BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015N09

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase               342   2e-115   Ipomoea batatas [batate]
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               342   7e-110   Ipomoea batatas [batate]
ref|XP_004159592.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    313   9e-104   
emb|CAN75190.1|  hypothetical protein VITISV_035381                     318   5e-101   Vitis vinifera
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        318   8e-101   Vitis vinifera
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        317   3e-100   
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        316   5e-100   
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        315   2e-99    Nicotiana sylvestris
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        309   3e-99    Populus euphratica
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    313   3e-99    
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    313   6e-99    Cucumis sativus [cucumbers]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    313   6e-99    Cucumis melo [Oriental melon]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    313   6e-99    Cucumis melo [Oriental melon]
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 313   7e-99    Theobroma cacao [chocolate]
gb|KDP26621.1|  hypothetical protein JCGZ_17779                         312   1e-98    Jatropha curcas
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             311   3e-98    
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             311   3e-98    
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2                 305   5e-98    
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    310   8e-98    Solanum tuberosum [potatoes]
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    310   1e-97    Fragaria vesca subsp. vesca
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    310   1e-97    Fragaria vesca subsp. vesca
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   309   4e-97    Morus notabilis
ref|XP_002312685.1|  leucine-rich repeat family protein                 307   2e-96    
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             307   2e-96    
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg             305   2e-96    
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg             305   2e-96    
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    304   3e-96    Prunus mume [ume]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    304   8e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    304   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        304   3e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    304   5e-95    Prunus mume [ume]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    304   5e-95    Prunus mume [ume]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    303   6e-95    Populus euphratica
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    303   7e-95    Populus euphratica
emb|CDP13189.1|  unnamed protein product                                302   1e-94    Coffea canephora [robusta coffee]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           301   2e-94    Medicago truncatula
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    301   2e-94    Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    301   2e-94    Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    301   2e-94    Malus domestica [apple tree]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   300   9e-94    Citrus sinensis [apfelsine]
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                300   9e-94    Erythranthe guttata [common monkey flower]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    298   2e-93    Solanum lycopersicum
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    298   6e-93    Solanum lycopersicum
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    298   7e-93    Cicer arietinum [garbanzo]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    297   7e-93    Glycine max [soybeans]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        297   8e-93    Glycine soja [wild soybean]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             297   9e-93    Phaseolus vulgaris [French bean]
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    296   2e-92    Nicotiana tomentosiformis
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        296   2e-92    Glycine soja [wild soybean]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    296   2e-92    Glycine max [soybeans]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    295   5e-92    Citrus sinensis [apfelsine]
gb|KJB61041.1|  hypothetical protein B456_009G337000                    295   6e-92    Gossypium raimondii
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             295   6e-92    Citrus clementina [clementine]
gb|KJB61045.1|  hypothetical protein B456_009G337000                    295   6e-92    Gossypium raimondii
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590          294   1e-91    Amborella trichopoda
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        292   7e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    292   1e-90    Elaeis guineensis
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    291   2e-90    
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    291   2e-90    
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    291   2e-90    
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        290   4e-90    Phoenix dactylifera
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    289   5e-90    Solanum tuberosum [potatoes]
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        290   7e-90    Elaeis guineensis
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    290   1e-89    Phoenix dactylifera
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        289   1e-89    Eucalyptus grandis [rose gum]
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    289   2e-89    Phoenix dactylifera
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    284   6e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    284   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    283   5e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    283   6e-87    
ref|XP_006844161.1|  hypothetical protein AMTR_s00006p00261510          277   5e-85    Amborella trichopoda
ref|XP_010261784.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    273   3e-84    Nelumbo nucifera [Indian lotus]
ref|XP_003637897.1|  Receptor-like kinase                               269   2e-83    
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          272   2e-83    
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    273   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        272   3e-83    Solanum lycopersicum
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    272   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    272   3e-83    Sesamum indicum [beniseed]
emb|CAN63733.1|  hypothetical protein VITISV_025883                     271   5e-83    Vitis vinifera
emb|CDP00520.1|  unnamed protein product                                271   6e-83    Coffea canephora [robusta coffee]
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    271   9e-83    Ricinus communis
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        271   9e-83    Vitis vinifera
gb|KEH21800.1|  NSP-interacting kinase-like protein                     271   9e-83    Medicago truncatula
ref|XP_008446509.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    268   1e-82    Cucumis melo [Oriental melon]
ref|XP_004171526.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    260   2e-82    
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    270   2e-82    Citrus sinensis [apfelsine]
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   270   2e-82    Citrus sinensis [apfelsine]
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    267   3e-82    
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    270   4e-82    Phoenix dactylifera
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        268   4e-82    Glycine soja [wild soybean]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       266   4e-82    Glycine max [soybeans]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    270   5e-82    Setaria italica
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    268   7e-82    
gb|KEH17048.1|  NSP-interacting kinase-like protein                     267   8e-82    Medicago truncatula
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    268   8e-82    Cicer arietinum [garbanzo]
gb|KDP24340.1|  hypothetical protein JCGZ_25636                         268   9e-82    Jatropha curcas
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             268   1e-81    Phaseolus vulgaris [French bean]
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    268   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             268   1e-81    Citrus clementina [clementine]
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    268   1e-81    Glycine max [soybeans]
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        268   1e-81    Glycine soja [wild soybean]
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    268   2e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    268   2e-81    
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    268   2e-81    Populus euphratica
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    268   2e-81    Cucumis melo [Oriental melon]
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    268   2e-81    Cucumis melo [Oriental melon]
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    267   2e-81    Glycine max [soybeans]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    267   2e-81    Populus euphratica
ref|XP_004238998.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        267   2e-81    Solanum lycopersicum
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        267   3e-81    Glycine soja [wild soybean]
ref|XP_006605000.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    255   3e-81    
ref|NP_001238448.1|  NSP-interacting kinase precursor                   266   3e-81    Glycine max [soybeans]
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    267   4e-81    Cucumis sativus [cucumbers]
gb|KJB43139.1|  hypothetical protein B456_007G186300                    263   4e-81    Gossypium raimondii
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        266   4e-81    Glycine soja [wild soybean]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       266   5e-81    Glycine max [soybeans]
gb|KEH17047.1|  NSP-interacting kinase-like protein                     266   5e-81    Medicago truncatula
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    266   5e-81    Glycine max [soybeans]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             266   5e-81    Populus trichocarpa [western balsam poplar]
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    266   6e-81    Cicer arietinum [garbanzo]
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    266   6e-81    Nicotiana tomentosiformis
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    266   8e-81    Cucumis melo [Oriental melon]
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        266   1e-80    Eucalyptus grandis [rose gum]
ref|XP_006348615.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    265   1e-80    
gb|KJB80538.1|  hypothetical protein B456_013G102600                    266   1e-80    Gossypium raimondii
gb|KDO70180.1|  hypothetical protein CISIN_1g007025mg                   264   1e-80    Citrus sinensis [apfelsine]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             266   1e-80    Populus trichocarpa [western balsam poplar]
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             265   1e-80    Phaseolus vulgaris [French bean]
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             265   1e-80    Populus trichocarpa [western balsam poplar]
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  265   1e-80    Gossypium arboreum [tree cotton]
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    265   1e-80    Populus euphratica
gb|KDO70181.1|  hypothetical protein CISIN_1g007025mg                   263   1e-80    Citrus sinensis [apfelsine]
ref|NP_001140727.1|  uncharacterized LOC100272802                       254   2e-80    
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    265   2e-80    Elaeis guineensis
ref|XP_007033440.1|  NSP-interacting kinase 1                           266   2e-80    
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        266   2e-80    Sesamum indicum [beniseed]
tpg|DAA53257.1|  TPA: putative leucine-rich repeat receptor-like ...    259   2e-80    
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                265   3e-80    Populus tomentosa [Chinese white poplar]
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    265   3e-80    Nicotiana sylvestris
ref|XP_002886588.1|  nsp-interacting kinase 3                           265   3e-80    
dbj|BAK02609.1|  predicted protein                                      265   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             264   4e-80    
gb|AAB71968.1|  Putative Serine/Threonine protein kinase                263   5e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDP02372.1|  unnamed protein product                                264   6e-80    Coffea canephora [robusta coffee]
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        264   6e-80    Glycine soja [wild soybean]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    263   7e-80    Populus euphratica
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        264   7e-80    Tarenaya hassleriana [spider flower]
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    264   8e-80    Pyrus x bretschneideri [bai li]
ref|NP_176279.1|  NSP-interacting kinase 3                              263   9e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY44608.1|  BnaCnng11570D                                          260   9e-80    Brassica napus [oilseed rape]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    263   9e-80    Populus euphratica
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    263   9e-80    
emb|CDY61508.1|  BnaCnng37930D                                          260   1e-79    Brassica napus [oilseed rape]
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    263   1e-79    Cucumis sativus [cucumbers]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             263   1e-79    Phaseolus vulgaris [French bean]
emb|CBI16897.3|  unnamed protein product                                263   1e-79    Vitis vinifera
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    263   1e-79    Sesamum indicum [beniseed]
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        263   1e-79    Vitis vinifera
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    263   1e-79    Citrus sinensis [apfelsine]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             263   2e-79    Citrus clementina [clementine]
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    263   2e-79    Sesamum indicum [beniseed]
gb|KEH25223.1|  NSP-interacting kinase-like protein                     263   2e-79    Medicago truncatula
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    262   2e-79    Glycine max [soybeans]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    262   3e-79    Elaeis guineensis
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             261   3e-79    
gb|KJB43138.1|  hypothetical protein B456_007G186300                    262   3e-79    Gossypium raimondii
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    261   4e-79    Nicotiana sylvestris
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        261   4e-79    Prunus mume [ume]
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    261   4e-79    Nicotiana tomentosiformis
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    261   4e-79    Nicotiana tomentosiformis
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   5e-79    Populus euphratica
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   5e-79    Phoenix dactylifera
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   5e-79    Populus euphratica
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    261   5e-79    Nicotiana sylvestris
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    261   5e-79    Solanum tuberosum [potatoes]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   6e-79    Cucumis sativus [cucumbers]
gb|EEC73926.1|  hypothetical protein OsI_08784                          261   6e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        261   6e-79    Cucumis melo [Oriental melon]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    261   6e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    261   7e-79    Camelina sativa [gold-of-pleasure]
gb|EEE57731.1|  hypothetical protein OsJ_08242                          261   7e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    261   7e-79    Camelina sativa [gold-of-pleasure]
ref|XP_002514536.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    259   8e-79    
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    261   8e-79    Camelina sativa [gold-of-pleasure]
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   8e-79    Nicotiana sylvestris
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   8e-79    Oryza brachyantha
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   9e-79    Phoenix dactylifera
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        261   9e-79    Tarenaya hassleriana [spider flower]
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    260   1e-78    Nicotiana sylvestris
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    261   1e-78    Malus domestica [apple tree]
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g             260   1e-78    
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    260   1e-78    Brachypodium distachyon [annual false brome]
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    259   2e-78    
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             260   2e-78    Eutrema salsugineum [saltwater cress]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    259   2e-78    
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    260   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    260   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    259   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg             259   3e-78    Prunus persica
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    259   3e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   4e-78    
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    259   4e-78    Camelina sativa [gold-of-pleasure]
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          259   4e-78    Sorghum bicolor [broomcorn]
ref|NP_001169689.1|  LOC100383570 precursor                             259   4e-78    Zea mays [maize]
gb|ABD96908.1|  hypothetical protein                                    259   4e-78    Tarenaya spinosa
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        258   5e-78    Solanum lycopersicum
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        259   5e-78    Nicotiana tomentosiformis
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    264   5e-78    
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        258   6e-78    Fragaria vesca subsp. vesca
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   6e-78    Phoenix dactylifera
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                259   7e-78    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    259   7e-78    Tarenaya hassleriana [spider flower]
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    258   7e-78    Brassica rapa
emb|CDY46185.1|  BnaA01g23070D                                          258   7e-78    Brassica napus [oilseed rape]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   7e-78    Tarenaya hassleriana [spider flower]
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   7e-78    Elaeis guineensis
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   7e-78    Pyrus x bretschneideri [bai li]
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    258   7e-78    Brassica rapa
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        258   9e-78    Solanum lycopersicum
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   1e-77    Cicer arietinum [garbanzo]
dbj|BAJ89901.1|  predicted protein                                      257   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    258   3e-77    Setaria italica
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    256   3e-77    Brachypodium distachyon [annual false brome]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    256   3e-77    Setaria italica
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    256   4e-77    Elaeis guineensis
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        256   6e-77    
emb|CDY61461.1|  BnaC01g43240D                                          256   7e-77    Brassica napus [oilseed rape]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    255   8e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    255   1e-76    
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    255   1e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                255   1e-76    Erythranthe guttata [common monkey flower]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   254   2e-76    
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    254   3e-76    Solanum tuberosum [potatoes]
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             254   3e-76    Prunus persica
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        254   3e-76    Fragaria vesca subsp. vesca
