTNSLVRIGTVEGDWVKRALTALIRPS  189

Query  325  SHQQRRRGDFQPRPSRLSRMSKAEED  248
            SHQQ+RR DFQ RPSRLS MSKA +D
Sbjct  190  SHQQKRRFDFQFRPSRLSIMSKANDD  215



>ref|XP_004488522.1| PREDICTED: uncharacterized protein LOC101494844 [Cicer arietinum]
Length=187

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (69%), Gaps = 10/137 (7%)
 Frame = -1

Query  676  HGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP---KKTCLCSPT  506
            H    S    SV FS DR +SP+ S+SV+         G G  +  L    K TC+CSP+
Sbjct  52   HRSTFSVRASSVLFSFDRCVSPNSSISVTV-------SGTGETVKRLKHRQKPTCMCSPS  104

Query  505  SHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            +HPGSFRCS HK++ S  +++Y  NRLN RRSAMTNSLVRI  VEG+LV+RALA+LIRPS
Sbjct  105  THPGSFRCSFHKSLGSGSAVTYAPNRLNVRRSAMTNSLVRIRGVEGELVRRALASLIRPS  164

Query  325  SHQQRRRGDFQPRPSRL  275
            SH QRRR DF+PRPSR 
Sbjct  165  SHNQRRRYDFRPRPSRF  181



>ref|XP_009125255.1| PREDICTED: putative protein TPRXL [Brassica rapa]
 ref|XP_009125256.1| PREDICTED: putative protein TPRXL [Brassica rapa]
 ref|XP_009125257.1| PREDICTED: putative protein TPRXL [Brassica rapa]
Length=190

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 11/148 (7%)
 Frame = -1

Query  676  HGXASSTPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  509
            H  AS TP P   S R+S+D RSISP    S+S   +   K    +P     ++ C+CSP
Sbjct  46   HRSASPTPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETSP----SRRRCMCSP  101

Query  508  TSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  338
            T+HPGSFRCSLHKN+   + + + SY  N LN RRSAMTNSLVRIG VEG+ V+RAL  L
Sbjct  102  TTHPGSFRCSLHKNVANPHGQGTASYTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTL  161

Query  337  IRPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            IRPSSH  +RR  FQPRPSRLS MSKAE
Sbjct  162  IRPSSHHLKRRAAFQPRPSRLSVMSKAE  189



>ref|XP_008445241.1| PREDICTED: uncharacterized protein LOC103488327 [Cucumis melo]
Length=199

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 96/145 (66%), Gaps = 22/145 (15%)
 Frame = -1

Query  664  SSTP-TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            SSTP + SVRFSI  RS SP              K    N   +LPKK C+CSPT+HPGS
Sbjct  69   SSTPLSRSVRFSIGHRSGSP--------------KLSNRNSPVSLPKKPCMCSPTTHPGS  114

Query  490  FRCSLHKNMNS------RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            FRCSLHK   S        S +Y S  LN RRSAMTNSLVRIG VEGD VKRAL ALIRP
Sbjct  115  FRCSLHKKSGSGIHQHQASSSAYSSTGLNMRRSAMTNSLVRIGGVEGDWVKRALTALIRP  174

Query  328  SSHQQRRRGDFQPRPSRLSRMSKAE  254
            SSHQ RRR +F+P+PSRLS MSKAE
Sbjct  175  SSHQLRRRANFRPQPSRLSVMSKAE  199



>gb|KFK27780.1| hypothetical protein AALP_AA8G427900 [Arabis alpina]
Length=218

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 19/142 (13%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTSHPGSFR  485
            T S R+SID RSISP+RS+             V  P ++ +P  ++ C+CSPT+HPGSFR
Sbjct  83   TQSFRYSIDNRSISPNRSI------------AVSKPTSHKIPDSRRRCMCSPTTHPGSFR  130

Query  484  CSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            CSLHKN+   + + +++YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ 
Sbjct  131  CSLHKNVANPHGQGAVTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQL  190

Query  313  RRRGDFQPRPSRLSRMSKAEED  248
            +RR  +QPR SRLS MSKAEE+
Sbjct  191  KRRSAYQPRRSRLSSMSKAEEE  212



>ref|XP_008775758.1| PREDICTED: uncharacterized protein LOC103696036 [Phoenix dactylifera]
Length=190

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = -1

Query  658  TPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLP-KKTCLCSPTSHPGSFRC  482
            +P PSVRFS DR    HR  S  R       +      +++P ++TC+CSPT+HPGSFRC
Sbjct  53   SPVPSVRFSFDR----HRPTSPGRSLAFADHRSPRPITSSVPQRRTCMCSPTTHPGSFRC  108

Query  481  SLHKNMNS----RPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            SLHK +        ++S  SNRLNARRSAM NSLVRIGTVEG+ VKRAL ALIRPSSHQQ
Sbjct  109  SLHKGLGQLQHSHSAVSSSSNRLNARRSAMANSLVRIGTVEGEWVKRALTALIRPSSHQQ  168

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            RRR  FQPR SRLS MSKA++
Sbjct  169  RRRAAFQPRSSRLSVMSKADD  189



>ref|XP_004241685.1| PREDICTED: uncharacterized protein LOC101259944 [Solanum lycopersicum]
Length=197

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 100/144 (69%), Gaps = 16/144 (11%)
 Frame = -1

Query  664  SSTPTPSVRFSI--DRSISPHrsvsvsrrdqvvRKQGVGNPL--ANLPKKTCLCSPTSHP  497
            S +P+PSVRFS   +RSIS              + Q   +PL  ++  KK C CSPT+HP
Sbjct  56   SVSPSPSVRFSSSNNRSIS----------VFPRKPQQNRHPLPSSSNQKKHCTCSPTTHP  105

Query  496  GSFRCSLH-KNMNSRPSISYPSNR-LNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            GSFRCSLH K  N     SY S+  LN RRSAMTNSLVRIG VEG+LVKRALAALIRPSS
Sbjct  106  GSFRCSLHRKTTNRSDGQSYHSSHPLNMRRSAMTNSLVRIGAVEGELVKRALAALIRPSS  165

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQ RRR DFQP+PSRLS MSKAE+
Sbjct  166  HQLRRRCDFQPKPSRLSVMSKAED  189



>ref|XP_008228742.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Prunus 
mume]
Length=212

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 79/103 (77%), Gaps = 11/103 (11%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM-----------NSRPSISYPSNRLNARRSAMTNSLVR  386
            KKTCLCSPT+HPGSFRC+LHKN            N R S  + S RLN RRSAM NSLVR
Sbjct  102  KKTCLCSPTTHPGSFRCALHKNSPSGGAAHHLNSNGRTSSYHSSIRLNYRRSAMKNSLVR  161

Query  385  IGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            IG VEGDLVKRAL+ALIRPSSH Q+R+ DFQP+PSRLS MSKA
Sbjct  162  IGGVEGDLVKRALSALIRPSSHSQKRKVDFQPKPSRLSVMSKA  204



>ref|XP_009401387.1| PREDICTED: uncharacterized protein LOC103985422 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 96/142 (68%), Gaps = 24/142 (17%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            P P +RFS+DRSIS               K+    P     ++TCLCSP++HPGSFRCSL
Sbjct  53   PAPPLRFSLDRSIS----------YGCSLKRSPAAPA----RRTCLCSPSTHPGSFRCSL  98

Query  475  HKNMNSR-PS------ISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  317
            HK ++   PS       + PSNRLNARRSAM NSLVRIG VEG+ VKRAL   IRPSSHQ
Sbjct  99   HKGLDHHNPSHVVAAAAASPSNRLNARRSAMANSLVRIGAVEGEWVKRAL---IRPSSHQ  155

Query  316  QRRRGDFQPRPSRLSRMSKAEE  251
            QRRR +FQPRP+RLSRMSKA +
Sbjct  156  QRRRTNFQPRPTRLSRMSKAVQ  177



>ref|XP_002324583.1| hypothetical protein POPTR_0018s12410g [Populus trichocarpa]
 gb|EEF03148.1| hypothetical protein POPTR_0018s12410g [Populus trichocarpa]
Length=212

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 104/147 (71%), Gaps = 10/147 (7%)
 Frame = -1

Query  679  LHGXASSTPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSH  500
            ++G ++ +P+ SVR +   ++SP+RS+S     +    Q V     + PK+TC+CSP++H
Sbjct  70   MYGHSTPSPSSSVRLN---AVSPNRSISTVNPSRSHNHQVVRK--QSTPKRTCMCSPSTH  124

Query  499  PGSFRCSLHKNMNSRPSISYPSN-----RLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            PGSFRCSLHK      S S  +      RLNARRSAMTNSLVRIG VEGDLV+RALA+LI
Sbjct  125  PGSFRCSLHKGTGFGSSTSSSNYSSNNNRLNARRSAMTNSLVRIGGVEGDLVRRALASLI  184

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            RPSSHQQRRR  FQ RPSRLS MSKAE
Sbjct  185  RPSSHQQRRRTAFQSRPSRLSVMSKAE  211



>ref|XP_006399610.1| hypothetical protein EUTSA_v10014629mg [Eutrema salsugineum]
 gb|ESQ41063.1| hypothetical protein EUTSA_v10014629mg [Eutrema salsugineum]
Length=219

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 9/137 (7%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S R+S+D RSISP      +R   V +KQ   +   +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  88   SFRYSLDSRSISP-----TNRSISVSKKQQPSSHKISETRRRCMCSPTTHPGSFRCSLHK  142

Query  469  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N+   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  143  NVANPHGQGAASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  202

Query  298  FQPRPSRLSRMSKAEED  248
            +QPRPSRLS MSKA+++
Sbjct  203  YQPRPSRLSIMSKADDN  219



>ref|XP_010421380.1| PREDICTED: hypha-specific G1 cyclin-related protein 1-like [Camelina 
sativa]
Length=224

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 11/142 (8%)
 Frame = -1

Query  652  TPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFR  485
            T S R+SID  RSISP+RS++VS                 +P  ++ C+CSPT+HPGSFR
Sbjct  86   TQSFRYSIDNSRSISPNRSIAVSSNQPSNHHHHH----HKIPDSRRRCMCSPTTHPGSFR  141

Query  484  CSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            CSLHKN+   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ 
Sbjct  142  CSLHKNVANPHGQGATSYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQL  201

