BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015L20

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097825.1|  PREDICTED: syntaxin-51-like                        326   4e-109   Sesamum indicum [beniseed]
ref|XP_011095474.1|  PREDICTED: syntaxin-52-like                        320   5e-107   Sesamum indicum [beniseed]
ref|XP_009591371.1|  PREDICTED: syntaxin-51-like                        320   9e-107   Nicotiana tomentosiformis
ref|XP_009786725.1|  PREDICTED: syntaxin-51-like                        318   4e-106   Nicotiana sylvestris
ref|XP_004244081.1|  PREDICTED: syntaxin-51-like isoform X2             317   1e-105   Solanum lycopersicum
ref|XP_010324299.1|  PREDICTED: syntaxin-51-like isoform X1             317   2e-105   Solanum lycopersicum
ref|XP_006346178.1|  PREDICTED: syntaxin-51-like isoform X1             315   8e-105   
ref|XP_006346179.1|  PREDICTED: syntaxin-51-like isoform X2             315   1e-104   Solanum tuberosum [potatoes]
ref|XP_009625656.1|  PREDICTED: syntaxin-51-like isoform X2             312   8e-104   Nicotiana tomentosiformis
ref|XP_002277100.1|  PREDICTED: syntaxin-51                             311   2e-103   Vitis vinifera
ref|XP_009625654.1|  PREDICTED: syntaxin-51-like isoform X1             312   2e-103   Nicotiana tomentosiformis
ref|XP_009765138.1|  PREDICTED: syntaxin-51-like isoform X2             310   9e-103   Nicotiana sylvestris
ref|XP_009765136.1|  PREDICTED: syntaxin-51-like isoform X1             310   1e-102   Nicotiana sylvestris
ref|XP_010245902.1|  PREDICTED: syntaxin-51-like                        307   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010246481.1|  PREDICTED: syntaxin-52-like                        305   4e-101   Nelumbo nucifera [Indian lotus]
gb|EYU27391.1|  hypothetical protein MIMGU_mgv1a013014mg                301   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_006595709.1|  PREDICTED: syntaxin-51-like                        300   5e-99    Glycine max [soybeans]
ref|XP_007146536.1|  hypothetical protein PHAVU_006G048900g             300   5e-99    Phaseolus vulgaris [French bean]
gb|ACU19604.1|  unknown                                                 297   1e-97    Glycine max [soybeans]
gb|AFK34675.1|  unknown                                                 296   2e-97    Medicago truncatula
ref|XP_003600182.1|  Syntaxin-52                                        296   2e-97    
gb|KEH18882.1|  syntaxin of plants protein                              295   3e-97    Medicago truncatula
ref|XP_007020672.1|  Syntaxin of plants 51 isoform 2                    294   4e-97    
ref|XP_008447706.1|  PREDICTED: syntaxin-51-like                        295   5e-97    Cucumis melo [Oriental melon]
ref|XP_007020671.1|  Syntaxin of plants 51 isoform 1                    295   8e-97    
gb|AES70433.2|  syntaxin of plants protein                              295   1e-96    Medicago truncatula
gb|KJB81690.1|  hypothetical protein B456_013G156800                    294   1e-96    Gossypium raimondii
emb|CDP13772.1|  unnamed protein product                                293   4e-96    Coffea canephora [robusta coffee]
ref|XP_004151390.1|  PREDICTED: syntaxin-51-like                        291   2e-95    Cucumis sativus [cucumbers]
gb|KJB11946.1|  hypothetical protein B456_002G094300                    290   4e-95    Gossypium raimondii
gb|AFK35227.1|  unknown                                                 290   7e-95    Medicago truncatula
ref|XP_006452473.1|  hypothetical protein CICLE_v10009364mg             288   2e-94    Citrus clementina [clementine]
ref|XP_008345031.1|  PREDICTED: syntaxin-52-like isoform X3             288   3e-94    
gb|KHG11788.1|  Syntaxin-51 -like protein                               288   3e-94    Gossypium arboreum [tree cotton]
ref|XP_008345029.1|  PREDICTED: syntaxin-52-like isoform X1             288   4e-94    
gb|KJB22165.1|  hypothetical protein B456_004G032900                    288   4e-94    Gossypium raimondii
gb|KDP39206.1|  hypothetical protein JCGZ_00963                         288   4e-94    Jatropha curcas
ref|XP_010099994.1|  hypothetical protein L484_014031                   285   3e-93    
ref|XP_009361064.1|  PREDICTED: syntaxin-52-like isoform X2             285   4e-93    Pyrus x bretschneideri [bai li]
ref|XP_009361063.1|  PREDICTED: syntaxin-52-like isoform X1             285   5e-93    Pyrus x bretschneideri [bai li]
ref|XP_007211870.1|  hypothetical protein PRUPE_ppa010128mg             285   6e-93    Prunus persica
ref|XP_009343644.1|  PREDICTED: syntaxin-52-like isoform X1             285   9e-93    Pyrus x bretschneideri [bai li]