dbj|BAB01326.1|  receptor-like kinase                                   253   6e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             254   7e-76    Capsella rubella
ref|NP_189183.2|  NSP-interacting kinase 2                              253   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    253   7e-76    
ref|NP_974360.1|  NSP-interacting kinase 2                              253   8e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876917.1|  nsp-interacting kinase 2                           253   9e-76    
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    253   9e-76    Pyrus x bretschneideri [bai li]
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    252   2e-75    Arabis alpina [alpine rockcress]
ref|NP_197104.1|  NSP-interacting kinase 1                              252   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65586.1|  receptor protein kinase-like protein                    252   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    251   2e-75    
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    252   3e-75    Camelina sativa [gold-of-pleasure]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          251   4e-75    Sorghum bicolor [broomcorn]
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    251   4e-75    Saccharum hybrid cultivar [sugarcane]
gb|KDP31451.1|  hypothetical protein JCGZ_11827                         251   4e-75    Jatropha curcas
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        251   6e-75    Camelina sativa [gold-of-pleasure]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    251   6e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60823.1|  hypothetical protein B456_009G327400                    250   6e-75    Gossypium raimondii
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    251   7e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        250   8e-75    Tarenaya hassleriana [spider flower]
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    251   9e-75    Camelina sativa [gold-of-pleasure]
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    249   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             250   2e-74    Eutrema salsugineum [saltwater cress]
gb|EPS73511.1|  hypothetical protein M569_01245                         249   2e-74    Genlisea aurea
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                249   2e-74    Erythranthe guttata [common monkey flower]
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             249   3e-74    Zea mays [maize]
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             249   3e-74    Eutrema salsugineum [saltwater cress]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    248   3e-74    Eucalyptus grandis [rose gum]
ref|XP_002871697.1|  nsp-interacting kinase 1                           249   4e-74    Arabidopsis lyrata subsp. lyrata
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    247   4e-74    
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    249   4e-74    Phoenix dactylifera
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     248   5e-74    Eucalyptus grandis [rose gum]
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        248   5e-74    Camelina sativa [gold-of-pleasure]
ref|NP_001189971.1|  NSP-interacting kinase 2                           248   8e-74    Arabidopsis thaliana [mouse-ear cress]
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...    250   9e-74    
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    247   1e-73    
ref|NP_001168791.1|  uncharacterized LOC100382590                       244   1e-73    Zea mays [maize]
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    247   1e-73    
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    247   1e-73    
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    247   1e-73    Eucalyptus grandis [rose gum]
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    247   1e-73    
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             247   1e-73    Capsella rubella
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    247   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    246   2e-73    
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        246   2e-73    
gb|AFW86330.1|  putative leucine-rich repeat receptor-like protei...    244   3e-73    
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    246   3e-73    
emb|CDY48073.1|  BnaA06g33550D                                          246   4e-73    
emb|CDX83534.1|  BnaC07g22740D                                          244   2e-72    
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    243   4e-72    
gb|ACN30679.1|  unknown                                                 243   4e-72    
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        243   6e-72    
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                    243   7e-72    
gb|ADG39068.1|  AT5G16000-like protein                                  226   2e-70    
gb|AFW76893.1|  putative leucine-rich repeat receptor-like protei...    235   2e-70    
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    238   3e-70    
gb|AEN83023.1|  AT5G16000-like protein                                  225   3e-70    
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    238   3e-70    
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   239   4e-70    
gb|AEN83026.1|  AT5G16000-like protein                                  224   1e-69    
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         237   1e-69    
gb|ACN34523.1|  unknown                                                 235   2e-69    
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    235   2e-69    
gb|ADG39062.1|  AT5G16000-like protein                                  223   3e-69    
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    236   4e-69    
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    235   5e-69    
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    235   5e-69    
ref|NP_001042146.2|  Os01g0171000                                       220   4e-68    
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                232   5e-68    
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        233   5e-68    
emb|CDY26481.1|  BnaC09g41870D                                          232   6e-68    
emb|CDX69484.1|  BnaA10g18330D                                          232   7e-68    
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...    230   3e-67    
dbj|BAF79962.1|  receptor-like kinase                                   228   2e-66    
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1         228   2e-66    
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...    227   5e-66    
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    226   2e-65    
ref|XP_010277988.1|  PREDICTED: probable LRR receptor-like serine...    224   3e-65    
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...    224   1e-64    
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...    223   2e-64    
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...    218   1e-63    
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1         221   1e-63    
ref|XP_008664639.1|  PREDICTED: probable LRR receptor-like serine...    220   2e-63    
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein     217   2e-63    
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                     219   3e-63    
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    220   3e-63    
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                     219   3e-63    
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                     219   3e-63    
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                     219   3e-63    
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                     219   3e-63    
ref|XP_006845438.1|  hypothetical protein AMTR_s00019p00103320          219   4e-63    
gb|EPS59992.1|  hypothetical protein M569_14812                         217   7e-63    
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...    219   1e-62    
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...    219   1e-62    
ref|XP_008664635.1|  PREDICTED: probable LRR receptor-like serine...    219   1e-62    
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...    218   2e-62    
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...    214   2e-62    
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...    219   3e-62    
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...    217   4e-62    
ref|NP_001057376.1|  Os06g0274500                                       217   4e-62    
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...    219   4e-62    
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...    216   6e-62    
ref|NP_001061919.1|  Os08g0442700                                       217   6e-62    
emb|CDX78667.1|  BnaA03g05790D                                          218   7e-62    
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...    216   7e-62    
ref|XP_002325107.1|  leucine-rich repeat family protein                 216   9e-62    
dbj|BAJ91470.1|  predicted protein                                      216   1e-61    
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...    216   1e-61    
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...    215   1e-61    
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...    215   1e-61    
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...    215   2e-61    
emb|CDX70667.1|  BnaC03g07510D                                          216   2e-61    
ref|XP_007225632.1|  hypothetical protein PRUPE_ppa003371mg             213   3e-61    
gb|EAZ07144.1|  hypothetical protein OsI_29394                          215   4e-61    
emb|CDP02874.1|  unnamed protein product                                214   4e-61    
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          215   4e-61    
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...    214   4e-61    
ref|XP_002965655.1|  hypothetical protein SELMODRAFT_167872             213   4e-61    
ref|XP_002971685.1|  hypothetical protein SELMODRAFT_172211             213   5e-61    
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1         214   6e-61    
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...    214   6e-61    
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...    214   7e-61    
gb|AFW62720.1|  putative leucine-rich repeat receptor-like protei...    201   8e-61    
gb|KDO62317.1|  hypothetical protein CISIN_1g039819mg                   211   8e-61    
gb|EAZ42894.1|  hypothetical protein OsJ_27488                          215   9e-61    
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...    213   1e-60    
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    213   1e-60    
gb|KDP38737.1|  hypothetical protein JCGZ_04090                         213   2e-60    
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...    212   2e-60    
ref|XP_002309372.1|  leucine-rich repeat family protein                 212   2e-60    
ref|XP_010059023.1|  PREDICTED: probable LRR receptor-like serine...    209   2e-60    
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    211   3e-60    
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg             211   4e-60    
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    211   4e-60    
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...    211   5e-60    
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...    211   7e-60    
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...    211   7e-60    
ref|XP_001756895.1|  predicted protein                                  209   9e-60    
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...    210   1e-59    
emb|CAN63294.1|  hypothetical protein VITISV_040285                     210   1e-59    
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                     209   2e-59    
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...    209   3e-59    
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...    209   3e-59    
gb|ADT91694.1|  somatic embryogenesis receptor-like kinase 1            199   3e-59    
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...    209   3e-59    
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...    208   6e-59    
ref|XP_010274437.1|  PREDICTED: probable LRR receptor-like serine...    208   7e-59    
ref|XP_001785606.1|  predicted protein                                  207   8e-59    
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...    208   9e-59    
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...    208   9e-59    
gb|KJB53859.1|  hypothetical protein B456_009G008400                    207   1e-58    
ref|XP_010274436.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-58    
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             207   1e-58    
gb|AGS80343.1|  somatic embryogenesis receptor kinase 1                 207   1e-58    
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg             207   1e-58    
gb|ACZ56417.1|  somatic embryogenesis receptor-like kinase 1            207   1e-58    
gb|ACY91853.1|  somatic embryogenesis receptor-like kinase 1            207   1e-58    
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...    208   1e-58    
ref|XP_010274435.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-58    
gb|AAC63680.1|  putative LRR receptor protein kinase                    207   1e-58    
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...    207   1e-58    
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...    207   2e-58    
ref|XP_001767678.1|  predicted protein                                  207   2e-58    
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...    207   2e-58    
ref|XP_001759122.1|  predicted protein                                  206   2e-58    
ref|XP_008366037.1|  PREDICTED: probable LRR receptor-like serine...    197   2e-58    
ref|XP_002533758.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    202   2e-58    
gb|KEH32608.1|  LRR receptor-like kinase                                205   3e-58    
gb|KDP21117.1|  hypothetical protein JCGZ_21588                         205   3e-58    
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    206   3e-58    
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein     206   3e-58    
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase         206   5e-58    
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590             205   6e-58    
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356             205   6e-58    
ref|XP_001763339.1|  predicted protein                                  204   7e-58    
gb|AET86626.2|  somatic embryogenesis receptor kinase 1                 198   7e-58    
gb|KHG18235.1|  hypothetical protein F383_07279                         205   7e-58    
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...    205   9e-58    
gb|ADW65656.1|  somatic embryogenesis receptor kinase 1                 199   9e-58    
emb|CDY39685.1|  BnaA04g14020D                                          205   1e-57    
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...    205   1e-57    
emb|CDY65182.1|  BnaC04g56200D                                          205   1e-57    
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...    205   1e-57    
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg             205   1e-57    
ref|XP_002880534.1|  leucine-rich repeat family protein                 205   1e-57    
ref|XP_002305735.1|  leucine-rich repeat transmembrane protein ki...    204   1e-57    
gb|AIA99455.1|  putative somatic embryogenesis receptor kinase          204   1e-57    
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-57    
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-57    
gb|KDO83985.1|  hypothetical protein CISIN_1g007020mg                   201   3e-57    
ref|XP_004149147.1|  PREDICTED: somatic embryogenesis receptor ki...    203   3e-57    
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...    203   3e-57    
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg                202   3e-57    
ref|XP_010530140.1|  PREDICTED: somatic embryogenesis receptor ki...    203   3e-57    
gb|AHI59639.1|  somatic embryogenesis receptor-like kinase              203   3e-57    
ref|XP_002867342.1|  predicted protein                                  204   4e-57    
ref|XP_009591346.1|  PREDICTED: somatic embryogenesis receptor ki...    198   4e-57    
emb|CDX72249.1|  BnaC07g42710D                                          203   4e-57    
ref|XP_007020221.1|  Somatic embryogenesis receptor-like kinase 1...    200   5e-57    
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...    202   5e-57    
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...    203   5e-57    
ref|XP_002978309.1|  hypothetical protein SELMODRAFT_268158             202   6e-57    
gb|KDP35227.1|  hypothetical protein JCGZ_09386                         202   6e-57    
ref|XP_008453749.1|  PREDICTED: somatic embryogenesis receptor ki...    202   6e-57    
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg             202   7e-57    
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...    203   7e-57    
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...    203   7e-57    
emb|CAB79770.1|  receptor-like kinase homolog                           201   8e-57    
gb|ACM89547.1|  somatic embryogenesis receptor kinase                   198   8e-57    
ref|XP_002966264.1|  hypothetical protein SELMODRAFT_85471              202   8e-57    
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...    202   8e-57    
ref|XP_009105842.1|  PREDICTED: somatic embryogenesis receptor ki...    202   9e-57    
gb|KHG07759.1|  hypothetical protein F383_34545                         202   9e-57    
emb|CDX72833.1|  BnaC06g32810D                                          202   9e-57    
gb|AFO67896.1|  leucine-rich repeat receptor-like kinase                202   9e-57    
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...    202   1e-56    
gb|KJB69704.1|  hypothetical protein B456_011G038400                    201   1e-56    
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein      202   1e-56    
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg             202   1e-56    
gb|EPS63998.1|  somatic embryogenesis receptor-like kinase 1            202   1e-56    
gb|KJB69703.1|  hypothetical protein B456_011G038400                    202   1e-56    
gb|KJB69702.1|  hypothetical protein B456_011G038400                    202   1e-56    
ref|XP_010999766.1|  PREDICTED: probable LRR receptor-like serine...    201   1e-56    
gb|EMS65008.1|  Somatic embryogenesis receptor kinase 2                 200   1e-56    
emb|CDP01160.1|  unnamed protein product                                202   1e-56    
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein      201   1e-56    
ref|XP_010543171.1|  PREDICTED: somatic embryogenesis receptor ki...    202   1e-56    
ref|XP_010939572.1|  PREDICTED: somatic embryogenesis receptor ki...    201   2e-56    
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...    201   2e-56    
gb|KJB76635.1|  hypothetical protein B456_012G097800                    201   2e-56    
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein      201   2e-56    
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    202   2e-56    
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...    201   2e-56    
ref|XP_004162174.1|  PREDICTED: somatic embryogenesis receptor ki...    199   2e-56    
ref|NP_194781.2|  senescence-associated receptor-like kinase            202   2e-56    
gb|KHN17525.1|  Putative LRR receptor-like serine/threonine-prote...    201   2e-56    
emb|CAM31941.1|  hypothetical protein                                   201   2e-56    
gb|AFQ07900.1|  somatic embryogenesis receptor-like kinase              192   2e-56    
ref|XP_010999763.1|  PREDICTED: probable LRR receptor-like serine...    201   2e-56    
dbj|BAD32780.1|  somatic embryogenesis receptor kinase 1                201   2e-56    
ref|XP_003549524.2|  PREDICTED: probable LRR receptor-like serine...    201   2e-56    
ref|NP_001275800.1|  somatic embryogenesis receptor-like kinase p...    201   2e-56    
gb|EMS66270.1|  Somatic embryogenesis receptor kinase 1                 197   2e-56    
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase              201   2e-56    
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
gb|ABK25941.1|  unknown                                                 189   3e-56    
ref|XP_010471192.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_010415894.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_011074139.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_007201734.1|  hypothetical protein PRUPE_ppa002871mg             201   3e-56    
ref|XP_009104891.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_006300879.1|  hypothetical protein CARUB_v10019969mg             201   3e-56    
ref|XP_010063800.1|  PREDICTED: somatic embryogenesis receptor ki...    200   3e-56    
ref|XP_002276414.2|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_004496399.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
emb|CDY36679.1|  BnaCnng07810D                                          201   3e-56    
ref|XP_010428030.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|XP_003556185.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
gb|EYU43606.1|  hypothetical protein MIMGU_mgv1a021039mg                199   3e-56    
ref|XP_008245841.1|  PREDICTED: somatic embryogenesis receptor ki...    201   3e-56    
ref|NP_001237909.1|  somatic embryogenesis receptor-like kinase-l...    199   4e-56    
gb|AAK82463.1|  At1g71830/F14O23_24                                     201   4e-56    
ref|NP_177328.1|  somatic embryogenesis receptor kinase 1               201   4e-56    
gb|AAF43236.1|AC012654_20  Contains similarity to the somatic emb...    200   4e-56    
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...    200   4e-56    