Query  313  RRRGDFQPRPSRLSRMSKAEED  248
            +RR  ++PR SRL+ MSKAEED
Sbjct  202  KRRAAYEPRRSRLASMSKAEED  223



>ref|XP_007014526.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY32145.1| Serine-rich protein-related [Theobroma cacao]
Length=208

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 104/132 (79%), Gaps = 12/132 (9%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN-  467
             RFSI+RSISP+RS+SVS+           NPL+  PK+TC+CSPT+HPGSFRCSLHKN 
Sbjct  86   FRFSINRSISPNRSISVSKG---------SNPLSIPPKRTCMCSPTTHPGSFRCSLHKNS  136

Query  466  --MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQ  293
               ++  + SYPSNRLN RRSAMTNSLVRIG VEGD VKRAL ALIRPSSHQQRRR  F+
Sbjct  137  QNADANYTASYPSNRLNIRRSAMTNSLVRIGGVEGDWVKRALTALIRPSSHQQRRRAAFR  196

Query  292  PRPSRLSRMSKA  257
            PRPSRLS +S++
Sbjct  197  PRPSRLSVLSES  208



>ref|XP_008364364.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Malus 
domestica]
Length=190

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKN--MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            K+TCLCSPT+HPGSFRC+LHKN     + S  + S  LN RRSAM NSLVRIG VEGDLV
Sbjct  92   KRTCLCSPTTHPGSFRCALHKNSPRAGQSSSYHSSISLNYRRSAMKNSLVRIGGVEGDLV  151

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            KRAL+ALIRPSSH QRRR DFQP+PSRLS MSKA +D
Sbjct  152  KRALSALIRPSSHSQRRRVDFQPKPSRLSAMSKASDD  188



>ref|XP_008454197.1| PREDICTED: putative protein TPRXL [Cucumis melo]
Length=199

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S+RF ID RS SP              +    N + +  +K C+CSPT HPGSFRCSLHK
Sbjct  64   SLRFQIDQRSASP-----SRSISVQKNRDSNANAVPSNKRKVCVCSPTKHPGSFRCSLHK  118

Query  469  NMNSRPSISYPSN----RLNARRSAMTNSLVRIGTVEG-DLVKRALAALIRPSSHQQRRR  305
            N      +S  S      LN RRSAMTNSLVRIG VEG DLVKRAL+ALIRPSSHQQRR 
Sbjct  119  NSTHSVDVSNGSQLRNGSLNVRRSAMTNSLVRIGCVEGADLVKRALSALIRPSSHQQRRP  178

Query  304  GDFQPRPSRLSRMSKAEED  248
              FQ RPSRLS MSKAEE+
Sbjct  179  SAFQRRPSRLSLMSKAEEE  197



>emb|CDX70380.1| BnaC03g04640D [Brassica napus]
Length=221

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            + FS+D RSISP  +       +  +   + +P      + C+CSPT+HPGSFRCSLHKN
Sbjct  90   IAFSLDTRSISPTTTNRSISVTKKPQPSKISSP------RRCMCSPTTHPGSFRCSLHKN  143

Query  466  M---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            +   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  RRR  +
Sbjct  144  VANPHGQGTASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLRRRAAY  203

Query  295  QPRPSRLSRMSKAEED  248
            QPRPSRLS MSKA  +
Sbjct  204  QPRPSRLSTMSKAATE  219



>gb|EYU21687.1| hypothetical protein MIMGU_mgv1a024748mg [Erythranthe guttata]
Length=97

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 6/95 (6%)
 Frame = -1

Query  520  LCSPTSHPGSFRCSLHKN------MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            +CSPT+HPGSFRCSLHK+       ++ PS    S++LN RRSAMTNSLVRIGTVEGDLV
Sbjct  1    MCSPTTHPGSFRCSLHKSSAAAAGYSNHPSSYRSSHQLNMRRSAMTNSLVRIGTVEGDLV  60

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            +RALAALIRPSSH  RRR DFQPRPSRLS MSKA+
Sbjct  61   RRALAALIRPSSHNLRRRFDFQPRPSRLSVMSKAD  95



>ref|XP_010493781.1| PREDICTED: squamosa promoter-binding-like protein 18 [Camelina 
sativa]
Length=219

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 103/144 (72%), Gaps = 8/144 (6%)
 Frame = -1

Query  667  ASSTPTPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPG  494
            AS+  T S R+SID  RSISP+RS++VS             P +   ++ C+CSPT+HPG
Sbjct  77   ASAPMTQSFRYSIDNSRSISPNRSIAVSSNKPTNHHHHHKIPDS---RRRCMCSPTTHPG  133

Query  493  SFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            SFRCSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSS
Sbjct  134  SFRCSLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSS  193

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQ +RR  ++PR SRL+ MSKAEE
Sbjct  194  HQLKRRAAYEPRRSRLASMSKAEE  217



>ref|XP_009131193.1| PREDICTED: cell wall integrity and stress response component 
1-like [Brassica rapa]
 emb|CDX78410.1| BnaA03g03220D [Brassica napus]
Length=222

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = -1

Query  643  VRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            + FS+D RSISP  +       +  +   + +P      + C+CSPT+HPGSFRCSLHKN
Sbjct  91   IAFSLDTRSISPTTTNRSISVAKKPQPSKISSP------RRCMCSPTTHPGSFRCSLHKN  144

Query  466  M---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDF  296
            +   + + + SYP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  RRR  +
Sbjct  145  VANPHGQGTASYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLRRRAAY  204

Query  295  QPRPSRLSRMSKAEED  248
            QPRPSRLS MSKA  +
Sbjct  205  QPRPSRLSIMSKAATE  220



>ref|XP_006288644.1| hypothetical protein CARUB_v10001949mg [Capsella rubella]
 gb|EOA21542.1| hypothetical protein CARUB_v10001949mg [Capsella rubella]
Length=214

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 15/140 (11%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRC  482
            T S R+SID RSISP+RS++VS   Q   K         +P  ++ C+CSPT+HPGSFRC
Sbjct  83   TQSFRYSIDNRSISPNRSIAVSSNKQSNHK---------IPDSRRRCMCSPTTHPGSFRC  133

Query  481  SLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            SLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  134  SLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  193

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  ++PR SRL+ MSKAE+
Sbjct  194  RRAAYEPRRSRLASMSKAED  213



>ref|XP_007023329.1| Serine-rich protein-related, putative [Theobroma cacao]
 gb|EOY25951.1| Serine-rich protein-related, putative [Theobroma cacao]
Length=216

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 93/144 (65%), Gaps = 18/144 (13%)
 Frame = -1

Query  643  VRFSI-DRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKN  467
            VRFSI DR ISP                 V     +   +TCLCSPT+HPGSFRCSLHK 
Sbjct  77   VRFSINDRPISP-----GRSISFNKNNNAVSTGAHHQRSRTCLCSPTTHPGSFRCSLHKG  131

Query  466  M----------NSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
            +          N +P+ S  + S+ L+ RRSAM NSLVRIG VEG+LVKRAL ALIRPSS
Sbjct  132  LSMSRDHHHQNNRQPTTSSFHSSSALHFRRSAMKNSLVRIGGVEGELVKRALTALIRPSS  191

Query  322  HQQRRRGDFQPRPSRLSRMSKAEE  251
            HQQRRR  F+PRPSRLS MSKA++
Sbjct  192  HQQRRRAAFEPRPSRLSVMSKADD  215



>ref|XP_009151048.1| PREDICTED: uncharacterized protein LOC103874389 [Brassica rapa]
 ref|XP_009151049.1| PREDICTED: uncharacterized protein LOC103874389 [Brassica rapa]
Length=207

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 20/146 (14%)
 Frame = -1

Query  664  SSTP-TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLAN-LP--KKTCLCSPTSH  500
            +STP   S R+SID RS+SP++SV             V  P  N +P  ++ C+CSPT+H
Sbjct  73   TSTPLNQSFRYSIDNRSVSPNQSV------------AVSKPSGNKIPDSRRRCMCSPTTH  120

Query  499  PGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            PGSFRCSLHKN+   + + + +Y +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRP
Sbjct  121  PGSFRCSLHKNVANPHGQGAATYSTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRP  180

Query  328  SSHQQRRRGDFQPRPSRLSRMSKAEE  251
            SSHQ +RR  +QPRPSRLS MSKA++
Sbjct  181  SSHQLKRRSAYQPRPSRLSSMSKADD  206



>ref|XP_009111663.1| PREDICTED: uncharacterized protein LOC103837086 [Brassica rapa]
Length=191

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVE  371
            ++ C+CSPT+HPGSFRCSLHKN+       +  + +YP+N LN RRSAMTNSLVRIG VE
Sbjct  91   RRRCMCSPTTHPGSFRCSLHKNVANPHGQGAATAAAYPTNSLNMRRSAMTNSLVRIGGVE  150

Query  370  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            G+ V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  151  GEWVRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  190



>ref|XP_010040344.1| PREDICTED: uncharacterized protein LOC104429140 [Eucalyptus grandis]
Length=197

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 91/140 (65%), Gaps = 19/140 (14%)
 Frame = -1

Query  661  STPTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRC  482
            + P+PS+RF++DR  SP        + Q   + G G                 +PGSFRC
Sbjct  73   AQPSPSIRFALDRPTSP-SRSISVSQQQRRGRTGGGQ---------------LYPGSFRC  116

Query  481  SLHKNMNSRPSIS--YPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRR  308
            SLHK   S PS S  Y  NRLNARRSAMTNSLVRIG VEGDLVKRALAALIRPSSHQQRR
Sbjct  117  SLHKGCGS-PSASAGYAPNRLNARRSAMTNSLVRIGGVEGDLVKRALAALIRPSSHQQRR  175

Query  307  RGDFQPRPSRLSRMSKAEED  248
            R  FQPR SRLS MSKA E+
Sbjct  176  RAAFQPRQSRLSIMSKAAEE  195



>gb|ABL97972.1| serine-rich protein [Brassica rapa]
 emb|CDY19808.1| BnaA09g04610D [Brassica napus]
Length=193

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 95/140 (68%), Gaps = 22/140 (16%)
 Frame = -1

Query  646  SVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            S R+SID  RSI+             V K   GN + +  ++ C+CSPT+HPGSFRCSLH
Sbjct  67   SFRYSIDNTRSIA-------------VSKPSGGNKIPD-SRRRCMCSPTTHPGSFRCSLH  112

Query  472  KNM------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            KN+       +  + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  113  KNVANPHGQGAATAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  172