ref|XP_009343645.1|  PREDICTED: syntaxin-52-like isoform X2             284   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_009334173.1|  PREDICTED: syntaxin-52-like isoform X3             283   2e-92    Pyrus x bretschneideri [bai li]
ref|XP_010060271.1|  PREDICTED: syntaxin-51-like isoform X2             283   2e-92    Eucalyptus grandis [rose gum]
ref|XP_009334172.1|  PREDICTED: syntaxin-52-like isoform X2             283   2e-92    Pyrus x bretschneideri [bai li]
gb|KCW66896.1|  hypothetical protein EUGRSUZ_F00647                     283   2e-92    Eucalyptus grandis [rose gum]
ref|XP_007211871.1|  hypothetical protein PRUPE_ppa010128mg             284   4e-92    
ref|XP_010060270.1|  PREDICTED: syntaxin-51-like isoform X1             283   4e-92    Eucalyptus grandis [rose gum]
ref|XP_006344878.1|  PREDICTED: syntaxin-52-like                        282   6e-92    
ref|XP_008227024.1|  PREDICTED: syntaxin-52-like                        282   7e-92    Prunus mume [ume]
gb|AFK40726.1|  unknown                                                 281   1e-91    Lotus japonicus
ref|XP_008449105.1|  PREDICTED: syntaxin-51-like                        281   1e-91    Cucumis melo [Oriental melon]
emb|CDX88551.1|  BnaC06g39950D                                          281   2e-91    
ref|XP_009334171.1|  PREDICTED: syntaxin-52-like isoform X1             282   3e-91    
ref|XP_009128371.1|  PREDICTED: syntaxin-52 isoform X1                  280   4e-91    Brassica rapa
gb|KHG00459.1|  Syntaxin-51 -like protein                               280   4e-91    Gossypium arboreum [tree cotton]
ref|XP_009128372.1|  PREDICTED: syntaxin-52 isoform X2                  280   5e-91    Brassica rapa
ref|XP_004149588.1|  PREDICTED: syntaxin-52-like                        279   8e-91    Cucumis sativus [cucumbers]
ref|XP_007142350.1|  hypothetical protein PHAVU_008G273200g             278   2e-90    Phaseolus vulgaris [French bean]
ref|XP_010675821.1|  PREDICTED: syntaxin-52-like                        278   2e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491440.1|  PREDICTED: syntaxin-52-like isoform X1             278   3e-90    Cicer arietinum [garbanzo]
ref|XP_009117773.1|  PREDICTED: syntaxin-51-like                        278   4e-90    Brassica rapa
ref|XP_006302763.1|  hypothetical protein CARUB_v10020885mg             278   4e-90    Capsella rubella
gb|KHM99515.1|  Syntaxin-51                                             278   4e-90    Glycine soja [wild soybean]
ref|XP_003532151.1|  PREDICTED: syntaxin-51-like isoform X1             277   5e-90    Glycine max [soybeans]
ref|XP_010472824.1|  PREDICTED: syntaxin-52                             276   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010429855.1|  PREDICTED: syntaxin-52-like                        276   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006389870.1|  hypothetical protein EUTSA_v10019084mg             276   1e-89    
gb|EPS71742.1|  hypothetical protein M569_03017                         277   1e-89    Genlisea aurea
emb|CDY52847.1|  BnaA09g56390D                                          276   1e-89    Brassica napus [oilseed rape]
ref|XP_011461087.1|  PREDICTED: syntaxin-52-like                        276   2e-89    Fragaria vesca subsp. vesca
ref|XP_003551745.1|  PREDICTED: syntaxin-52-like isoform X1             275   3e-89    Glycine max [soybeans]
ref|XP_010459159.1|  PREDICTED: syntaxin-51-like                        275   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010537838.1|  PREDICTED: syntaxin-51                             275   5e-89    Tarenaya hassleriana [spider flower]
gb|AFK40910.1|  unknown                                                 275   5e-89    Lotus japonicus
ref|XP_004500114.1|  PREDICTED: syntaxin-52-like                        274   1e-88    Cicer arietinum [garbanzo]
ref|XP_010647220.1|  PREDICTED: syntaxin-51-like                        274   1e-88    
gb|KHN30881.1|  Syntaxin-51                                             274   1e-88    Glycine soja [wild soybean]
ref|XP_006602182.1|  PREDICTED: syntaxin-52-like isoform X2             274   1e-88    Glycine max [soybeans]
ref|XP_002887794.1|  hypothetical protein ARALYDRAFT_477131             273   2e-88    
ref|XP_010476728.1|  PREDICTED: syntaxin-51                             273   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010417628.1|  PREDICTED: syntaxin-52-like                        273   2e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009416129.1|  PREDICTED: syntaxin-52-like                        273   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010497722.1|  PREDICTED: syntaxin-51-like                        273   4e-88    Camelina sativa [gold-of-pleasure]