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score =   342 bits (878),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/166 (99%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD
Sbjct  67   HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  126

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG
Sbjct  127  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  186

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQRNDTPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  187  LAEKWEASQRNDTPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  232



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 165/166 (99%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD
Sbjct  462  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG
Sbjct  522  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  581

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQRNDTPR+RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  582  LAEKWEASQRNDTPRYRTHENTPQRYSDFIEESSLIVEAMELSGPR  627



>ref|XP_004159592.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like, partial [Cucumis 
sativus]
Length=235

 Score =   313 bits (801),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LD
Sbjct  70   HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLD  129

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  130  WVKKLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  189

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  190  LAEKWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  235



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   318 bits (815),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  443  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  502

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDG
Sbjct  503  WVKKLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDG  562

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  563  LAEKWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  608



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLKNNFDRVELEEMV+VALLCTQFNPSHRPKMSE+LRMLEGDG
Sbjct  521  WVKKLHQEGKLNLMVDKDLKNNFDRVELEEMVKVALLCTQFNPSHRPKMSEILRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQKVETPRFRSCENPPQRYSDYIEESSLVIEAMELSGPR  626



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVKTLHQE KLNLMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDG
Sbjct  521  WVKTLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  581  LAEKWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGVILD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGTNQKGVILD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLKN+FDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG
Sbjct  520  WVKKLHQEGKLNLMVDKDLKNDFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWE SQ  +TPR+R+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  580  LAEKWEQSQNIETPRYRSFEHPPQRYSDFIEESSLVVEAMELSGPR  625



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KLNLMVDKDLKN+FDR+ELEEMVQVALLCT F+PSHRPKMSEVLRMLEGDG
Sbjct  521  WVKKLHQEKKLNLMVDKDLKNSFDRIELEEMVQVALLCTHFSPSHRPKMSEVLRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  581  LAEKWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  287  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  346

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH + KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  347  WVKKLHHDRKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  406

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  407  LAEKWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  452



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  453  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  512

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNL+VDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  513  WVKKLHQEGKLNLLVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  572

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  573  LAEKWEASQKIETPRFRSCESHPQRYSDFIEESSLVVEAMELSGPR  618



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  516  WVKKLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  576  LAEKWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  516  WVKKLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  576  LAEKWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   313 bits (801),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+LD
Sbjct  444  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGANQKGVMLD  503

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN+MVDKDLK NFDRVELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  504  WVKKLHQEGKLNMMVDKDLKGNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  563

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPR R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  564  LAEKWEASQHIETPRCRPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   313 bits (802),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLEGDG
Sbjct  521  WVKKLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  626



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNL+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLNLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR R+ EN PQRYSDFIEESSL+VEAMELSGPR
Sbjct  581  LAEKWEASQKIETPRLRSCENHPQRYSDFIEESSLVVEAMELSGPR  626



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH E KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  523  WVKKLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  583  LAEKWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  628



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQKA+DFGR ANQKGV+LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQKALDFGRAANQKGVMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH E KLNLMVDKDL+ NFDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  519  WVKKLHHERKLNLMVDKDLRGNFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPRFR+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  579  LAEKWEASQRVETPRFRSCENPPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 3/169 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  283  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  342

Query  500  WV---KTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLE  330
            WV   K LHQEGKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNPSHRP+MSEVLRMLE
Sbjct  343  WVLSVKKLHQEGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPSHRPRMSEVLRMLE  402

Query  329  GDGLAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            GDGLAEKWEASQ+ +TPRFR+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  403  GDGLAEKWEASQKVETPRFRSCDNPPQRYSDFIEESSLVIEAMELSGPR  451



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRG NQKGV+LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGVNQKGVMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH E KLNLMVDKDLKNNFDR+ELEEMVQVALLCTQF P++RPKMSEVLRMLEGDG
Sbjct  517  WVKKLHAEKKLNLMVDKDLKNNFDRIELEEMVQVALLCTQFIPTYRPKMSEVLRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  577  LAEKWEASQKVETPRYRTSENTPKRYSDYIEESSLVVEAMELSGPR  622



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  581  LAEKWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  626



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  524  WVKKLHQEGKLNLMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPRFR+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  584  LAEKWEASQGVETPRFRSCEHPPQRYSDFIDESSLVVEAMELSGPR  629



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   309 bits (791),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A QKGV+LD
Sbjct  472  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRQAKQKGVMLD  531

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKD+K NFDRVELEEMVQ+ALLCTQFNPSHRPKMS+VL+MLEGDG
Sbjct  532  WVKKLHQEGKLNLMVDKDIKGNFDRVELEEMVQIALLCTQFNPSHRPKMSDVLKMLEGDG  591

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR R+ EN PQRYSDFIEESSL++EAMELSGPR
Sbjct  592  LAEKWEASQKVETPRIRSCENPPQRYSDFIEESSLVIEAMELSGPR  637



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+ KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  580  LAEKWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  625



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHI+PEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  457  HVTTAVRGTVGHISPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+ KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  517  WVKKLHQDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  577  LAEKWEASQKVETPRFRSCENPPQKYSDFIEESSLVVEAMELSGPR  622



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  395  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  454

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  455  WVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  514

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  515  LAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  394  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  453

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  454  WVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  513

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  514  LAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  559



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  395  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  454

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  455  WVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  514

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  515  LAEKWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TA+RGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LD
Sbjct  417  HVTTAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLD  476

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDG
Sbjct  477  WVKKLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDG  536

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  537  LAEKWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  582



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TA+RGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  +QKGV+LD
Sbjct  461  HVTTAIRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAVSQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDK L NNFDRVELEEMV+VALLCTQF+PS RPKMSEVLRMLEGDG
Sbjct  521  WVKKLHQEGKLNLMVDKCLNNNFDRVELEEMVKVALLCTQFHPSQRPKMSEVLRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPR R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  581  LAEKWEASQRAETPRLRSSENLPQRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN MVDK L NNFDRVELEEMVQVALLCTQF+PS RPKM EVLRMLEGDG
Sbjct  523  WVKKLHQEGKLNQMVDKCLNNNFDRVELEEMVQVALLCTQFHPSQRPKMCEVLRMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E  PQRYSDFIEESSL+VEAMELSGPR
Sbjct  583  LAEKWEASQKVETPRFRSSETMPQRYSDFIEESSLVVEAMELSGPR  628



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  491  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  550

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  551  WVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  610

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  611  LAEKWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  656



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  490  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  549

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGK+NLMVDKDLK NFDRVELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  550  WVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  609

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  610  LAEKWEASQKIETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR  655



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  459  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH + KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  519  WVKKLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  579  LAEKWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  624