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  +QPRPSRLS MSKA++
Sbjct  173  RRSAYQPRPSRLSSMSKADD  192



>gb|EPS66146.1| hypothetical protein M569_08632, partial [Genlisea aurea]
Length=182

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 94/143 (66%), Gaps = 24/143 (17%)
 Frame = -1

Query  658  TPTPSVRFSIDR--SISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFR  485
            +P+PSVRFS  R  +I+ H                   PL +  KKTCLCSPT+HPGSFR
Sbjct  55   SPSPSVRFSASRRQTIASHHQH---------------RPLNSGGKKTCLCSPTNHPGSFR  99

Query  484  CSLHK-------NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPS  326
            CSLHK       N  ++ +     ++L+ +RSAMTNSLVRIGTVEGDLVKRALA+LIRPS
Sbjct  100  CSLHKKNLMPGYNHGNQTTPYRSGHQLHLQRSAMTNSLVRIGTVEGDLVKRALASLIRPS  159

Query  325  SHQQRRRGDFQPRPSRLSRMSKA  257
             H  RRR DF PRPSRLS MSKA
Sbjct  160  LHSLRRRSDFVPRPSRLSLMSKA  182



>ref|XP_010454851.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=219

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 100/141 (71%), Gaps = 13/141 (9%)
 Frame = -1

Query  652  TPSVRFSID--RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFR  485
            T S R+SID  RSISP+RS++VS                 +P  ++ C+CSPT+HPGSFR
Sbjct  83   TQSFRYSIDNSRSISPNRSIAVSSNKPSNHHHH------KIPDSRRRCMCSPTTHPGSFR  136

Query  484  CSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQ  314
            CSLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ 
Sbjct  137  CSLHKNVANPHGQGAAAYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQL  196

Query  313  RRRGDFQPRPSRLSRMSKAEE  251
            +RR  ++PR SRL+ MSKAEE
Sbjct  197  KRRAAYEPRRSRLASMSKAEE  217



>emb|CDX97080.1| BnaC09g45450D [Brassica napus]
Length=198

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            C+CSPT+HPGSFRCSLHKN+         S SYP+N LN RRSAMTNSLVRIG VEG+ V
Sbjct  101  CMCSPTTHPGSFRCSLHKNVANPHGQGAASSSYPTNSLNMRRSAMTNSLVRIGGVEGEWV  160

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            +RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  161  RRALTTLIRPSSHHLRRRAAYQPRPSRLSIMSKATE  196



>ref|XP_006288623.1| hypothetical protein CARUB_v10001925mg [Capsella rubella]
 gb|EOA21521.1| hypothetical protein CARUB_v10001925mg [Capsella rubella]
Length=219

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 95/137 (69%), Gaps = 12/137 (9%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S R+S+D RSISP        ++Q         P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  89   SFRYSLDSRSISPTNRSISVTKNQP--------PKISETRRRCMCSPTTHPGSFRCSLHK  140

Query  469  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  141  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  200

Query  298  FQPRPSRLSRMSKAEED  248
            +QPRPSRLS M+KA+E+
Sbjct  201  YQPRPSRLSIMAKADEN  217



>ref|XP_009121994.1| PREDICTED: putative protein TPRXL [Brassica rapa]
Length=224

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            C+CSPT+HPGSFRCSLHKN+         S SYP+N LN RRSAMTNSLVRIG VEG+ V
Sbjct  127  CMCSPTTHPGSFRCSLHKNVANPHGQGASSSSYPTNSLNMRRSAMTNSLVRIGGVEGEWV  186

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            +RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  187  RRALTTLIRPSSHHLRRRAAYQPRPSRLSNMSKATE  222



>ref|XP_009338490.1| PREDICTED: putative protein TPRXL [Pyrus x bretschneideri]
Length=248

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 79/106 (75%), Gaps = 11/106 (10%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKN-----------MNSRPSISYPSNRLNARRSAMTNSLVR  386
            K+TCLCSPT+HPGSFRC+LHKN              + S  + S  LN RRSAM NSLVR
Sbjct  141  KRTCLCSPTTHPGSFRCALHKNSPPGGAAHQSHCGGQSSSYHSSISLNYRRSAMKNSLVR  200

Query  385  IGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            IG VEGDLVKRAL+ALIRPSSH QRRR DFQP+PSRLS MSKA +D
Sbjct  201  IGGVEGDLVKRALSALIRPSSHSQRRRVDFQPKPSRLSVMSKASDD  246



>ref|XP_010419664.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=214

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S R+S+D RSISP    S+S       K      ++   ++ C+CSPT+HPGSFRCSLHK
Sbjct  86   SFRYSLDSRSISPTNHRSISVSKNQAPK------MSESSRRRCMCSPTTHPGSFRCSLHK  139

Query  469  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  140  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  199

Query  298  FQPRPSRLSRMSKAE  254
            +QPRPSRLS M+KA+
Sbjct  200  YQPRPSRLSTMAKAD  214



>emb|CDX69786.1| BnaA10g21350D [Brassica napus]
Length=194

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 74/96 (77%), Gaps = 5/96 (5%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNM-----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            C+CSPT+HPGSFRCSLHKN+         S +YP+N LN RRSAMTNSLVRIG VEG+ V
Sbjct  97   CMCSPTTHPGSFRCSLHKNVANPHGQGASSSAYPTNSLNMRRSAMTNSLVRIGGVEGEWV  156

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            +RAL  LIRPSSH  RRR  +QPRPSRLS MSKA E
Sbjct  157  RRALTTLIRPSSHHLRRRAAYQPRPSRLSIMSKATE  192



>gb|AFB32810.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
 gb|AFB32811.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
Length=143

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGGVEGEWVR  108

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RAL ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  109  RALTALIRPSSHHTRRRTSFQPRPSRLCHMTTAQD  143



>emb|CDX85730.1| BnaA02g00830D [Brassica napus]
Length=233

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = -1

Query  676  HGXASSTPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSP  509
            H  AS TP P   S R+S+D RSISP    S+S   +   K    +P     ++ C+CSP
Sbjct  46   HRSASPTPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETSP----SRRRCMCSP  101

Query  508  TSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAAL  338
            T+HPGSFRCSLHKN+   + + + SY  N LN RRSAMTNSLVRIG VEG+ V+RAL  L
Sbjct  102  TTHPGSFRCSLHKNVANPHGQGTASYTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTL  161

Query  337  IRPSSHQQRRRGDFQPRPSRLSRMS  263
            IRPSSH  +RR  FQPRPSRLS M+
Sbjct  162  IRPSSHHLKRRAAFQPRPSRLSVMT  186



>ref|XP_002872151.1| hypothetical protein ARALYDRAFT_489379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48410.1| hypothetical protein ARALYDRAFT_489379 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 14/140 (10%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRC  482
            T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+HPGSFRC
Sbjct  87   TQSFRYSIDNRSISPNRSIAVSSNKPSNHHK--------IPDSRRRCMCSPTTHPGSFRC  138

Query  481  SLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            SLHKN+   + + + +YP+N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  139  SLHKNVANPHGQGTGTYPTNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  198

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  ++PR SRL+ MSKAE+
Sbjct  199  RRSAYEPRRSRLASMSKAED  218



>emb|CDX88167.1| BnaA06g27580D [Brassica napus]
Length=184

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  362
            ++ C+CSPT+HPGSFRCSLHKN+   + + + +Y +N LN RRSAMTNSLVRIG VEG+ 
Sbjct  87   RRRCMCSPTTHPGSFRCSLHKNVANPHGQGAATYSTNGLNMRRSAMTNSLVRIGGVEGEW  146

Query  361  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  147  VRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  183



>gb|AFG60223.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60225.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60226.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60227.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60228.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60229.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60230.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60231.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60232.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60235.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60237.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
Length=143

 Score =   127 bits (318),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG+VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGSVEGEWVR  108

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            R L ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  109  RTLTALIRPSSHNTRRRTSFQPRPSRLCHMTTAQD  143



>ref|NP_196670.1| serine-rich protein-like protein [Arabidopsis thaliana]
 emb|CAC03457.1| putative protein [Arabidopsis thaliana]
 gb|AAM64778.1| serine-rich protein [Arabidopsis thaliana]
 gb|AAO44074.1| At5g11090 [Arabidopsis thaliana]
 dbj|BAE99719.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91634.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=217

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            C+CSPT+HPGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+R
Sbjct  123  CMCSPTTHPGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRR  182

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            AL  LIRPSSH  +RR  +QPRPSRLS M+KA+E+
Sbjct  183  ALTTLIRPSSHHLKRRAAYQPRPSRLSIMAKADEN  217



>ref|XP_004152334.1| PREDICTED: uncharacterized protein LOC101207294 [Cucumis sativus]
 ref|XP_004165079.1| PREDICTED: uncharacterized protein LOC101224572 [Cucumis sativus]
 gb|KGN52922.1| hypothetical protein Csa_4G006290 [Cucumis sativus]
Length=189

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S+RF  D RS SP R     ++++      V    +N  K  C+CSPT HPGSFRCSLHK
Sbjct  52   SLRFQTDQRSASPSRRSVSVQKNRDSNANAVP---SNKKKVMCMCSPTKHPGSFRCSLHK  108

Query  469  NMNSRPSISYPSN----RLNARRSAMTNSLVRIGTVEG-DLVKRALAALIRPSSHQQRRR  305
            N      IS  S      LN RRSAMTNSLVRI  VEG DLVKRAL+ALIRPSSHQQRR+
Sbjct  109  NSTHSIDISNGSQFRNVSLNIRRSAMTNSLVRIECVEGADLVKRALSALIRPSSHQQRRQ  168

Query  304  GDFQPRPSRLSRMSKAEED  248
              FQ RPS LS MSKAEE+
Sbjct  169  SAFQRRPSHLSVMSKAEEE  187



>gb|AFB32809.1| hypothetical protein 0_3046_01, partial [Pinus mugo]
Length=138

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG VEG+ V+
Sbjct  45   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGGVEGEWVR  103

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            R L ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  104  RVLTALIRPSSHHTRRRTSFQPRPSRLCHMTTAQD  138



>ref|NP_197910.1| serine-rich protein-like protein [Arabidopsis thaliana]
 ref|NP_851072.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AAK83595.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AAK97665.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AAL31101.1| AT5g25280/F18G18_20 [Arabidopsis thaliana]
 gb|AED93421.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AED93422.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=220