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   303 bits (775),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  462  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH + KLNLMVDKDL+  FDR+ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  522  WVKKLHHDRKLNLMVDKDLRGKFDRIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  581

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  582  LAEKWEASQKVETPRFRSCENPAQKYSDFIEESSLVVEAMELSGPR  627



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGA QKG++LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGAKQKGIMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+ KL LMVDKDLKN++D VELEEMVQVALLCT FNPS+RPKMSEVLRMLEGDG
Sbjct  519  WVKKLHQDAKLELMVDKDLKNDYDNVELEEMVQVALLCTVFNPSNRPKMSEVLRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +TPRFRT E+ PQRYSD+IEESSL+VEAMELSGPR
Sbjct  579  LAEKWEASQTIETPRFRTFEHIPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFG+GILLLELITG KA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGYGILLLELITGHKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH EGKL+ MVDKDLK NFD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHLEGKLSQMVDKDLKGNFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  580  LAEKWEASQRIETPRFRFCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  465  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  524

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  525  WVKKLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  584

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  585  LAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  630



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  526

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  527  WVKKLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  586

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  587  LAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  632



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  466  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  525

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDLK N DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  526  WVKKLHQEGKLNLMVDKDLKGNIDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  585

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  586  LAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVVEAMELSGPR  631



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   300 bits (767),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 3/166 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL+ MVDKDLK NFDR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLSQMVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 3/169 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITG KAVDFGRGANQKGVILD
Sbjct  460  HVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDK+LK++FD +ELEEMVQVALLCT FNP+HRPKMSEVLRMLEGDG
Sbjct  520  WVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQVALLCTHFNPTHRPKMSEVLRMLEGDG  579

Query  320  LAEKWEASQRNDTPRF---RTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWE SQ+ DTPR+   R+ +N PQRYSD+IEESSL+VE MELSGPR
Sbjct  580  LAEKWEQSQKVDTPRYNNSRSFQNLPQRYSDYIEESSLVVEDMELSGPR  628



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LD
Sbjct  408  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLD  467

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH E KLNLMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDG
Sbjct  468  WVKKLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDG  527

Query  320  LAEKWEASQR--NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+    TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  528  LAEKWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  575



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   298 bits (762),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAV+FGRGANQKGV+LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVEFGRGANQKGVMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH E KLNLMVDKDLKNNFD +ELEEMVQVALLCT F P++RPKMSEVLRMLEGDG
Sbjct  516  WVKKLHVEKKLNLMVDKDLKNNFDGIELEEMVQVALLCTHFIPTYRPKMSEVLRMLEGDG  575

Query  320  LAEKWEASQR--NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+    TPRF T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  576  LAEKWEASQKVETPTPRFTTSENTPKRYSDYIQESSLVVEAMELSGPR  623



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   298 bits (762),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH EG+L+ MVDKDLK  FD VEL EMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHLEGRLSQMVDKDLKGIFDIVELGEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  580  LAERWEASQRIETPRFRLCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  580  LAERWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  580  LAERWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  520  WVKKLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR+ E  PQRYSD IEESSLIVEAMELSGPR
Sbjct  580  LAERWEASQRIETPRFRSCE--PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 156/167 (93%), Gaps = 2/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-L  504
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ L
Sbjct  436  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVML  495

Query  503  DWVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD  324
            DWVK LHQEGK NLMVDKDLKNNFDR+ELEEMV+VALLCTQFNPSHRPKMSE LRMLEGD
Sbjct  496  DWVKELHQEGKSNLMVDKDLKNNFDRIELEEMVKVALLCTQFNPSHRPKMSEALRMLEGD  555

Query  323  GLAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            GLAEKWEASQ+ + PR R  E+TPQRYS+++EESSL VE MELSGPR
Sbjct  556  GLAEKWEASQKLEAPRNRAFEHTPQRYSNYVEESSL-VEPMELSGPR  601



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  581  LAERWEASQRIETPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG KA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+G+L+ MVDKDLK NFD +ELEEMVQVALLCTQFNPSHRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQDGRLSQMVDKDLKGNFDLIELEEMVQVALLCTQFNPSHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +TPRFR+ E  PQRYSD IEESSL+VEAMELSGPR
Sbjct  581  LAERWEASQRIETPRFRSCE--PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 3/166 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL+ MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+GKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDG
Sbjct  521  WVKKLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ   T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 3/166 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQ+GV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRAANQRGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL+ MVDKDLK   DR+ELEEMVQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLSQMVDKDLKGKLDRIELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPR+RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  581  LAEKWEASQKIETPRYRTHE---KRYSDFIEESSLVIEAMELSGPR  623



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   295 bits (755),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRAANQKGVMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQ+GKL+L+VDKDLK NFDR+ELEEMVQVALLCTQFNP HRP+MSEVLRMLEGDG
Sbjct  518  WVKKLHQDGKLSLLVDKDLKGNFDRIELEEMVQVALLCTQFNPLHRPRMSEVLRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRT--HENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ   T + R+  ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  578  LAEKWEASQMIKTLKLRSCDNDNPPQRYSDFIEESSLVLEAMELSGPR  625



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 156/167 (93%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGR ANQKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRLANQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KLNLMVDKDLKNNFDRVELEEMV+VALLCTQF+P+ RPKMSEV+RMLEGDG
Sbjct  523  WVKKLHQEKKLNLMVDKDLKNNFDRVELEEMVRVALLCTQFHPACRPKMSEVVRMLEGDG  582

Query  320  LAEKWEASQRN-DTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+  +TPRFR  E  P++YSD IEESSL+VEAMELSGPR
Sbjct  583  LAEKWEASQQKVETPRFRGSEFFPRKYSDLIEESSLVVEAMELSGPR  629



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYL TGQSSEKTDVFG+GILLLELITGQKA+DFGR +NQKGV+LD
Sbjct  458  HVTTAVRGTIGHIAPEYLCTGQSSEKTDVFGYGILLLELITGQKAIDFGRASNQKGVMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LH EGKLN +VDKDLKNN+DRVEL EMVQVALLCTQFNP HRPKMS+VLRMLE DG
Sbjct  518  WVKKLHTEGKLNQLVDKDLKNNYDRVELGEMVQVALLCTQFNPLHRPKMSDVLRMLEDDG  577

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKW+ASQR++TPR R+ E  PQRYSD+IEESSL+VEAMELSGPR
Sbjct  578  LAEKWDASQRSETPRSRSSE--PQRYSDYIEESSLVVEAMELSGPR  621



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL +MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDG
Sbjct  524  WVKKLHQENKLRVMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TP+ R+ E  P +Y DF+E+SSL+VEA+ELSGPR
Sbjct  584  LAEKWEASQKIETPKSRSCEQPPPKYLDFVEDSSLVVEAIELSGPR  629



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 1/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LD
Sbjct  466  HVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLD  525

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  526  WVKKLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  585

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  586  LAEKWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  630



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 1/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LD
Sbjct  465  HVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLD  524

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  525  WVKKLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  584

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  585  LAEKWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  629



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 1/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HVSTAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LD
Sbjct  464  HVSTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALDFGRVANQKGVMLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLNLMVDKDL+   DRVELEEMVQVALLCTQFNP +RPKMSEVL+MLEGDG
Sbjct  524  WVKKLHQEGKLNLMVDKDLRGKLDRVELEEMVQVALLCTQFNPLYRPKMSEVLKMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR  +   QRYSDFIEESSL++EAMELSGPR
Sbjct  584  LAEKWEASQKVETPRFRPCDPR-QRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL++MVDKDLKNN+DRVELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDG
Sbjct  524  WVKKLHQENKLSMMVDKDLKNNYDRVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ D P+  + E  P RY DF+EESSL+V+A+ELSGPR
Sbjct  584  LAEKWEASQKIDAPKSLSSEQPPPRYLDFVEESSLVVDAIELSGPR  629



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 2/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-L  504
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ L
Sbjct  435  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVML  494

Query  503  DWVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD  324
            DWV+ LHQE KLNLMVD +LKNNFD++ELEEMV+VALLCT FNPSHRPKMSE LRMLEGD
Sbjct  495  DWVRNLHQEEKLNLMVDSNLKNNFDQIELEEMVKVALLCTHFNPSHRPKMSEALRMLEGD  554

Query  323  GLAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            GLAEKWEASQ+ +TPR R  E+TPQRYS+F+E+SSL VE MELSGPR
Sbjct  555  GLAEKWEASQKLETPRNRAFEHTPQRYSNFVEDSSL-VEPMELSGPR  600



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LLLELITGQKA+DFGR ANQKGV+LD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLLELITGQKALDFGRLANQKGVMLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL++MVDKDLKNN+D VELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDG
Sbjct  524  WVKKLHQENKLSMMVDKDLKNNYDSVELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ DTP+  + E  P +Y DF+EESSL+V+A+ELSGPR
Sbjct  584  LAEKWEASQKTDTPKSLSSEQPPPKYLDFVEESSLVVDAIELSGPR  629



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LD
Sbjct  478  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLD  537

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL++MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDG
Sbjct  538  WVKRLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDG  597

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ DTP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  598  LAEKWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  643



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRVANQKGVMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV  LH++GKLN +VDKDL  NFDR+ELEEMV+V+LLCT+FNP  RPKMSEVLRMLEGDG
Sbjct  516  WVNKLHKDGKLNQLVDKDLGVNFDRIELEEMVKVSLLCTKFNPLERPKMSEVLRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +TPRFR+ EN   RYSDFIEESSL+VEAMELSGPR
Sbjct  576  LAEKWEASQKVETPRFRSCENPTPRYSDFIEESSLVVEAMELSGPR  621



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFGR ANQKGV+LD
Sbjct  484  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGRLANQKGVMLD  543

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL++MVDKDL+NN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDG
Sbjct  544  WVKRLHQENKLSMMVDKDLRNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDG  603

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ DTP+  + E  P ++SD++E+SSL+VEA+ELSGPR
Sbjct  604  LAEKWEASQKVDTPKSGSSEQAPPKHSDYVEDSSLVVEAIELSGPR  649



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  442  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLD  501

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +LN+MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDG
Sbjct  502  WVKKLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDG  561

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            L E W+A Q+ DTP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  562  LVESWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  607



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ANQKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLANQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +LN+MVDKDLKNN+DRVELEEMVQVALLCTQF+PSHRPKMSEV+RMLEGDG
Sbjct  521  WVKKLHQENRLNIMVDKDLKNNYDRVELEEMVQVALLCTQFHPSHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            L E W+A Q+ DTP+ R+ E    +Y DF+E+SSL++EA+ELSGPR
Sbjct  581  LVESWDALQKMDTPKCRSLERQSPKYVDFMEDSSLVLEAIELSGPR  626



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   283 bits (724),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LD
Sbjct  494  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLD  553

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDG
Sbjct  554  WVKKLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDG  613

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR DTP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  614  LAEKWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  659



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR  NQKGV+LD
Sbjct  500  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRLTNQKGVMLD  559

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL +MVDKDLKNN++RVELEEM+QVALLCTQF+PS RPKMSEV+RMLEGDG
Sbjct  560  WVKKLHQENKLYMMVDKDLKNNYNRVELEEMIQVALLCTQFHPSQRPKMSEVVRMLEGDG  619

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR DTP+ R+ E    +Y DF+E+SS +VEA+ELSGPR
Sbjct  620  LAEKWEASQRMDTPKSRSSEQLTPKYIDFMEDSSFVVEAIELSGPR  665



>ref|XP_006844161.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+L+VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKLDLLVDKDLKINYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR+DT +FR  + + +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAERWEASQRSDTSKFRGSDLSSERYSDLTDDSSLLAQAMELSGPR  620



>ref|XP_010261784.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nelumbo 
nucifera]
Length=550

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LD
Sbjct  384  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLD  443

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+ +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  444  WVKKIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  503

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  504  LAERWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  550



>ref|XP_003637897.1| Receptor-like kinase [Medicago truncatula]
Length=496

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  330  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  389

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  390  WVKKIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  449

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  450  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  496



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  449  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLD  508

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +LN+MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  509  WVKKLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDG  568

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  569  LAEKWEASQNVDTPKSVSSEILPPKYMDFAADESSLGLEAMELSGPR  615



>ref|XP_010261776.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALDFGKAANQKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+ +VDKD+KNN+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLDALVDKDMKNNYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LAERWEASQRAEATKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVI-L  504
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGRGANQKGV+ L
Sbjct  438  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAMDFGRGANQKGVVML  497

Query  503  DWVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD  324
            DWV+ LHQE KLNLMVD +L+N+F+R+ELEEMV+VALLCT FNP HRPKMSE LRMLEGD
Sbjct  498  DWVRKLHQEDKLNLMVDSNLRNSFERIELEEMVKVALLCTHFNPCHRPKMSEALRMLEGD  557

Query  323  GLAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            GLAE+W ASQ  +T R R  E TPQ YSD++++SSL VE MELSGPR
Sbjct  558  GLAEQWAASQNLETRRKRAFEPTPQTYSDYVQDSSL-VEPMELSGPR  603



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDMLVDKDLKDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +T + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRAETTKCKPHEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_011070875.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Sesamum indicum]
Length=623

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDL+NN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLDMLVDKDLRNNYDRIELEEMVQVALLCTQYLPNHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LAEKWEASQRAEVTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  443  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  502

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  503  WVKKIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  562

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEA+QR +  R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  563  LAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  609



>emb|CDP00520.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKN++DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLELLVDKDLKNSYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LAEKWEASQRAEATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQF PSHRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQFLPSHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRAESTKSKLHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  519  WVKKIHQEKKLDMLVDKDLKANYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEA+QR +  R + +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  579  LAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR  625



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   271 bits (693),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLK+N+D++ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  520  WVKKIHQEKKLELLVDKDLKSNYDKIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ DT +F+  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  580  LAERWEASQKTDTSKFKHQESSLSDRYSDLTDDSLLLVQAMELSGPR  626



>ref|XP_008446509.1| PREDICTED: protein NSP-INTERACTING KINASE 2 isoform X3 [Cucumis 
melo]
Length=510

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LD
Sbjct  344  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLD  403

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDG
Sbjct  404  WVKKIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDG  463

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  464  LAEKWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  510



>ref|XP_004171526.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like, partial [Cucumis sativus]
Length=287

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  121  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILD  180

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRP MSEV+RMLEG+G
Sbjct  181  WVKRIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPXMSEVVRMLEGEG  240

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LA +WEASQR D+ + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  241  LAVRWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  287



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  344  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  403

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  404  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  463

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  464  LAEKWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLKN++DR+ELEE VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDMLVDKDLKNDYDRIELEETVQVALLCTQYLPSHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR + P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRAEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  416  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  475

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDG
Sbjct  476  WVKKIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDG  535

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  536  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  582



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  344  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  403

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  404  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  463

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  464  LAEKWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  510



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLD  526

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDG
Sbjct  527  WVKKLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDG  586

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P +Y DF  +ESSL +EAMELSGPR
Sbjct  587  LAEKWEASQNVDTPKSVSSELLPPKYMDFAADESSLGLEAMELSGPR  633



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  424  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRIANQKGGVLD  483

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDG
Sbjct  484  WVKKLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDG  543

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  544  LAEKWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  590



>gb|KEH17048.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=558

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  392  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  451

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  452  WVKKIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  511

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  512  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  558



>ref|XP_004490300.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cicer arietinum]
Length=622

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  576  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  622



>gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEE+VQVALLCTQF PSHRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLEMLVDKDLKANYDRIELEEIVQVALLCTQFLPSHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRVEATKPKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKN++DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKIDLLVDKDLKNHYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLTQAMELSGPR  621



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +L++MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDG
Sbjct  522  WVKKLHQEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDG  581

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ DF  +ESSL +EAMELSGPR
Sbjct  582  LAEKWEASQNVDTPKSVSSELLPPKFMDFAADESSLGLEAMELSGPR  628



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+++G+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEYGKAANQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHHEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPAHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PS+RPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSYRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+DFG+ ANQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIDFGKAANQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK ++QE KL ++VDKDLKNN+D +ELEE+VQVALLCTQF P+ RP+MSEV+RMLEGDG
Sbjct  521  WVKKINQEKKLEMLVDKDLKNNYDSIELEEIVQVALLCTQFLPNQRPRMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D+ R R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581  LAEKWEASQRADSTRSRVTEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++L+VDKDLKNN+DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKIDLLVDKDLKNNYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQSAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAEKWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_008446507.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X1 [Cucumis 
melo]
Length=624

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578  LAEKWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>ref|XP_008446508.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Cucumis 
melo]
Length=622

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLELLVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  576  LAEKWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  622



>ref|XP_003552626.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Glycine 
max]
 ref|XP_006602982.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Glycine 
max]
Length=623

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  577  LAEKWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAEKWEASQRAEETRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=621

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKGV+LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGVMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL+L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  LAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>gb|KHN13790.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  577  LAEKWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_006605000.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=230

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  665  VRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKTL  486
            VRGTVG+IAPEYLS GQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LDWV+ L
Sbjct  68   VRGTVGYIAPEYLSRGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLDWVRKL  127

Query  485  HQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDGLAEKW  306
            HQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMS+V+RMLEGDGLAEKW
Sbjct  128  HQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSDVVRMLEGDGLAEKW  187

Query  305  EASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGP  186
            EASQ  DT + +  E ++  RYSD I++SSL+V+AMELSGP
Sbjct  188  EASQSADTTKCKPQELSSSDRYSDLIDDSSLLVQAMELSGP  228



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  434  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  493

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  494  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  553

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  554  LAEKWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  600



>ref|XP_004135130.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 ref|XP_004155284.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52017.1| hypothetical protein Csa_5G608050 [Cucumis sativus]
Length=623

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFG+GILLLELITGQ+A++FG+  NQKG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGYGILLLELITGQRALEFGKAVNQKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDL++N+DR+ELEEMVQVALLCTQ+ P+ RPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEILVDKDLRSNYDRIELEEMVQVALLCTQYLPTTRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D  R+R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  577  LAEKWEASQRADANRYRVNEFSSSERYSDLTDDSSLLAQAMELSGPR  623



>gb|KJB43139.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=475

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  308  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  367

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  368  WVRKIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  427

Query  320  LAEKWEASQRNDTPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  428  LAERWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  475



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  453  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  512

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  513  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  572

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  573  LAEKWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  619



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT   +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQSADTSNCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>gb|KEH17047.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=621

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE K++++VDKDLKN +DR+EL+E+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKIDVLVDKDLKNKYDRIELDEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQRAESTRSRGNELSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ LHQE KL L+VDKDLK N+DR+ELEE+VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVRKLHQEKKLELLVDKDLKTNYDRIELEEIVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQSADTTKCKPQELSSSDRYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  + R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAEKWEASQRAEETKSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 151/169 (89%), Gaps = 3/169 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+EL+EMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLELLVDKDLKNNYDRIELDEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRN--DTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LA+KWEASQ+N  +T + + HE ++  RYSD  ++SSL+++AMELSGPR
Sbjct  578  LADKWEASQKNVDNTTKCKQHELSSSDRYSDLTDDSSLLIQAMELSGPR  626



>ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis]
Length=624

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE KL+L+V+KDLK+N+DR+E+EEMVQVAL+CTQ++PSHRPKMSEV+RMLEGDG
Sbjct  518  WVKKIQQEKKLDLLVNKDLKDNYDRIEVEEMVQVALICTQYHPSHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_008465988.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis melo]
Length=623

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E + +RYSD  ++SSL  +A+ELSGPR
Sbjct  578  LAEKWEASQRAEASRSRANEFSSERYSDLTDDSSLFAQAIELSGPR  623



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDL++N+DR+ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  523  WVKKIHQEKKLEMLVDKDLRSNYDRIELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583  LAERWEASQRVESNKGKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_006348615.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=621

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG++LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGIMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL+L+V KDLK+ +DR+ELEEMVQVAL+CTQ++PSHRPK+SEV+RMLEGDG
Sbjct  515  WVKKIHLEKKLDLLVSKDLKDKYDRIELEEMVQVALICTQYHPSHRPKISEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  LAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  518  WVRKVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|KDO70180.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=552

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  386  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLD  445

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  446  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDG  505

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  506  LAEKWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  552



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDG
Sbjct  521  WVKKIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR DT +++  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  577  LAERWEASQRVDTTKYKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ PSHRPKMSEV+RMLEGDG
Sbjct  520  WVKKIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPSHRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG ILD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL+++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  518  WVRKVHQEKKLDMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+ELEE+VQVALLC Q+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHQEKKLELLVDKDLKNNYDRIELEEIVQVALLCIQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAEKWEASQRAEETRSRANEFSSSERYSDMTDDSSLLVQAMELSGPR  622



>gb|KDO70181.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=549

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  383  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLD  442

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  443  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDG  502

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  503  LAEKWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  549



>ref|NP_001140727.1| uncharacterized LOC100272802 [Zea mays]
 gb|ACF84475.1| unknown [Zea mays]
 gb|ACR35282.1| unknown [Zea mays]
 gb|AFW80156.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=251

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 149/170 (88%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LD
Sbjct  82   HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLD  141

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-  324
            WVK LHQE +L +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ 
Sbjct  142  WVKKLHQEKQLGVMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEP  201

Query  323  GLAEKWEASQRN-DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            GLAE+WEASQ N DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  202  GLAERWEASQSNVDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  251



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK+++DR+ELEE V+VALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDMLVDKDLKSDYDRIELEETVRVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR + P+F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRVEAPKFKMPEVSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL  +VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  523  WVRKIHQEKKLEGLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  583  LAERWEASQRAEATKCKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_011077619.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Sesamum indicum]
Length=648

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  482  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  541

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK+ +NN+D VELEEMVQVALLCTQF P HRPKMSEV+RMLEGDG
Sbjct  542  WVKKIHQEKKLDVLVDKNFRNNYDPVELEEMVQVALLCTQFLPIHRPKMSEVVRMLEGDG  601

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  602  LAEKWEASQRAEATRCRANEFSSSGRYSDLTDDSSLLVQAMELSGPR  648



>tpg|DAA53257.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=428

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  262  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLD  321

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +L  MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  322  WVKKLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDG  381

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAE+WEASQ  DTP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  382  LAERWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  428



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL L+VDKDLKNN+DR+ELEE+VQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  516  WVKKIHLEKKLELLVDKDLKNNYDRIELEEIVQVALLCTQYLPSHRPKMSEVVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAEKWEASQRAEESRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris]
Length=624

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELI+GQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELISGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+L+V+KDLK+N+DR+E+EE+VQVAL+CTQ++PS RPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDLLVNKDLKDNYDRIEVEELVQVALICTQYHPSQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ ++ R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  516  WVKKLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  575

Query  320  LAEKWEASQRNDT--------PRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  576  LAERWEATQNGTAEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  629



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  465  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  524

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
             VK LHQE +LN+MVDKDL +N+DRVELEEMVQVALLCTQ+ PSHRP+MSEV+RMLEGDG
Sbjct  525  LVKKLHQEKQLNMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLEGDG  584