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 100/140 (71%), Gaps = 14/140 (10%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRC  482
            T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+HPGSFRC
Sbjct  88   TQSFRYSIDNRSISPNRSIAVSSNKPSNHHK--------IPDSRRRCMCSPTTHPGSFRC  139

Query  481  SLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            SLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  140  SLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  199

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  ++PR SRL+ MSKAE+
Sbjct  200  RRSAYEPRRSRLASMSKAED  219



>gb|AAM67211.1| serine-rich protein [Arabidopsis thaliana]
Length=220

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 100/140 (71%), Gaps = 14/140 (10%)
 Frame = -1

Query  652  TPSVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLP--KKTCLCSPTSHPGSFRC  482
            T S R+SID RSISP+RS++VS        +        +P  ++ C+CSPT+HPGSFRC
Sbjct  88   TQSFRYSIDNRSISPNRSIAVSSNIPSNHHK--------IPDSRRRCMCSPTTHPGSFRC  139

Query  481  SLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
            SLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSHQ +
Sbjct  140  SLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHQLK  199

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  ++PR SRL+ MSKAE+
Sbjct  200  RRSAYEPRRSRLASMSKAED  219



>ref|XP_010491804.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=216

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 11/135 (8%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S R+S+D RSISP    S+S             P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  89   SFRYSLDSRSISPTNHRSISVSKNQP-------PKISESRRRCMCSPTTHPGSFRCSLHK  141

Query  469  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  142  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  201

Query  298  FQPRPSRLSRMSKAE  254
            +QPRPSRLS M+KA+
Sbjct  202  YQPRPSRLSSMAKAD  216



>gb|AFG60224.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60233.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60234.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
 gb|AFG60236.1| hypothetical protein 0_3046_01, partial [Pinus taeda]
Length=143

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRIG+VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIGSVEGEWVR  108

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            R L ALIRPSSH  RRR  FQP+PSRL  M+ A++
Sbjct  109  RTLTALIRPSSHNTRRRTSFQPQPSRLCHMTTAQD  143



>ref|XP_010456484.1| PREDICTED: putative protein TPRXL [Camelina sativa]
Length=229

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 11/135 (8%)
 Frame = -1

Query  646  SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHK  470
            S R+S+D RSISP    S+S             P  +  ++ C+CSPT+HPGSFRCSLHK
Sbjct  102  SFRYSLDSRSISPTNHRSISVSKNQP-------PKMSESRRRCMCSPTTHPGSFRCSLHK  154

Query  469  NM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGD  299
            N+   + + + SY +N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH  +RR  
Sbjct  155  NVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSHHLKRRAA  214

Query  298  FQPRPSRLSRMSKAE  254
            +QPRPSRLS M+KA+
Sbjct  215  YQPRPSRLSAMAKAD  229



>emb|CDX80497.1| BnaC07g29470D [Brassica napus]
Length=206

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM----NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD  365
            ++ C+CSPT+HPGSFRCSLHKN+        + +Y +N LN RRSAMTNSLVRIG VEG+
Sbjct  108  RRRCMCSPTTHPGSFRCSLHKNVANPHGQGSAATYSTNGLNMRRSAMTNSLVRIGGVEGE  167

Query  364  LVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
             V+RAL  LIRPSSHQ +RR  +QPRPSRLS MSKA++
Sbjct  168  WVRRALTTLIRPSSHQLKRRSAYQPRPSRLSSMSKADD  205



>ref|XP_002871454.1| hypothetical protein ARALYDRAFT_487941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47713.1| hypothetical protein ARALYDRAFT_487941 [Arabidopsis lyrata subsp. 
lyrata]
Length=223

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  362
            ++ C+CSPT+HPGSFRCSLHKN+   + + + SY +N LN RRSAMTNSLVRIG VEG+ 
Sbjct  125  RRRCMCSPTTHPGSFRCSLHKNVANPHGQGTASYTTNGLNMRRSAMTNSLVRIGGVEGEW  184

Query  361  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            V+RAL  LIRPSSH  +RR  +QPRPSRLS M+K++++
Sbjct  185  VRRALTTLIRPSSHHLKRRAAYQPRPSRLSIMAKSDDE  222



>emb|CDY51107.1| BnaCnng20100D [Brassica napus]
Length=228

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 93/139 (67%), Gaps = 7/139 (5%)
 Frame = -1

Query  658  TPTP---SVRFSID-RSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGS  491
            TP P   S R+S+D RSISP    S+S   +   K       +   ++ C+CSPT+HPGS
Sbjct  52   TPQPMSQSFRYSLDTRSISPTNHRSISVSKKPQPKVSETTTASPSRRRRCMCSPTTHPGS  111

Query  490  FRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            FRCSLHKN+   + + + S+  N LN RRSAMTNSLVRIG VEG+ V+RAL  LIRPSSH
Sbjct  112  FRCSLHKNVANPHGQGTASFTGNSLNMRRSAMTNSLVRIGGVEGEWVRRALTTLIRPSSH  171

Query  319  QQRRRGDFQPRPSRLSRMS  263
              RRR  FQPRPSRLS M+
Sbjct  172  HLRRRAAFQPRPSRLSVMT  190



>gb|AEW07499.1| hypothetical protein 0_3046_01, partial [Pinus radiata]
Length=143

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N+N+  S +  S+ LNARRSAM NS+VRI +VEG+ V+
Sbjct  50   PRKTCMCSPTNHPGSFRCTLHRNINNSSSSTVHSH-LNARRSAMRNSVVRIRSVEGEWVR  108

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            R LAALIRPSSH  RRR  FQPRP+RL  M+ A++
Sbjct  109  RTLAALIRPSSHNTRRRTSFQPRPNRLCHMTTAQD  143



>ref|XP_002530465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31935.1| conserved hypothetical protein [Ricinus communis]
Length=194

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 7/97 (7%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSR-----PSISYP--SNRLNARRSAMTNSLVRIGTV  374
            K+TC CSPT+HPGSFRC+ H+ M +R     P+ SY   S+RLN RRSAMTNSLVRIG V
Sbjct  96   KRTCACSPTNHPGSFRCAFHRAMTARNNSSTPTASYQHSSSRLNFRRSAMTNSLVRIGGV  155

Query  373  EGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMS  263
            EG+LVKRAL+ALIRPSSHQ RR   F+PRPSRLS MS
Sbjct  156  EGELVKRALSALIRPSSHQLRRCAAFEPRPSRLSVMS  192



>gb|EYU34940.1| hypothetical protein MIMGU_mgv1a024024mg [Erythranthe guttata]
Length=225

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -1

Query  526  TCLCSPTSHPGSFRCSLHKN-----------MNSRPSISYPSNRLNARRSAMTNSLVRIG  380
            TC+CSPT+HPGSFRCSLHK              +R      S+ LN RRSAM NSLVRIG
Sbjct  104  TCMCSPTNHPGSFRCSLHKGGLAGSGVVSGGGPARTVSCGSSSGLNMRRSAMKNSLVRIG  163

Query  379  TVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEEDl*vlll*VCIDYSVWI  200
            TVEG+L KRALAALIRPSSHQQRRRG+F+PRPSRLS MS+      +L   VC  Y+   
Sbjct  164  TVEGELEKRALAALIRPSSHQQRRRGEFRPRPSRLSVMSRNNRSNTILSNRVCCVYNFEF  223



>ref|XP_004138717.1| PREDICTED: uncharacterized protein LOC101214709 [Cucumis sativus]
 ref|XP_004159260.1| PREDICTED: uncharacterized LOC101214709 [Cucumis sativus]
 gb|KGN62968.1| hypothetical protein Csa_2G382420 [Cucumis sativus]
Length=201

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 80/106 (75%), Gaps = 6/106 (6%)
 Frame = -1

Query  553  NPLANLPKKTCLCSPTSHPGSFRCSLHKNMNS------RPSISYPSNRLNARRSAMTNSL  392
            N   +LPKK C CSPT+HPGSFRCSLHK   S        S +Y S+ LN RRSAMTNSL
Sbjct  96   NSPVSLPKKPCTCSPTTHPGSFRCSLHKKSGSGIHQHQASSSAYSSSGLNMRRSAMTNSL  155

Query  391  VRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            VRIG VEG+ VKRAL ALIRPSSHQ RRR +F+P+PSRLS MSKA+
Sbjct  156  VRIGGVEGEWVKRALTALIRPSSHQLRRRANFRPQPSRLSVMSKAD  201



>ref|XP_011084060.1| PREDICTED: uncharacterized protein LOC105166416 [Sesamum indicum]
Length=201

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 90/127 (71%), Gaps = 16/127 (13%)
 Frame = -1

Query  652  TPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLH  473
            +PS+ FS+DR  SP+RS+S S          V  P A   K+TC+CSPT+HPGSFRCSLH
Sbjct  70   SPSLSFSLDRPGSPNRSISFSGP--------VQKPAAASQKRTCMCSPTNHPGSFRCSLH  121

Query  472  KNM--------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQ  317
            K +        +S+ +    S+RLN RRSAM NSLVRIGTVEGDLVKRALAALIRPSSHQ
Sbjct  122  KGVASNSRVSSSSQSASYGSSSRLNMRRSAMKNSLVRIGTVEGDLVKRALAALIRPSSHQ  181

Query  316  QRRRGDF  296
            QRRRG F
Sbjct  182  QRRRGAF  188



>gb|AEW07500.1| hypothetical protein 0_3046_01, partial [Pinus lambertiana]
Length=144

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = -1

Query  550  PLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  371
            P +  P+KTC+CSPT+HPGSFRCSLHKN ++  S +   ++LNARRSAM NSLVRIG VE
Sbjct  46   PCSVPPRKTCMCSPTNHPGSFRCSLHKNTSNSSSSTM-QSQLNARRSAMKNSLVRIGGVE  104

Query  370  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            G+ V+RAL ALIRPSSH  RRR  FQPRPSRL  M+ A++
Sbjct  105  GEWVRRALTALIRPSSHHMRRRSSFQPRPSRLCHMTTAQD  144



>gb|ABK21216.1| unknown [Picea sitchensis]
Length=180

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC LH+N N+  S +  S  LNARRSAMTNSLVRIG VEG+ V+
Sbjct  85   PRKTCMCSPTNHPGSFRCKLHRNSNNSSSSTMHSQ-LNARRSAMTNSLVRIGGVEGEWVR  143

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            RAL ALIRPSSH  RRR  FQ RPSRL  M+ AE
Sbjct  144  RALTALIRPSSHHMRRRASFQLRPSRLCHMTTAE  177



>gb|KCW81351.1| hypothetical protein EUGRSUZ_C02733 [Eucalyptus grandis]
Length=220

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 15/140 (11%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFSIDR  SP +S + S R  V+ ++G  N      K++C+CSPT+HPGSFRCSLHK+ 
Sbjct  86   VRFSIDRPASPKQSFAASPRQPVIHRRGNSN------KQSCMCSPTTHPGSFRCSLHKHS  139

Query  463  NSRP---------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
             S           S S+  NRL   RSAM N +V IG VEGDL+ RAL ALIRPSSHQQ+
Sbjct  140  GSGGGGGGGGNGHSDSFVPNRLIMLRSAMRNRIVSIGGVEGDLMIRALTALIRPSSHQQK  199

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQ RPSRLS MSKA +
Sbjct  200  RRAAFQSRPSRLSAMSKAGD  219



>gb|ABR18379.1| unknown [Picea sitchensis]
Length=180

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P+KTC+CSPT+HPGSFRC+LH+N N+  S +  S  LNARRSAMTNSLVRIG VEG+ V+
Sbjct  85   PRKTCMCSPTNHPGSFRCNLHRNSNNSSSSTMHSQ-LNARRSAMTNSLVRIGGVEGEWVR  143

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RAL ALIRPSSH  RRR  FQ RPSRL  M+ A++
Sbjct  144  RALTALIRPSSHHMRRRASFQLRPSRLCHMTTAKD  178



>ref|XP_010051172.1| PREDICTED: forkhead box protein C1-like [Eucalyptus grandis]
Length=251

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 15/140 (11%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            VRFSIDR  SP +S + S R  V+ ++G  N      K++C+CSPT+HPGSFRCSLHK+ 
Sbjct  117  VRFSIDRPASPKQSFAASPRQPVIHRRGNSN------KQSCMCSPTTHPGSFRCSLHKHS  170

Query  463  NSRP---------SISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQR  311
             S           S S+  NRL   RSAM N +V IG VEGDL+ RAL ALIRPSSHQQ+
Sbjct  171  GSGGGGGGGGNGHSDSFVPNRLIMLRSAMRNRIVSIGGVEGDLMIRALTALIRPSSHQQK  230

Query  310  RRGDFQPRPSRLSRMSKAEE  251
            RR  FQ RPSRLS MSKA +
Sbjct  231  RRAAFQSRPSRLSAMSKAGD  250



>ref|XP_010097175.1| hypothetical protein L484_025721 [Morus notabilis]
 gb|EXB67242.1| hypothetical protein L484_025721 [Morus notabilis]
Length=190

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 5/101 (5%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  371
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  370  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            G+L+KR+L+ALIRPSS+QQR R  FQP+PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPKPSRLSVMSRAQDS  190



>ref|XP_010097173.1| hypothetical protein L484_025719 [Morus notabilis]
 gb|EXB67240.1| hypothetical protein L484_025719 [Morus notabilis]
Length=190

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  371
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  370  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            G+L+KR+L+ALIRPSS+QQR R  FQP PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPMPSRLSVMSRAQDS  190



>ref|XP_010097172.1| hypothetical protein L484_025718 [Morus notabilis]
 gb|EXB67239.1| hypothetical protein L484_025718 [Morus notabilis]
Length=190

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKN-----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVE  371
            PKKTC+C+PT+HPGSFRCSLHKN         PS S  S R    RSAM NSL+R   VE
Sbjct  90   PKKTCMCAPTTHPGSFRCSLHKNSPRGGAQKTPSFSSNSRRQYLMRSAMANSLIRNRVVE  149

Query  370  GDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            G+L+KR+L+ALIRPSS+QQR R  FQP PSRLS MS+A++ 
Sbjct  150  GELMKRSLSALIRPSSNQQRSRETFQPMPSRLSVMSRAQDS  190



>ref|XP_007150776.1| hypothetical protein PHAVU_005G179600g [Phaseolus vulgaris]
 gb|ESW22770.1| hypothetical protein PHAVU_005G179600g [Phaseolus vulgaris]
Length=200

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRP-----SISYPSNRLNARRSAMTNSLVRIGTVEG  368
            K+TC+CSPT+HPGSFRC+ HK +  R      + S    +LN  RSAM NS+VRIG VEG
Sbjct  95   KRTCMCSPTTHPGSFRCAYHKQLAERQQQRQQTASSSGRKLNLLRSAMKNSVVRIGGVEG  154

Query  367  DLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            ++V+R L  LIRPSSH   RR  FQPRP+RLS MSKA++
Sbjct  155  EIVRRGLTTLIRPSSHHLHRRVGFQPRPTRLSLMSKAQD  193



>gb|ABR17408.1| unknown [Picea sitchensis]
Length=166

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            +K C+CSPT+HPGSFRC LH+  N+  S S P+++LN RRSAM NSLV+IG+VEGD V+R
Sbjct  71   RKACMCSPTNHPGSFRCRLHRKSNT--SSSSPNSQLNVRRSAMANSLVKIGSVEGDWVRR  128

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            ++ ALIRPSSH  RR+  FQPRPSRL  M+ A+ D
Sbjct  129  SITALIRPSSHHMRRKTSFQPRPSRLRHMTTAQVD  163



>gb|ADE76856.1| unknown [Picea sitchensis]
Length=197

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            +KTC CSPT+HPGSFRCSLH+N N+  S +  S +LNARRSAMTNSLVRI  VEG+ V+R
Sbjct  103  RKTCTCSPTNHPGSFRCSLHRNSNNSSSSTMCS-QLNARRSAMTNSLVRISGVEGEWVRR  161

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            AL A IRPSSH+ RRR  FQPRPSRL   + A++
Sbjct  162  ALTATIRPSSHRMRRRTSFQPRPSRLCHTTTAQD  195



>gb|KEH37892.1| hypothetical protein MTR_2g450700 [Medicago truncatula]
Length=149

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            K+TC+CSP++HPGSFRC LHKN  S  S +  SNR N RRSAM NSLVRI  +EG+LVKR
Sbjct  56   KRTCMCSPSTHPGSFRCRLHKNSTS--SKTSTSNRHNVRRSAMANSLVRISRLEGELVKR  113

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            AL ALIR  S+ QRRR +FQPRPSR S MSK EE
Sbjct  114  ALEALIRRCSYNQRRRCNFQPRPSRFSVMSKVEE  147



>ref|XP_009793128.1| PREDICTED: uncharacterized protein LOC104240041 [Nicotiana sylvestris]
Length=171

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 99/139 (71%), Gaps = 18/139 (13%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKK--TCLCSPTSHPGSFRCSLHK  470
            ++FS+DR +SP+RS+SV  R+    +Q       +LP+K   C+CSPT+HPGSFRCS+HK
Sbjct  37   IQFSLDREMSPNRSISVMNRESTRNRQ-----YKSLPQKKAACMCSPTTHPGSFRCSMHK  91

Query  469  NMNSRPSISYPSN-----------RLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSS  323
             M+ R S S  +            RLN RRSAMTNSLVRIGTVEG+LVKRALAALIRPSS
Sbjct  92   KMDVRRSSSSSTQTVSSSYNSNSNRLNMRRSAMTNSLVRIGTVEGELVKRALAALIRPSS  151

Query  322  HQQRRRGDFQPRPSRLSRM  266
            HQQRRR  FQ RPSRLS M
Sbjct  152  HQQRRRFGFQRRPSRLSNM  170



>ref|XP_011467044.1| PREDICTED: uncharacterized protein LOC105352242, partial [Fragaria 
vesca subsp. vesca]
Length=199

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 91/143 (64%), Gaps = 17/143 (12%)
 Frame = -1

Query  655  PTPSVRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSL  476
            P  SVRF  DR  +P RS+++ +      K  +        KK CLCSP++HPG+FRC+ 
Sbjct  58   PISSVRF--DRPSTPERSITIKKPIADNAKNQIN---GQSTKKACLCSPSTHPGAFRCAR  112

Query  475  HKNM-----------NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRP  329
            H+N            +   S  + S RLN RRSAM NSLVRIG VEGDLVKRALAAL+RP
Sbjct  113  HRNAPRVGASESNSSSKTASSYHSSVRLNCRRSAMINSLVRIG-VEGDLVKRALAALVRP  171

Query  328  SSHQQRRRGDFQPRPSRLSRMSK  260
            S++ QR R DF+P+PSRLS MSK
Sbjct  172  SAYNQRHRADFKPKPSRLSVMSK  194



>gb|KHN22423.1| hypothetical protein glysoja_024932 [Glycine soja]
Length=159

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM---NSRPSISYPSNRLNARRSAMTNSLVRIGTVEGD-  365
            K+TC+CSPT+HPGSFRC+ HK +     + + S    RLN  RSAM NS+VRIG VEGD 
Sbjct  60   KRTCMCSPTNHPGSFRCAYHKQLAEKQKQQTTSLSCRRLNLLRSAMKNSVVRIGGVEGDQ  119

Query  364  LVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            +V+RAL   LIRPSSH  RRR  FQPRP+RLS MSKA++
Sbjct  120  IVRRALTTTLIRPSSHHLRRRETFQPRPTRLSLMSKAQD  158



>ref|XP_009600832.1| PREDICTED: uncharacterized protein LOC104096200 [Nicotiana tomentosiformis]
Length=180

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 15/143 (10%)
 Frame = -1

Query  643  VRFSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM  464
            ++FS+DR +SP+RS+S+  R+    +Q          K  C+CSPT+HPGSFRCS+HK M
Sbjct  37   IQFSLDREMSPNRSISIMNRENTRNRQYKS---LRQKKAACMCSPTTHPGSFRCSMHKKM  93

Query  463  NSR------------PSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSH  320
            + R             S +  SNRL  RRSAMTNSLVRIGTVEG+LVKRALAALIRPSSH
Sbjct  94   DVRRSSSSSSSQTVSSSYNSNSNRLIMRRSAMTNSLVRIGTVEGELVKRALAALIRPSSH  153

Query  319  QQRRRGDFQPRPSRLSRMSKAEE  251
            QQRRR  FQ RPSRLS M + +E
Sbjct  154  QQRRRFGFQRRPSRLSNMFRTDE  176



>gb|ABK26255.1| unknown [Picea sitchensis]
Length=199

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVK  356
            P++TC+CSPT+HPGSFRCSLH+N +     S   ++LNARRSAMTNSLVRIG VEG+ V+
Sbjct  106  PRQTCMCSPTNHPGSFRCSLHRNSSH---SSSTHSQLNARRSAMTNSLVRIGGVEGEWVR  162