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P +++DF   +ESS+ +EAMELSGPR
Sbjct  585  LAEKWEASQNVDTPKSVSSELLPLKFTDFAGADESSVGLEAMELSGPR  632



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  521  WVKKLHQEGKLKQLIDKDLSDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  580

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ  +         P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  581  LAERWEASQTGNGDSQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  634



>gb|AAB71968.1| Putative Serine/Threonine protein kinase [Arabidopsis thaliana]
Length=588

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LD
Sbjct  415  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLD  474

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  475  WVKKLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  534

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  535  LAERWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  588



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++F + ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFNKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDL+NN+D +E+EEMVQVALLCTQ+ PSHRPKMSEV++MLEGDG
Sbjct  518  WVKRIHQEKKLDILVDKDLRNNYDCIEVEEMVQVALLCTQYLPSHRPKMSEVIQMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WE SQR ++ ++RT E +  +RYSD  ++SSL+ +AMELSGPR
Sbjct  578  LAERWEVSQRLESSKYRTQELSASERYSDLTDDSSLLAQAMELSGPR  624



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEMLVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  577  LAERWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  461  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDG
Sbjct  521  WVKKIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 151/171 (88%), Gaps = 5/171 (3%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKAANQKGAMLD  526

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+DR+E+EEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  527  WVKKVHQEKKLELIVDKDLKNNYDRIEVEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  586

Query  320  LAEKWEASQRNDTPRFRTHE-----NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ+ ++   R++      ++ +RYSD  ++S+L+V+AMELSGPR
Sbjct  587  LAEKWEASQQRNSETHRSYSRPNEFSSSERYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ +NQKG ILD
Sbjct  470  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKASNQKGAILD  529

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  530  WVKRIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  589

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  LVERWEASQKAESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR A+QKGV+LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  519  WVKKLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  578

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  579  LAERWEATQNGTGEHQPPPLPPGMVSSSPRVRYYSDYIQESSLVVEAIELSGPR  632



>emb|CDY44608.1| BnaCnng11570D [Brassica napus]
Length=507

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 5/166 (3%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  347  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  406

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  407  WVKKLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  466

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LA++WEASQ             P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  467  LADRWEASQSGGAKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  460  HVTTAVRGTIGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRAIEFGKAANQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKD+K N+DR+ELEEMVQVALL TQ+ P+HRPKMSEV+RMLEGDG
Sbjct  520  WVKKIHQEKKLEMLVDKDIKGNYDRIELEEMVQVALLSTQYLPNHRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580  LAERWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score =   263 bits (672),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  519  WVKRIHHEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPSHRPKMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  579  LVERWEASQKAESAKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>emb|CDY61508.1| BnaCnng37930D [Brassica napus]
Length=507

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 5/166 (3%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  347  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  406

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  407  WVKKLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  466

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LA++WEASQ             P  YSD+I+ESSL+VEA+ELSGPR
Sbjct  467  LADRWEASQSGGAKSL-----PPPYYSDYIQESSLVVEAIELSGPR  507



>ref|XP_004149504.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
 ref|XP_004164846.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Cucumis sativus]
Length=623

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A++FG+ ANQKG ILD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAANQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDL++N+DR+ELEE+V+VALLC Q+ PSHRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEMLVDKDLRSNYDRIELEEIVRVALLCIQYLPSHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL V+A++LSGPR
Sbjct  577  LAEKWEASQRAEASRSRANEFSSSERYSDLTDDSSLFVQAIQLSGPR  623



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL L+VDKDL NN+DR+ELEE+VQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  519  WVRKIHQEKKLELLVDKDLMNNYDRIELEEIVQVALLCTQYLPGHRPRMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  DT +  + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  579  LAEKWEASQSADTTKCNKPHELSSSDRYSDLTDDSSLLVQAMELSGPR  626



>emb|CBI16897.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE +L ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDG
Sbjct  516  WVKKIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  576  LAERWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL  +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDG
Sbjct  521  WVKKLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  581  LAERWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  627



>ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
Length=624

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE +L ++VDKDLK+ +DRVELEEMVQVALLCTQ+ P HRPKMSEV++MLEGDG
Sbjct  518  WVKKIHQEKRLEILVDKDLKHFYDRVELEEMVQVALLCTQYLPGHRPKMSEVVQMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRGEVTKCKPHELSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  LAEKWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ PS RPKMSEV+RMLEGDG
Sbjct  515  WVKKIHQEKKLEMLVDKDLKNNYDRIELEEMVQVALLCTQYLPSLRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKW ASQ+ +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  LAEKWAASQKAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  621



>ref|XP_011099081.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Sesamum 
indicum]
Length=631

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A+ FG+ ANQKG +LD
Sbjct  465  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALQFGKSANQKGAVLD  524

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL  +VDKDLKNN+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDG
Sbjct  525  WVKKLHQEKKLEDLVDKDLKNNYDRIELEEMVQVALLCTQYLPGLRPKMSEVVRMLEGDG  584

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + +T E ++ +RYSD  ++SSL+ +A+ELSGPR
Sbjct  585  LAERWEASQRLESNKLKTQELSSSERYSDLTDDSSLLAQAIELSGPR  631



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQKGVMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+L+VDKDLKNN+D+ ELEE+VQVALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDLLVDKDLKNNYDKNELEEIVQVALLCTQYLPAHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR D T + + +E ++  R+SD  ++SSL+++AMELSGPR
Sbjct  578  LAEKWEASQRADNTTKGKPYELSSSDRFSDLTDDSSLLIQAMELSGPR  625



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ AN KG +LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANNKGAMLD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK+N+DR+E EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEMLVDKDLKSNYDRIEFEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQ-RYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR DT + +  E++   RYSD  ++S L+V+AMELSGPR
Sbjct  577  LAERWEASQRVDTTKCKPQESSSSDRYSDLTDDSLLLVQAMELSGPR  623



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELITGLRAMEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLKN++DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDMLVDKDLKNDYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRVEAHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>ref|XP_006373507.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
 gb|ERP51304.1| hypothetical protein POPTR_0017s14360g [Populus trichocarpa]
Length=596

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  430  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  489

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDG
Sbjct  490  WVKKIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDG  549

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  550  LAESWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  596



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +H E KL ++VDKDLKNN+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVRKIHHEKKLEVLVDKDLKNNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFR-THE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ + +  HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRAESTKCKPPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  625



>ref|XP_009803966.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
sylvestris]
Length=602

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 153/170 (90%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  433  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  492

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDG
Sbjct  493  WVKKIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDG  552

Query  320  LAEKWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  183
            LAEKWEASQR   +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  553  LAEKWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  602



>ref|XP_008230341.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Prunus mume]
Length=623

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEVLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQR ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LVERWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_009596697.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=603

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 153/170 (90%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  434  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  493

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDG
Sbjct  494  WVKKIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDG  553

Query  320  LAEKWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  183
            LAEKWEASQR   +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  554  LAEKWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  603



>ref|XP_009596696.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=621

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 153/170 (90%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  452  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  511

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RP+MSEV+RMLEGDG
Sbjct  512  WVKKIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPRMSEVVRMLEGDG  571

Query  320  LAEKWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  183
            LAEKWEASQR   +T   R +E ++ +RYSD  E +SSL+V+AMELSGPR
Sbjct  572  LAEKWEASQRAEPNTRCSRANEFSSSERYSDLTENDSSLLVQAMELSGPR  621



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDG
Sbjct  521  WVKKIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  581  LAESWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  438  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  497

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+ +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  498  WVKKIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  557

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  558  LAERWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  604



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ PS RPKM EV++MLEGDG
Sbjct  520  WVKKIHQEKKLEMLVDKDLKGNYDRIELEEMVQVALLCTQYLPSQRPKMYEVVKMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE WEASQR +  + + HE ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580  LAESWEASQRAEATKSKPHEFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_009803965.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 153/170 (90%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  451  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  510

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKD+KNN+DR+ELEEMVQVALLCTQ++PS RPKMSEV+RMLEGDG
Sbjct  511  WVKKIHQEKKLDMLVDKDMKNNYDRIELEEMVQVALLCTQYHPSQRPKMSEVVRMLEGDG  570

Query  320  LAEKWEASQRN--DTPRFRTHE-NTPQRYSDFIE-ESSLIVEAMELSGPR  183
            LAEKWEASQR   +T   R +E ++ +RYSD  + +SSL+V+AMELSGPR
Sbjct  571  LAEKWEASQRAEPNTRCSRANEFSSSERYSDLTDNDSSLLVQAMELSGPR  620



>ref|XP_006344295.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Solanum tuberosum]
Length=620

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  453  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  512

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ + QE KL+++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDG
Sbjct  513  WVRKIQQEKKLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDG  572

Query  320  LAEKWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R  R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  573  LAEKWEASQRAEPTRCSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+G
Sbjct  520  WVKRIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEG  579

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LA +WEASQR D+ + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580  LAVRWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  521  WVKKMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  581  LAERWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGGILD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +H E KL ++VDKDLK N+DRVELEEMVQVALLCTQ+ P HRPKMSEV+RMLEG+G
Sbjct  520  WVKRIHLEKKLEVLVDKDLKANYDRVELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGEG  579

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LA +WEASQR D+ + + H+ ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  580  LAVRWEASQRVDSTKCKPHDFSSSDRYSDLTDDSSLLVQAMELSGPR  626



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  520  WVKKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  579

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  580  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  520  WVKKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  579

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  580  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  521  WVKKMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  581  LAERWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  523  WVKKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  582

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_002514536.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF47642.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=576

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+ G +A++FG+ ANQKG +LD
Sbjct  410  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVHGLRALEFGKSANQKGAMLD  469

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            W+K +HQ+ KL L+VDK+LKNN+D +ELEE+V+VALLCTQF P HRPKMSEV+RMLEGDG
Sbjct  470  WIKKIHQDKKLELLVDKNLKNNYDPIELEEIVRVALLCTQFIPGHRPKMSEVVRMLEGDG  529

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  530  LAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  576



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  523  WVKKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  582

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_009803321.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Nicotiana 
sylvestris]
Length=622

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  455  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDG
Sbjct  515  WVKKIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDG  574

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  575  LAERWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  622



>ref|XP_006647834.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Oryza brachyantha]
Length=626

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L++N+DRVELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  520  WVKKMHQEKKLDVLVDKGLRSNYDRVELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  580  LAERWEASQRADSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  626



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+ +VDKDL++N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKKLDTLVDKDLRDNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  578  LAERWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  624



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 14/180 (8%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+T VRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  461  HVTTVVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKLN +VDKDLK  FDRVELEE+VQVALLCTQFNP HRPKMSEVL+MLEGDG
Sbjct  521  WVKKLHQEGKLNQIVDKDLKGKFDRVELEEIVQVALLCTQFNPLHRPKMSEVLKMLEGDG  580

Query  320  LAEKWEASQ-----RNDTP---RFRTH------ENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ     RN      R R+        + P  YS++I++SSL+VEA+ELSGPR
Sbjct  581  LAERWEASQSQSQNRNAEQMLMRLRSRSWCEPSSSPPVMYSEYIQDSSLVVEAIELSGPR  640



>ref|XP_009803320.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Nicotiana 
sylvestris]
Length=625

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDKDLK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDG
Sbjct  518  WVKKIHQEKKLDILVDKDLKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDG  577

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  578  LAERWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_008341829.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=636

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  470  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILD  529

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE  L ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  530  WVKKIHQEKTLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  589

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  LVERWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+  NQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKSTNQKGALLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLKNN+D +EL+E VQVALLCTQ  PSHRPKMSEV+RMLEGDG
Sbjct  521  WVKKIHQEKKLELLVDKDLKNNYDPIELDETVQVALLCTQNLPSHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R RT E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  581  LAEKWEASQRAEATRTRTIEFSSSERYSDLTDDSSLLVQAMELSGPR  627



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  521  WVKKMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  581  LAERWEASQRTDSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  627



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  436  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  495

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
             VK LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  496  MVKKLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDG  555

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  556  LAEKWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  603



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 148/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + FDRVELEE+VQVALLCTQFNPS RPKMSEV++MLEGDG
Sbjct  521  WVKKLHQEGKLKQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSFRPKMSEVMKMLEGDG  580

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LAE+WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  581  LAERWEASQNGAAESLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  633

Query  185  R  183
            R
Sbjct  634  R  634



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  434  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  493

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
             VK LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  494  MVKKLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDG  553

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  554  LAEKWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  601



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L+N++D +ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  522  WVKKMHQEKKLDVLVDKGLRNSYDHIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  581

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  582  LAERWEASQRTDSHKFKVPEFTFGRCYSDLTDDSSLLVQAVELSGPR  628



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  466  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  525

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
             VK LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  526  MVKKLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDG  585

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  586  LAEKWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  633



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
             VK LH E +L++MVDKDL +N+DRVELEEMVQVALLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  524  MVKKLHHEKQLSMMVDKDLGSNYDRVELEEMVQVALLCTQYHPSHRPRMSEVIRMLEGDG  583

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            LAEKWEASQ  DTP+  + E  P ++ D    +ESSL +EAMELSGPR
Sbjct  584  LAEKWEASQNVDTPKSVSSELIPPKFMDLAAADESSLGLEAMELSGPR  631



>ref|XP_007214944.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
 gb|EMJ16143.1| hypothetical protein PRUPE_ppa002897mg [Prunus persica]
Length=623

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+  NQKG ILD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKATNQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLK N+DR+ELEEMVQVALLCTQ+ P  RPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEMLVDKDLKTNYDRIELEEMVQVALLCTQYLPGQRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQR ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LVERWEASQRVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  623



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV  LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  523  WVTKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  582

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  583  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  636



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  425  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  484

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQ+ KL+++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  485  WVKKIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  544

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  545  LAERWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  591



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV  LHQEGKL  ++DK+L + FDRVELEE+VQVALLCTQFNPSHRPKMSEV++MLEGDG
Sbjct  520  WVTKLHQEGKLKQLIDKELNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLEGDG  579

Query  320  LAEKWEASQRND--------TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA+Q            P   +     + YSD+I+ESSL+VEA+ELSGPR
Sbjct  580  LAERWEATQNGTGESQPPPLPPGMMSSSPRVRYYSDYIQESSLVVEAIELSGPR  633



>ref|XP_002436855.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
 gb|EER88222.1| hypothetical protein SORBIDRAFT_10g010010 [Sorghum bicolor]
Length=629

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L+  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  523  WVKKMHQEKKLDVLVDKGLRGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+ +F+  + T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  583  LAERWEASQRADSHKFKVPDFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELITGQKA+DFGR ANQKG +LD
Sbjct  468  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRVANQKGGVLD  527

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE +L  MVDKDL +++DRVELEEMVQV+LLCTQ++PSHRP+MSEV+RMLEGDG
Sbjct  528  WVKKLHQEKQLGTMVDKDLGSSYDRVELEEMVQVSLLCTQYHPSHRPRMSEVIRMLEGDG  587

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDF-IEESSLIVEAMELSGPR  183
            LAE+WEASQ  DTP   + E   Q+Y DF  +E SL +EAMELSGPR
Sbjct  588  LAERWEASQNVDTPESVSSELLLQKYMDFAADECSLGLEAMELSGPR  634



>gb|ABD96908.1| hypothetical protein [Cleome spinosa]
Length=630

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  517  WVKKIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  577  LAERWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  630



>ref|XP_004236956.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Solanum lycopersicum]
Length=620

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITG++A++FG+ ANQKG +LD
Sbjct  453  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGERALEFGKAANQKGAMLD  512

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ + QE +L+++VDKD+KN +D +ELEEMVQVALLCTQ++PSHRPKMSEV+RMLEGDG
Sbjct  513  WVRKIQQEKRLDMLVDKDMKNEYDTIELEEMVQVALLCTQYHPSHRPKMSEVVRMLEGDG  572

Query  320  LAEKWEASQRNDTPRF-RTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQ  +  R+ R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  573  LAEKWEASQTAEPTRYSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  620



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK+LK+N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDG
Sbjct  518  WVKKIHQEKKLDILVDKELKSNYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDG  577

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  578  LAERWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  625



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+G +A++FG+ ANQKG +LD
Sbjct  760  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGLRALEFGKTANQKGAMLD  819

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +H E KL ++VDKDLKNN+DR+ELEEM QVALLCTQ+ PSHRPKMSEV+RMLEGDG
Sbjct  820  WVRKIHLEKKLEMLVDKDLKNNYDRIELEEMAQVALLCTQYLPSHRPKMSEVVRMLEGDG  879

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +  R R +E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  880  LAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAMELSGPR  926



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGT+GHIAPEYLSTGQSS+KTDVFGFGILLLELITGQ A++F +  NQKG ILD
Sbjct  457  HVTTAVRGTIGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQTALEFAKSTNQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL ++VDKDL  N+DR+ELEEM+QVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  517  WVKKLHQEKKLEMLVDKDLNTNYDRIELEEMIQVALLCTQYLPGHRPRMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQR ++ + + + ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  577  LVERWEASQRAESTKSKAYFSSSDRYSDLTDDSSLLVQAMELSGPR  622



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAMEFGKAANQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE  L+++VDKDLKN++DR+ELEEMVQVALLCT + P  RPKMSEV+RMLEGDG
Sbjct  518  WVKKIHQEKNLDMLVDKDLKNDYDRIELEEMVQVALLCTLYLPGQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  +F+  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  578  LAERWEASQRVEAHKFKMPEFSSSERYSDLTDDSSLLVQAMELSGPR  624



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  522  WVKKLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  581

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LA++WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  582  LADRWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  634

Query  185  R  183
            R
Sbjct  635  R  635



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  523  WVKKIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDG  582

Query  320  LAEKWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  583  LAERWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  636



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  522  WVKKLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  581

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LA++WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  582  LADRWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  634

Query  185  R  183
            R
Sbjct  635  R  635



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  523  WVKKLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  582

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LA++WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  583  LADRWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  635

Query  185  R  183
            R
Sbjct  636  R  636



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  464  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKSANQKGAILD  523

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL ++VDKDLKNN+D +ELEE VQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  524  WVKKIHQEKKLEVLVDKDLKNNYDHLELEETVQVALLCTQYLPGHRPKMSEVVRMLEGDG  583

Query  320  LAEKWEASQRNDTP--------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D+         R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  584  LAERWEASQRTDSTAKCSSSSSRRLNELSSSDRYSDLTDDSTLLVQAMELSGPR  637



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  469  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  528

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQ+ KL+++VDKDL++ +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  529  WVKKIHQDKKLDMLVDKDLRDKYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  588

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR D   F+  E + +R +SD  ++SSL+ +AMELSGPR
Sbjct  589  LAERWEASQRVDAHMFKLPEFSSERCFSDLTDDSSLLAQAMELSGPR  635



>ref|XP_009373732.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG ILD
Sbjct  470  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAILD  529

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE  L ++VDKDL  N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  530  WVKKIHQEKTLEMLVDKDLTTNYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  589

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEASQ+ ++ + +  E ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  590  LVERWEASQKVESTKSKAPEFSSSDRYSDLTDDSSLLVQAMELSGPR  636



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +DRVELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  523  WVKKLHQEGKLKQLIDKDLNDKYDRVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  582

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LA++WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  583  LADRWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  635

Query  185  R  183
            R
Sbjct  636  R  636



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL+++VDKDL+ N+DR+ELEEMVQVALLCTQ+ P HRPKMSE++RMLEGDG
Sbjct  519  WVRKIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLCTQYLPGHRPKMSEIVRMLEGDG  578

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  579  LAERWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 149/170 (88%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ+A++FG+ ANQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQRALEFGKAANQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL L+VDKDLK+N+D+ ELEEMVQVALLCTQ+ PS+RPKMSEV+RMLEGDG
Sbjct  520  WVKKIHQEKKLELLVDKDLKSNYDKNELEEMVQVALLCTQYLPSNRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQR---NDTPRFRTHENT-PQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEA Q+   N   +++ HE++   RYSD  ++S L+V+AMELSGPR
Sbjct  580  LAERWEAYQKTTDNSNAKYKPHESSLSDRYSDLTDDSLLLVQAMELSGPR  629



>dbj|BAJ89901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  519  WVKKMHQEKKLDMLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+W+ASQR D+ +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  579  LAERWQASQRADSHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  625



>ref|XP_004965216.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Setaria italica]
Length=661

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  495  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  554

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK LK  +DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  555  WVKKMHQEKKLDVLVDKGLKGGYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  614

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ  D+ +F+  E + +R YSD  ++SSL+V+A+ELSGPR
Sbjct  615  LAERWEASQCADSHKFKVPEFSFRRCYSDLTDDSSLLVQAVELSGPR  661



>ref|XP_003563960.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Brachypodium 
distachyon]
Length=629

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  463  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKASNQKGAMLD  522

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+++VDK L++++DR+ELEEMVQVALLCTQ+ P HRP+MSEV+RMLEGDG
Sbjct  523  WVKKMHQEKKLDVLVDKGLRSSYDRIELEEMVQVALLCTQYLPGHRPRMSEVVRMLEGDG  582

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+W+ASQR D+ +F   E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  583  LAERWQASQRADSHKFTVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  629



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDG
Sbjct  518  WVKKMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ  D+ +F+  E T  R YSD  ++SSL+V+A+ELSGPR
Sbjct  578  LAERWEASQHTDSHKFKVPEFTFSRCYSDLTDDSSLLVQAVELSGPR  624



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ ANQKG +LD
Sbjct  469  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKAANQKGAMLD  528

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE KL+ +VDK L+N++DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  529  WVKRIHQEKKLDTIVDKVLRNHYDRIELEEMVQVALLCTQYLPGHRPKMSEVVRMLEGDG  588

Query  320  LAEKWEASQRNDTPRFRTHENTPQRY-SDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  + + HE + +R  SD  ++SSL+V+AMELSGPR
Sbjct  589  LAERWEASQRVEAYKCKLHEFSSERCSSDLTDDSSLLVQAMELSGPR  635



>ref|XP_008243752.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
 ref|XP_008243753.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Prunus mume]
Length=625

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  459  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDG
Sbjct  519  WVKKIQQEKKFDVLVDKELKNDYDPIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579  LAEKWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 148/181 (82%), Gaps = 22/181 (12%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKA+DFGR ++QKGV+LD
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSSHQKGVMLD  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQEGKL  ++DKDL + +D VELEE+VQVALLCTQFNPS+RPKMSEV++MLEGDG
Sbjct  522  WVKKLHQEGKLKQLIDKDLNDKYDTVELEEIVQVALLCTQFNPSNRPKMSEVMKMLEGDG  581

Query  320  LAEKWEASQR---------------NDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGP  186
            LA++WEASQ                + +PR R        YSD+I+ESSL+VEA+ELSGP
Sbjct  582  LADRWEASQSGGAKSLPPPLPSGMVSSSPRVR-------YYSDYIQESSLVVEAIELSGP  634