Query  355  RALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RAL +LIRPSSH  RRR  FQ RPSRL  M+ A++
Sbjct  163  RALTSLIRPSSHHMRRRSSFQRRPSRLCHMTTAQD  197



>gb|ABK27079.1| unknown [Picea sitchensis]
Length=199

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 13/133 (10%)
 Frame = -1

Query  637  FSIDRSISPHrsvsvsrrdqvvRKQGVGNPLANL----PKKTCLCSPTSHPGSFRCSLHK  470
            FS+DRS S      V    + +  +G   P+ ++    P++ C+CSPT+HPGSFRCSLH+
Sbjct  74   FSLDRSAS-----RVRSARRPITPKGDA-PMKSVPCAPPRQMCMCSPTNHPGSFRCSLHR  127

Query  469  NMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQP  290
            N +     S   ++LNARRSAMTNSLVRIG VEG+ V+RAL +LIRPSSH  RRR  FQP
Sbjct  128  NSS---HSSSTHSQLNARRSAMTNSLVRIGGVEGEWVRRALTSLIRPSSHHMRRRSSFQP  184

Query  289  RPSRLSRMSKAEE  251
            +PSRL  M+ A++
Sbjct  185  QPSRLCHMTTAQD  197



>ref|XP_011468518.1| PREDICTED: uncharacterized protein LOC105352658 [Fragaria vesca 
subsp. vesca]
Length=205

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 13/115 (11%)
 Frame = -1

Query  565  QGVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-----------RLNA  419
            Q  G  +A   +K CLCSP++HPG+FRC++H+N     +    S+           RL  
Sbjct  83   QKTGRAVAGT-QKACLCSPSTHPGAFRCAMHRNAQRGGASQSKSSSKTTSSYHSSIRLKY  141

Query  418  RRSAMTNSLVRIGTVEGDL-VKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            RR+AM NSLVRIG V G+L VK+A AALIRPS+H +RRR DFQP+PSRLS MSKA
Sbjct  142  RRAAMNNSLVRIGGVLGELLVKQASAALIRPSAHNRRRRADFQPKPSRLSVMSKA  196



>ref|XP_010236437.1| PREDICTED: uncharacterized protein LOC104584037 [Brachypodium 
distachyon]
Length=167

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-RLNARRSAMTNSLVRIGTVEG-DLV  359
            K+ C+CSPT+HPGSFRC+LH+  +S P  +       +ARRSAM NSLVRI  VEG D V
Sbjct  64   KRACMCSPTTHPGSFRCALHRGCSSSPGTAAAGGLHQDARRSAMANSLVRIAAVEGGDHV  123

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRL  275
            +RALAAL+RPSSH QRR   F+  PSRL
Sbjct  124  RRALAALVRPSSHHQRRGTSFRALPSRL  151



>ref|XP_004486636.1| PREDICTED: probable serine/threonine-protein kinase fhkB-like 
[Cicer arietinum]
Length=222

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 70/118 (59%), Gaps = 26/118 (22%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYP-------------------------SNRL  425
            + C+CSPT+H GSFRC+ HK M  +                               S +L
Sbjct  106  RKCMCSPTTHAGSFRCAYHKRMAEQEQQRREKQQQKQQQVQQQQQQQVHQQTAWSRSRKL  165

Query  424  NARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            N RRSAM NSLVRIG VEG++VKR L  LIRPSSH+ RRR  FQP+PSRLS MSKA++
Sbjct  166  NLRRSAMKNSLVRIG-VEGEIVKRTLTTLIRPSSHELRRREAFQPKPSRLSIMSKAQD  222



>ref|XP_010109762.1| hypothetical protein L484_008438 [Morus notabilis]
 gb|EXC24667.1| hypothetical protein L484_008438 [Morus notabilis]
Length=172

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = -1

Query  562  GVGNPLANLPKKTCLCSPTSHPGSFRCSLHKNM---NSRPSIS-YPSN--RLNARRSAMT  401
            G  N + + PKKTC+C+PT+HPGSFRC LHKN      R   S + SN  R    RSAM 
Sbjct  72   GNCNSVVSKPKKTCMCAPTTHPGSFRCYLHKNSPRGGRRQQTSLFDSNSIRFCLTRSAMA  131

Query  400  NSLVRIGTVEGDLVKRA-LAALIRPSSHQQRRRGDFQPRPS  281
            NS + IG VEG+L+KR+ L ALIRPSS+Q +RR  F+PRPS
Sbjct  132  NSPITIGLVEGELMKRSLLVALIRPSSNQLQRRDTFRPRPS  172



>gb|AEX12199.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12201.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12202.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12203.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12204.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12205.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12206.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12207.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12208.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12209.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12210.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12211.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12212.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12213.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12214.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
 gb|AEX12215.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
Length=86

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%), Gaps = 7/88 (8%)
 Frame = -1

Query  514  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            SPT+HPGSFRCSLH+N N   S ++P  +LNARRSAM     RI  VEG+ V+R L ALI
Sbjct  1    SPTNHPGSFRCSLHRNSNHSSS-THP--QLNARRSAMR----RINRVEGEWVRRVLTALI  53

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RPSS   R R  FQPRPSRL  M+ A++
Sbjct  54   RPSSQHMRTRTSFQPRPSRLCHMTTAQD  81



>gb|AEX12200.1| hypothetical protein 0_7218_01, partial [Pinus taeda]
Length=86

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 7/88 (8%)
 Frame = -1

Query  514  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            SPT+HPGSFRCSLH+N N   S ++P  +LNARRSAM     RI  VEG+ V+R L ALI
Sbjct  1    SPTNHPGSFRCSLHRNSN-HSSSTHP--QLNARRSAMR----RINRVEGEWVRRVLTALI  53

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RPSS   R R  FQP+PSRL  M+ A++
Sbjct  54   RPSSQHMRTRTSFQPQPSRLCHMTTAQD  81



>ref|XP_003597954.1| hypothetical protein MTR_2g104380 [Medicago truncatula]
 gb|AES68205.1| hypothetical protein MTR_2g104380 [Medicago truncatula]
Length=207

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 65/126 (52%), Gaps = 34/126 (27%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP---------------------------  437
            P + C+CSPT+H GSFRC+ HK M  +                                 
Sbjct  82   PARRCMCSPTTHAGSFRCAYHKRMAEQEQQRQQKQDKVHQQHQQQKEVQQKQHQQQQRQQ  141

Query  436  ------SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRL  275
                  S  LN RRSAM NSL+RIG VEG+++KR L  LIRPS  Q RRR  FQ +PSRL
Sbjct  142  ITAMSRSRTLNLRRSAMKNSLIRIG-VEGEILKRTLTNLIRPSPQQLRRREAFQAKPSRL  200

Query  274  SRMSKA  257
            S MSKA
Sbjct  201  SVMSKA  206



>gb|EAZ05724.1| hypothetical protein OsI_27951 [Oryza sativa Indica Group]
Length=175

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 5/75 (7%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNS--RPSISYPSN--RLNARRSAMTNSLVRIGTVEG-DLV  359
            C CSPT+HPGSFRC+LH+   S  RPS++      R +ARRSAM NSLVRI  VEG D V
Sbjct  76   CACSPTTHPGSFRCALHRGAASPSRPSVAAACGGLREDARRSAMANSLVRIAAVEGGDHV  135

Query  358  KRALAALIRPSSHQQ  314
            +RA+AALIRPSSH Q
Sbjct  136  RRAVAALIRPSSHHQ  150



>ref|XP_010520684.1| PREDICTED: uncharacterized protein LOC104799741 [Tarenaya hassleriana]
Length=159

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 19/110 (17%)
 Frame = -1

Query  526  TCLCSPTSHPGSFRCSLHKN--MNSRPSISYP----------------SNRLNARRSAMT  401
            TCLCSPT+HPGSFRC+ H+   +    +++                  ++ L  RRSAM 
Sbjct  48   TCLCSPTTHPGSFRCARHRRSAIGGGKAVTTKAPSPSPSPVPIREFAVTDGLKLRRSAMV  107

Query  400  NSLVRIGTVEGDLVKRALAALIR-PSSHQQRRRGDFQPRPSRLSRMSKAE  254
            NSL RIG VEG++ KR +AAL R PSS   RRR +F+PRPSR S M + +
Sbjct  108  NSLARIGGVEGEVAKRTMAALSRPPSSQNLRRRSEFRPRPSRFSVMCRDQ  157



>ref|XP_009131795.1| PREDICTED: uncharacterized protein LOC103856443 [Brassica rapa]
Length=167

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 71/116 (61%), Gaps = 18/116 (16%)
 Frame = -1

Query  544  ANLPKKT----CLCSPTSHPGSFRCSLH--------KNMNSRPSISYPSNR-----LNAR  416
             N PK +    CLCSPT+HPGSFRC+ H        + +NS+  ++   N      LN R
Sbjct  46   GNTPKTSAASKCLCSPTTHPGSFRCAFHRRLENEKNRTLNSQAKLNKCGNTTKNSGLNMR  105

Query  415  RSAMTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            ++A+ NSL RIG+VE D VK++LAA +++PS     RR DF+PRPSR   + K ++
Sbjct  106  KTALLNSLARIGSVEADRVKKSLAASMVKPSPLHISRRFDFRPRPSRFYALRKDQD  161



>gb|AFK36164.1| unknown [Medicago truncatula]
Length=207

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 64/126 (51%), Gaps = 34/126 (27%)
 Frame = -1

Query  535  PKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYP---------------------------  437
            P + C+CSPT+H GSFRC+ HK M  +                                 
Sbjct  82   PARRCMCSPTTHAGSFRCAYHKRMAEQEQQRQQKQDKVHQQHQQQKEVQQKQHQQQQRQQ  141

Query  436  ------SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRL  275
                  S  LN RRSAM NSL+RIG VE +++KR L  LIRPS  Q RRR  FQ +PSRL
Sbjct  142  ITAMSRSRTLNLRRSAMKNSLIRIG-VESEILKRTLTNLIRPSPQQLRRREAFQGKPSRL  200

Query  274  SRMSKA  257
            S MSKA
Sbjct  201  SVMSKA  206



>gb|AFW57201.1| hypothetical protein ZEAMMB73_692989, partial [Zea mays]
Length=170

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNA-RRSAMTNSLVRIGTVE-  371
            + +C CSPT+HPGSFRC+LH+     + +  S +  S+RL+A RR++M N LVRI  VE 
Sbjct  68   RASCACSPTTHPGSFRCALHRGGQGPLPASASAALVSSRLSAPRRASMANPLVRIAAVEG  127

Query  370  GDLVKRALAALIRPSSHQQRRRGD-FQPRPSRL  275
            GD ++RALAAL+RP+  Q RRR D F+P PSRL
Sbjct  128  GDHIRRALAALVRPTPSQTRRRADAFRPTPSRL  160



>emb|CDY51848.1| BnaA03g56150D [Brassica napus]
Length=167

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 63/105 (60%), Gaps = 14/105 (13%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------------LNARRSAMTNSLVRI  383
            CLCSPT HPGSFRC+ H+ + S  + +  S               LN R++A+ NSLVRI
Sbjct  57   CLCSPTVHPGSFRCAFHRRLESEKNRTLNSQAKPNKCGNMTKNSGLNMRKTALLNSLVRI  116

Query  382  GTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
             +VE D VK++LAA ++ PS     RR DF+PRPSR   + K ++
Sbjct  117  ASVEADRVKKSLAASMVTPSPLHISRRFDFRPRPSRFYALRKDQD  161



>gb|KFK26276.1| hypothetical protein AALP_AA8G225800 [Arabis alpina]
Length=162

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 15/109 (14%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLH--------KNMNSRPSISYPSNR-----LNARRSAMTNSL  392
            K+ CLCSPT+HPGSFRC  H        K +NS PS     N      LN R+ A+ NSL
Sbjct  55   KRKCLCSPTTHPGSFRCGFHRRLEIEKIKTLNS-PSSPVKGNNSFGSGLNLRKVALVNSL  113

Query  391  VRIGTVEGDLVKRAL-AALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
             +IG+VE +  +++L A+L++P+    RRR DF+PR SR   + K ++D
Sbjct  114  AKIGSVEAERFRKSLMASLVKPAGLHIRRRSDFRPRLSRFCVLHKEDQD  162



>ref|XP_004954250.1| PREDICTED: uncharacterized protein LOC101761531 [Setaria italica]
Length=176

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 71/119 (60%), Gaps = 24/119 (20%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNS-----------------RPSISYPSNRLNARRS-A  407
            ++TC+CSPT+HPGSFRCSLHK   +                   S S  ++RL A  S  
Sbjct  56   RRTCMCSPTNHPGSFRCSLHKERKAPHGGHKPTSPPSPPSLAGSSSSMTTSRLGASASRR  115

Query  406  MTNSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEED  248
            M ++LVRIG VE G+  +RALAA +RPS     S  +RR G F+PRPSRLS +S A ++
Sbjct  116  MGSALVRIGAVEGGEWARRALAATVRPSPAAQQSQHRRRVGGFRPRPSRLSAVSMAGDN  174



>ref|XP_002873994.1| hypothetical protein ARALYDRAFT_910077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50253.1| hypothetical protein ARALYDRAFT_910077 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 15/107 (14%)
 Frame = -1

Query  544  ANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSIS-------------YPSN-RLNARRSA  407
            +N  K+ CLCSPT+HPGSFRCS H+ +    S +             YP N  LN R+ A
Sbjct  60   SNHQKRKCLCSPTTHPGSFRCSFHRRLEHEKSKTLASSTAKRNNRGDYPINVGLNLRKLA  119

Query  406  MTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSR  269
            + NSL +IG+VE +  +R+LAA L++PSS     R +F+PR SR  +
Sbjct  120  LMNSLAKIGSVEAERFRRSLAANLVKPSSLHSHHRSEFRPRLSRFHK  166



>ref|XP_006400605.1| hypothetical protein EUTSA_v10015868mg [Eutrema salsugineum]
 gb|ESQ42058.1| hypothetical protein EUTSA_v10015868mg [Eutrema salsugineum]
Length=179

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 16/110 (15%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR--------------LNARRSAMTNS  395
            K  CLCSPT+HPGSFRCS H+ + +  + +  S+               LN R++A+ NS
Sbjct  70   KIKCLCSPTTHPGSFRCSFHRRLENEKNGTLGSSSAKRNTCGNTTRNSALNLRKAALVNS  129

Query  394  LVRIGTVEGDLVKRALAA-LIRP-SSHQQRRRGDFQPRPSRLSRMSKAEE  251
            L +IG+VE +  +++LAA +++P SS   RRR +F+PRPSR   + K ++
Sbjct  130  LAKIGSVEAERFRKSLAATMVKPNSSLHTRRRNEFRPRPSRFYALHKDQD  179



>gb|AEX12216.1| hypothetical protein 0_7218_01, partial [Pinus radiata]
Length=87

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = -1

Query  514  SPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRALAALI  335
            SPT+HPGSFRCSLH+N N   S S   ++LNARRSAM     RI  VEG+ V+R   ALI
Sbjct  1    SPTNHPGSFRCSLHRNSNR--SSSSTHSQLNARRSAMR----RINRVEGEWVRRVFTALI  54

Query  334  RPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            RPSS   R R  FQP+PSRL  M+ A++
Sbjct  55   RPSSQHMRTRTSFQPQPSRLCHMTTAQD  82



>ref|XP_010493142.1| PREDICTED: uncharacterized protein LOC104770417 [Camelina sativa]
Length=176

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 12/106 (11%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM-NSRPSISYPSNR----------LNARRSAMTNSLVR  386
            K+ CLCSPT+HPGSFRC+ H+ + + R      SNR          LN R+ A+ NSL +
Sbjct  67   KRKCLCSPTTHPGSFRCAFHRRLEHERSKTLASSNRGDDTVRVSVGLNLRKLALINSLAK  126

Query  385  IGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            IG+VE +  +R LAA L++P S    RR +F+PR SR   + K ++
Sbjct  127  IGSVEAERFRRCLAANLVKPPSFHDIRRPEFRPRLSRFFELHKDQD  172



>ref|XP_002443921.1| hypothetical protein SORBIDRAFT_07g004400 [Sorghum bicolor]
 gb|EES13416.1| hypothetical protein SORBIDRAFT_07g004400 [Sorghum bicolor]
Length=164

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 19/119 (16%)
 Frame = -1

Query  556  GNPLANLPKKTCLCSPTSHPGSFRCSLHK---------------NMNSRPSISYPSNRLN  422
            G P     + +C CSPT+HPGS+RC+LH+                + +  S +  S+RL+
Sbjct  44   GPPTKAKQRASCACSPTTHPGSYRCALHRGQGQAGGGGAAGPPLPVAAAASAAPVSSRLS  103

Query  421  A-RRSAMTNSLVRIGTVEG-DLVKRALAALIR-PSSHQQRRRGD-FQPRPSRLSRMSKA  257
            A RR++M N LVRI  VEG D ++RALAAL+R P S   RRR D F+P PSRLS MS A
Sbjct  104  APRRASMANPLVRIAAVEGSDHIRRALAALVRPPPSQTTRRRADAFRPTPSRLSAMSSA  162



>gb|KFK29077.1| hypothetical protein AALP_AA7G085900 [Arabis alpina]
Length=144

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 15/93 (16%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            K+ C CSPTSHPGSFRC LHK  ++       ++  + R+SA+T S+V          KR
Sbjct  66   KRPCSCSPTSHPGSFRCGLHKGSDT-----TGAHAPSVRKSAVTKSVV----------KR  110

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAE  254
            ALA L RPSSH Q RR +F+ +PS LS MSKA 
Sbjct  111  ALAVLTRPSSHSQSRRANFKSQPSGLSVMSKAN  143



>ref|NP_197537.1| serine-rich protein-like protein [Arabidopsis thaliana]
 gb|AED92836.1| serine-rich protein-like protein [Arabidopsis thaliana]
Length=175

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 17/103 (17%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPS------NR----------LNARRSAMT  401
            K+ CLCSPT+HPGSFRCS H+ +    S +  S      NR          LN R+ A+ 
Sbjct  68   KRKCLCSPTTHPGSFRCSFHRRLEHEKSKTLASSTVKRNNRGDNTIRVNVGLNLRKLALM  127

Query  400  NSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRL  275
            NSL +IG+VE +  +R+LAA L +PSS    RR +F+PR SR 
Sbjct  128  NSLAKIGSVEAERFRRSLAANLAKPSSLHSHRRPEFRPRLSRF  170



>ref|XP_010454341.1| PREDICTED: uncharacterized protein LOC104736112 [Camelina sativa]
Length=171

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 17/111 (15%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM-NSRPSISYPSNR---------------LNARRSAMT  401
            K+ CLCSPT+HPGSFRC+ H+ + + R      SNR               LN R+ A+ 
Sbjct  61   KRKCLCSPTTHPGSFRCAFHRRLEHERSKTLASSNRGDDNNNNNTMRVSVGLNLRKLALI  120

Query  400  NSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            NSL +IG+VE +  +  LAA L++PSS    RR +F+PR SR   + K ++
Sbjct  121  NSLAKIGSVEAERFRTCLAANLVKPSSFHDIRRPEFRPRLSRFYELHKDQD  171



>gb|KJB53962.1| hypothetical protein B456_009G013600 [Gossypium raimondii]
Length=109

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  350
            +TCLCSPT+HPGSFRCSLH+N N +P    P+ R  A R A  NS       + + +K  
Sbjct  16   RTCLCSPTTHPGSFRCSLHRNFN-KP----PTGRSRAVRIA-PNSWELALQAKANSIKAL  69

Query  349  LAALIRPSSHQQRRRGDFQPRPSRL  275
            L  +I+PSSH  +RR DFQP+PSR 
Sbjct  70   LLQIIKPSSHDLQRRRDFQPKPSRF  94



>ref|XP_007202930.1| hypothetical protein PRUPE_ppa016664mg [Prunus persica]
 ref|XP_008242916.1| PREDICTED: uncharacterized protein LOC103341213 [Prunus mume]
 gb|EMJ04129.1| hypothetical protein PRUPE_ppa016664mg [Prunus persica]
Length=99

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 17/95 (18%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKNMN-SRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKR  353
            +TCLCSPTSHPGSFRCSLH+N N  +P IS P+             +V+  +++G L   
Sbjct  17   RTCLCSPTSHPGSFRCSLHRNSNKQQPIISNPA------------FVVKPNSIKGCL---  61