Query  185  R  183
            R
Sbjct  635  R  635



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSS+KTDVFGFGILLLELITG +A+++G+ A QKG +LD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGLRALEYGKAAKQKGAMLD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL+++VDKDLK N+DR+ELEEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVRKMHQEKKLDVLVDKDLK-NYDRIELEEMVQVALLCTQYVPGHRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR +  +FR  E + +RYSD  ++ SL+VEAMELSGPR
Sbjct  577  LAERWEASQRTEVHKFRVPEFSSERYSDLTDD-SLLVEAMELSGPR  621



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  455  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  P+ RPKMSEV+RMLEGDG
Sbjct  515  WVKKIQQEKKFDVLVDKELKNDYDAIELEEMIQVALLCTQNLPNQRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  575  LAEKWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  621



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +AV+FG+ ANQKG ILD
Sbjct  458  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRAVEFGKAANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE  L+++VD+DLKNN+DRVE+EE++QV +LCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  518  WVRKIHQEKSLDMLVDRDLKNNYDRVEVEEIIQVVILCTQYLPGHRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEAS+R +  + +  E   ++YSD  ++SSL+++A+ELSGPR
Sbjct  578  LAERWEASRRIEAHKLKVPEIFSEQYSDITDDSSLLIDAIELSGPR  623



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A+ FG+ ANQKG +LD
Sbjct  456  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALQFGKSANQKGAVLD  515

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK LHQE KL  +VDKDL++N+D +ELEE+VQVALLCTQ+ P  RPKMSE++RMLEGDG
Sbjct  516  WVKKLHQEKKLEEVVDKDLRSNYDIIELEEIVQVALLCTQYLPGLRPKMSEIVRMLEGDG  575

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQR ++ +F+T E ++ +RYSD  ++SSLI +A+ELSGPR
Sbjct  576  LAERWEASQRLESNKFKTQELSSSERYSDLTDDSSLIAQAIELSGPR  622



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 148/167 (89%), Gaps = 7/167 (4%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELI+GQ+A+DFG+ ANQKG +LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALDFGKAANQKGAMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            W      E KL+++VDKDLKNN+DR+ELEE++QVALLCTQ+ PS+RPKMSEV+RMLEGDG
Sbjct  519  W------EKKLDMLVDKDLKNNYDRIELEEIIQVALLCTQYLPSYRPKMSEVVRMLEGDG  572

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R ++ ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  573  LAEKWEASQRAESTRCRANDFSSSERYSDLTDDSSLLAQAMELSGPR  619



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQKGV+LD
Sbjct  459  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAIEFGKAANQKGVMLD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WV+ +HQE KL+++VDKDL+ N+DR+ELEEMVQVALL TQ+ P HRPKMSE++RMLEGDG
Sbjct  519  WVRKIHQEKKLDVLVDKDLRINYDRIELEEMVQVALLSTQYLPGHRPKMSEIVRMLEGDG  578

Query  320  LAEKWEASQRND-TPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ+ D + +++T E ++ +R+SD  ++S L+V+AMELSGPR
Sbjct  579  LAERWEASQKFDGSNKYKTKELSSSERFSDLTDDSLLLVQAMELSGPR  626



>ref|XP_007221991.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
 gb|EMJ23190.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
Length=625

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  459  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDG
Sbjct  519  WVKKIQQEKKFDVLVDKELKNDYDPIELEEMIQVALLCTQNLPRQRPKMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579  LAEKWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>ref|XP_004297175.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Fragaria vesca subsp. 
vesca]
Length=624

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  457  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILVLELISGQRALEFGKAANQKGAILD  516

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++VDK+LKN++D +ELEEM+QVALLCTQ  P  RPKMSEV+RMLEGDG
Sbjct  517  WVKKIQQEKKFDMLVDKELKNDYDPIELEEMIQVALLCTQNLPGQRPKMSEVVRMLEGDG  576

Query  320  LAEKWEASQRNDTPRFRTHEN--TPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R RT+ +  + +RYSD  ++SSL+ +AMELSGPR
Sbjct  577  LAEKWEASQRAESNRCRTNNDFSSSERYSDLTDDSSLLAQAMELSGPR  624



>dbj|BAB01326.1| receptor-like kinase [Arabidopsis thaliana]
Length=630

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  521  WVKKLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDG  580

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L EKWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  581  LVEKWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  630



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILD
Sbjct  482  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILD  541

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  542  WVKKLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPVHRPKMSEVVRMLEGDG  601

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L EKWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  602  LVEKWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  651



>ref|NP_189183.2| NSP-interacting kinase 2 [Arabidopsis thaliana]
 sp|Q8RY65.1|NIK2_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 2; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL91629.1| AT3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|AAO11535.1| At3g25560/MWL2_18 [Arabidopsis thaliana]
 gb|ACN59323.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77026.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=635

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILD
Sbjct  466  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILD  525

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  526  WVKKLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDG  585

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L EKWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  586  LVEKWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  635



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 149/170 (88%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFG+LL+EL+TGQKA+DFGR ANQKG +LD
Sbjct  461  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGVLLVELVTGQKALDFGRVANQKGGVLD  520

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGD-  324
            WVK LHQE +L +MVDKDL +++D VELEEMVQ+ALLCTQ++PSHRP+MSEV+RMLEG+ 
Sbjct  521  WVKKLHQEKQLGVMVDKDLGSSYDGVELEEMVQLALLCTQYHPSHRPRMSEVIRMLEGEP  580

Query  323  GLAEKWEASQRN-DTPRFRTHENTPQRYSDF--IEESSLIVEAMELSGPR  183
            GLAE+WEASQ N DTP+  + E  P +Y DF   +ESSL +EAMELSGPR
Sbjct  581  GLAERWEASQSNVDTPKSVSSELLPPKYVDFAAADESSLGLEAMELSGPR  630



>ref|NP_974360.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
 gb|AEE77027.1| NSP-interacting kinase 2 [Arabidopsis thaliana]
Length=636

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILD  526

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  527  WVKKLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDG  586

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L EKWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  587  LVEKWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G ILD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILD  526

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  527  WVKKLQQEKKLEQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDG  586

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L EKWEA SQR +T R  +  N   + +RYSD  ++SS++V+AMELSGPR
Sbjct  587  LVEKWEASSQRAETNRSYSKPNEFSSSERYSDLTDDSSVLVQAMELSGPR  636



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score =   253 bits (645),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  458  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILD  517

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++VDK+LK ++D +ELEEM+QVALLCTQ  PS RPKMSEV+RMLEGDG
Sbjct  518  WVKKIQQEKKFDVLVDKELKYDYDAIELEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDG  577

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  578  LAEKWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  624



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITG +A++FG+ ANQ+G IL+
Sbjct  462  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILE  521

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK L QE KL  +VDKDLK+N+DR+E+EEMVQVALLCTQ+ P HRPKMSEV+RMLEGDG
Sbjct  522  WVKKLQQEKKLEQIVDKDLKSNYDRIEIEEMVQVALLCTQYLPIHRPKMSEVVRMLEGDG  581

Query  320  LAEKWEA-SQRNDTPRFRTHEN---TPQRYSDFIEESSLIVEAMELSGPR  183
            L E+WEA SQR +T R  +  N   T +RYSD  ++SS++V+AMELSGPR
Sbjct  582  LVERWEASSQRTETNRSYSKPNEFSTSERYSDLTDDSSVLVQAMELSGPR  631



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 7/173 (4%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A +FG+ ANQKGV+LD
Sbjct  466  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLD  525

Query  500  WVKTLHQEGKLNLMVDKDL--KNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEG  327
            WVK +HQE KL L+VDK+L  K ++D +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEG
Sbjct  526  WVKKIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEG  585

Query  326  DGLAEKWEASQRND-----TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            DGLAEKWEASQR+D     + R     ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  586  DGLAEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR  638



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 7/173 (4%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A +FG+ ANQKGV+LD
Sbjct  457  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLD  516

Query  500  WVKTLHQEGKLNLMVDKDL--KNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEG  327
            WVK +HQE KL L+VDK+L  K ++D +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEG
Sbjct  517  WVKKIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEG  576

Query  326  DGLAEKWEASQRND-----TPRFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            DGLAEKWEASQR+D     + R     ++  RYSD  ++SSL+V+AMELSGPR
Sbjct  577  DGLAEKWEASQRSDSVSKCSNRINELMSSSDRYSDLTDDSSLLVQAMELSGPR  629



>ref|XP_008339771.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Malus domestica]
Length=625

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGIL+LELI+GQ+A++FG+ ANQKG ILD
Sbjct  459  HITTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILILELISGQRALEFGKAANQKGAILD  518

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK + QE K +++V K+LKN++D +E+EEM+QVALLCTQ  PS RPKMSEV+RMLEGDG
Sbjct  519  WVKKIQQEKKFDVLVGKELKNDYDPIEVEEMIQVALLCTQNLPSQRPKMSEVVRMLEGDG  578

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR ++ R R +E ++ +RYSD  ++SSL+ +AMELSGPR
Sbjct  579  LAEKWEASQRAESNRCRANEFSSSERYSDLTDDSSLLAQAMELSGPR  625



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLEL+TGQ+A +FG+ ANQKGV+LD
Sbjct  467  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLD  526

Query  500  WVKTLHQEGKLNLMVDKDL--KNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEG  327
            WVK +HQE KL L+VDK+L  K ++D +EL+EMV+VALLCTQ+ P HRPKMSEV+RMLEG
Sbjct  527  WVKKIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLEG  586

Query  326  DGLAEKWEASQRNDTP------RFRTHENTPQRYSDFIEESSLIVEAMELSGPR  183
            DGLAE+WEASQR+DT       R     ++  RYSD  ++S+L+V+AMELSGPR
Sbjct  587  DGLAERWEASQRSDTSTSKCSNRINELMSSSDRYSDLTDDSTLLVQAMELSGPR  640



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDG
Sbjct  520  WVKKMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ  ++ +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  580  LAERWEASQHTESHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            HV+TAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQ A++FG+ +NQKG +LD
Sbjct  460  HVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQTALEFGKSSNQKGAMLD  519

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK +HQE +L+++VDK L + +DR+ELEEMVQVALLCTQF P HRPKMSEV+RMLEGDG
Sbjct  520  WVKKMHQEKQLDILVDKGLGSKYDRIELEEMVQVALLCTQFLPGHRPKMSEVVRMLEGDG  579

Query  320  LAEKWEASQRNDTPRFRTHENTPQR-YSDFIEESSLIVEAMELSGPR  183
            LAE+WEASQ  ++ +F+  E +  R +SD  ++SSL+V+A+ELSGPR
Sbjct  580  LAERWEASQHTESHKFKVPEFSFSRCHSDLTDDSSLLVQAVELSGPR  626



>gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  680  HVSTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILD  501
            H++T V+GTVGHIAPEYLSTGQSSEKTDVFGFG+LL+ELI+G +A++FG+ + QKG +LD
Sbjct  455  HITTTVKGTVGHIAPEYLSTGQSSEKTDVFGFGMLLVELISGLRALEFGKSSKQKGAMLD  514

Query  500  WVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLEGDG  321
            WVK ++ E KL L+VDKDLKNN+DR+ELEEMV+VALLCTQ+ P+HRPKMSEV+RMLEGDG
Sbjct  515  WVKKINHEKKLELLVDKDLKNNYDRIELEEMVRVALLCTQYYPTHRPKMSEVVRMLEGDG  574

Query  320  LAEKWEASQRNDTPRFRTHE-NTPQRYSDFIEESSLIVEAMELSGPR  183
            LAEKWEASQR +    R  E ++ +RYSD  ++SSL+V+AMELSGPR
Sbjct  575  LAEKWEASQRAEATGSRVAEFSSSERYSDLTDDSSLLVQAMELSGPR  621



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050