Query  352  ALAALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
             L  LI+PSSH  +RR  FQPRP+R   M+     
Sbjct  62   -LLQLIKPSSHDLQRRRKFQPRPTRFCLMNNTRNQ  95



>emb|CDX70925.1| BnaC03g10090D [Brassica napus]
Length=146

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 14/105 (13%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------------LNARRSAMTNSLVRI  383
            CLCSPT+HPGSFRC+ H+ + +  + +  S               L+ R++ + NSL RI
Sbjct  36   CLCSPTTHPGSFRCAFHRRLENEKNRTLNSQAKPNKCGNTTKNSGLSMRKTELLNSLARI  95

Query  382  GTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
             +VE D  +++LAA +++PS     RR DF+PRPSR   + K ++
Sbjct  96   ASVEADRFRKSLAASMVKPSPLHISRRFDFRPRPSRFYALRKDQD  140



>ref|XP_006286710.1| hypothetical protein CARUB_v10002860mg [Capsella rubella]
 gb|EOA19608.1| hypothetical protein CARUB_v10002860mg [Capsella rubella]
Length=181

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 19/113 (17%)
 Frame = -1

Query  532  KKTCLCSPTSHPGSFRCSLHKNM----------NSRPSISYPSNR--------LNARRSA  407
            K+ CLCSPT+HPGSFRCS H+ +          NS P+    SNR        LN R+ A
Sbjct  69   KRKCLCSPTTHPGSFRCSFHRRLEHDRSKTLASNSSPTKRTNSNRGDVRVCVGLNLRKLA  128

Query  406  MTNSLVRIGTVEGDLVKRALAA-LIRPSSHQQRRRGDFQPRPSRLSRMSKAEE  251
            + NSL +IG+ E +  + +LAA L++PSS    R  +F+PR SR  ++   ++
Sbjct  129  LINSLAKIGSAEAERFRTSLAANLVKPSSFHILRHPEFRPRLSRFYQLRTVQD  181



>emb|CDY68410.1| BnaAnng27180D [Brassica napus]
Length=153

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -1

Query  553  NPLANLPKKTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------LNARRSAMTNS  395
            NP ++   + C CSPT+HPGSFRC  H+ + +  S +  SN+       L  R+ A+ NS
Sbjct  45   NPPSSSAVRKCSCSPTTHPGSFRCGFHRRLENEKSKAL-SNKSKSGDSGLYLRKLALVNS  103

Query  394  LVRIGTVEGDLVKRALA-ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
            L RIG+VE +  ++ L  ++++PSS   RRR +F+PR SR   M K  +D
Sbjct  104  LARIGSVEAERFRKYLTESIVKPSSLLIRRRFEFRPRLSRFYGMHKDPKD  153



>ref|XP_009126442.1| PREDICTED: uncharacterized protein LOC103851346 [Brassica rapa]
 emb|CDY45090.1| BnaA02g04860D [Brassica napus]
Length=153

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 9/102 (9%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNR-------LNARRSAMTNSLVRIGTVE  371
            + C CSPT+HPGSFRC  H+ + S   I   SN+       +  R+ A+ NSL RIG+VE
Sbjct  53   RKCSCSPTTHPGSFRCGFHRRLES-EKIKALSNKSKSGDSGMYLRKLALANSLARIGSVE  111

Query  370  GDLVKRALA-ALIRPSSHQQRRRGDFQPRPSRLSRMSKAEED  248
             +  ++ L  ++++PSS   RRR +F+PR SR   M K  +D
Sbjct  112  AERFRKYLTESIVKPSSLLIRRRFEFRPRLSRFYGMHKDPKD  153



>gb|AEW08800.1| hypothetical protein CL1668Contig1_02, partial [Pinus radiata]
 gb|AFG50829.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50830.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50831.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50832.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50833.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50834.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50835.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50836.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50837.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50838.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50840.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50841.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50842.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
 gb|AFG50843.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
Length=48

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  400  NSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            NSLV+IG+VEG+ V+RAL ALIRPS H  RRR  FQPRPSRL  M++A
Sbjct  1    NSLVKIGSVEGEWVRRALTALIRPSRHHMRRRASFQPRPSRLCHMTRA  48



>ref|XP_010244874.1| PREDICTED: uncharacterized protein LOC104588580 [Nelumbo nucifera]
Length=111

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 10/92 (11%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKN---MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLV  359
            +TCLCSPT+HPGSFRCSLH+N   + +R S+   SN       + TN        + +L+
Sbjct  18   RTCLCSPTNHPGSFRCSLHRNSRKLYTRSSVHVVSN-------STTNRSDWRMVDKPNLL  70

Query  358  KRALAALIRPSSHQQRRRGDFQPRPSRLSRMS  263
            K  L  +I+PS H  RRR +FQP+P+R   M+
Sbjct  71   KEFLMQIIKPSKHDLRRRSNFQPKPTRFCLMN  102



>ref|NP_001237708.1| uncharacterized protein LOC100306623 [Glycine max]
 gb|ACU14899.1| unknown [Glycine max]
Length=108

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 15/92 (16%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  362
            +TC+CSPT+HPGSFRCS+HK     + +RP    PS+  ++  +A  NSL          
Sbjct  17   RTCMCSPTNHPGSFRCSMHKKPPRAVVARPLSRTPSSWNSSSMAAKANSL----------  66

Query  361  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRM  266
             K  L  +I+PSSH+  RR  FQP+PSR S M
Sbjct  67   -KAILLQMIKPSSHEHHRRKSFQPKPSRFSLM  97



>gb|AFG50839.1| hypothetical protein CL1668Contig1_02, partial [Pinus taeda]
Length=48

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  400  NSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            NSLV+IG+VEG+ V+RAL ALIRPS H  RRR  FQPRPSRL  M++A
Sbjct  1    NSLVKIGSVEGEWVRRALTALIRPSRHHLRRRASFQPRPSRLCHMTRA  48



>gb|KHN47128.1| hypothetical protein glysoja_022429 [Glycine soja]
Length=108

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 15/92 (16%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKN----MNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDL  362
            +TC+CSPT+HPGSFRCS+HK     + +RP    PS+  ++  +A  NSL          
Sbjct  17   RTCMCSPTNHPGSFRCSVHKKPPRAVVARPLSRTPSSWNSSSMAAKANSL----------  66

Query  361  VKRALAALIRPSSHQQRRRGDFQPRPSRLSRM  266
             K  L  +I+PSSH+  RR  FQP+PSR S M
Sbjct  67   -KAILLQMIKPSSHEHHRRKSFQPKPSRFSLM  97



>gb|EAY87888.1| hypothetical protein OsI_09309 [Oryza sativa Indica Group]
Length=173

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 61/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  401
            C+CSPT+HPGSFRCSLHK      S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQKR--SVHHKAAAAPSSPPSPTSPPASGGAVRLGGARRMGG  107

Query  400  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  251
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>ref|NP_001048411.1| Os02g0799700 [Oryza sativa Japonica Group]
 dbj|BAD36711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD36066.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10325.1| Os02g0799700 [Oryza sativa Japonica Group]
 dbj|BAG89439.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  401
            C+CSPT+HPGSFRCSLHK    + S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQ--KRSVHHKAAAAPSSPPSPTSPPASGGAVRLGGARRMGG  107

Query  400  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  251
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>gb|EAZ24963.1| hypothetical protein OsJ_08744 [Oryza sativa Japonica Group]
Length=173

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 62/116 (53%), Gaps = 27/116 (23%)
 Frame = -1

Query  523  CLCSPTSHPGSFRCSLHKNMNSRPSISYPSN-------------------RLNARRSAMT  401
            C+CSPT+HPGSFRCSLHK    + S+ + +                    RL   R    
Sbjct  50   CMCSPTNHPGSFRCSLHKEQ--KRSVHHKAAAAPSSPPSPTSPRASGGAVRLGGARRMGG  107

Query  400  NSLVRIGTVE-GDLVKRALAALIRPS-----SHQQRRRGDFQPRPSRLSRMSKAEE  251
            ++LVRIG VE G   +RALAA IRPS     +  +RR    +PRPSRLS +S A +
Sbjct  108  SALVRIGAVESGQWARRALAATIRPSPAAQQAQHRRRVAGLRPRPSRLSAVSMAGD  163



>emb|CDP06279.1| unnamed protein product [Coffea canephora]
Length=86

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  436  SNRLNARRSAMTNSLVRIGTVEGDLVKRALAALIRPSSHQQRRRGDFQPRPSRLSRMSKA  257
            S R   R+ A+ NS  R GTVEGD VKRAL AL R SS +Q  R DF P PSRLS MS+A
Sbjct  24   SGRFTVRQFAIMNSQARSGTVEGDFVKRALTALTRSSSQKQCPRRDFHPEPSRLSVMSRA  83

Query  256  EE  251
            E+
Sbjct  84   ED  85



>ref|XP_009760525.1| PREDICTED: uncharacterized protein LOC104212863 [Nicotiana sylvestris]
Length=75

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 11/73 (15%)
 Frame = -1

Query  520  LCSPTSHPGSFRCSLHKNMNS------RPSISYPSNR-LN---ARRSAMTNSLVRIGTVE  371
            +C+PT+HPGSFRCSLHKN N       + + +  S++ LN    RRSAM NS+VRIG VE
Sbjct  1    MCAPTNHPGSFRCSLHKNSNQTKYAHIKTTTTKKSHQHLNLKIIRRSAMVNSVVRIGAVE  60

Query  370  -GDLVKRALAALI  335
             G+L+KR L+A I
Sbjct  61   DGELIKRKLSAFI  73



>ref|XP_007013642.1| Serine-rich protein-related [Theobroma cacao]
 gb|EOY31261.1| Serine-rich protein-related [Theobroma cacao]
Length=109

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 7/89 (8%)
 Frame = -1

Query  529  KTCLCSPTSHPGSFRCSLHKNMNSRPSISYPSNRLNARRSAMTNSLVRIGTVEGDLVKRA  350
            +TCLCSPT+HPGSFRC+LH+N N       P  R    R +  +  + +   + + +K  
Sbjct  17   RTCLCSPTTHPGSFRCNLHRNFNK------PPGRTRVVRVSPNHWELAV-IAKANSIKAI  69

Query  349  LAALIRPSSHQQRRRGDFQPRPSRLSRMS  263
            L  +I+PSSH  +RR +FQP+PSR   ++
Sbjct  70   LLQIIKPSSHDMQRRRNFQPKPSRFCLLN  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240