gb|ACU23148.1|  unknown                                                 272   4e-88    Glycine max [soybeans]
emb|CDY68585.1|  BnaAnng27700D                                          272   4e-88    Brassica napus [oilseed rape]
ref|XP_010063061.1|  PREDICTED: syntaxin-52-like                        271   1e-87    Eucalyptus grandis [rose gum]
ref|XP_008787642.1|  PREDICTED: syntaxin-52-like                        271   1e-87    Phoenix dactylifera
emb|CDX81754.1|  BnaC08g38470D                                          270   2e-87    
emb|CDX87371.1|  BnaA07g35020D                                          280   3e-87    
gb|AFK34174.1|  unknown                                                 270   4e-87    Lotus japonicus
emb|CDY33349.1|  BnaC05g12340D                                          269   1e-86    Brassica napus [oilseed rape]
ref|XP_009149057.1|  PREDICTED: syntaxin-51                             268   2e-86    Brassica rapa
gb|KGN56069.1|  hypothetical protein Csa_3G064180                       268   3e-86    Cucumis sativus [cucumbers]
ref|XP_009106789.1|  PREDICTED: syntaxin-52-like                        268   3e-86    
ref|XP_004976388.1|  PREDICTED: syntaxin-52-like                        267   4e-86    Setaria italica
gb|KHG18509.1|  Syntaxin-51 -like protein                               266   6e-86    Gossypium arboreum [tree cotton]
ref|XP_010909005.1|  PREDICTED: syntaxin-52-like                        267   6e-86    Elaeis guineensis
ref|XP_006659260.1|  PREDICTED: syntaxin-52-like                        267   7e-86    Oryza brachyantha
ref|XP_006416838.1|  hypothetical protein EUTSA_v10008662mg             266   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_010532045.1|  PREDICTED: syntaxin-51-like isoform X2             266   1e-85    Tarenaya hassleriana [spider flower]
ref|NP_563994.1|  syntaxin-51                                           265   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565213.1|  syntaxin-52                                           265   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001136935.1|  uncharacterized protein LOC100217094               264   1e-84    Zea mays [maize]
ref|NP_001061436.1|  Os08g0277900                                       263   2e-84    
ref|XP_010532042.1|  PREDICTED: syntaxin-51-like isoform X1             263   2e-84    Tarenaya hassleriana [spider flower]
gb|AAM64357.1|  unknown                                                 263   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131944.1|  uncharacterized protein LOC100193337               263   3e-84    Zea mays [maize]
gb|AFW61956.1|  SNARE domain containing protein                         263   5e-84    
ref|XP_008385825.1|  PREDICTED: syntaxin-52-like                        262   5e-84    
gb|EAY84230.1|  hypothetical protein OsI_05611                          261   8e-84    Oryza sativa Indica Group [Indian rice]
gb|AHA84215.1|  syntaxin-51                                             266   9e-84    Phaseolus vulgaris [French bean]
ref|XP_008784838.1|  PREDICTED: syntaxin-52-like                        261   1e-83    Phoenix dactylifera
ref|XP_008668816.1|  PREDICTED: syntaxin-52-like                        261   1e-83    
ref|XP_006646793.1|  PREDICTED: syntaxin-52-like                        261   1e-83    Oryza brachyantha
ref|XP_010940839.1|  PREDICTED: syntaxin-52-like                        260   3e-83    Elaeis guineensis
gb|EEE68383.1|  hypothetical protein OsJ_26713                          263   5e-83    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045701.1|  Os02g0119400                                       259   7e-83    
gb|ACG31926.1|  SNARE domain containing protein                         259   7e-83    Zea mays [maize]
ref|XP_009407478.1|  PREDICTED: syntaxin-52-like                        258   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR25694.1|  syntaxin 51                                             256   2e-82    Oryza sativa Indica Group [Indian rice]
gb|EEC83251.1|  hypothetical protein OsI_28573                          263   2e-82    Oryza sativa Indica Group [Indian rice]
dbj|BAJ85147.1|  predicted protein                                      254   4e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97107.1|  predicted protein                                      253   1e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573428.1|  PREDICTED: syntaxin-52-like                        250   2e-79    Brachypodium distachyon [annual false brome]
gb|AAF68106.1|AC010793_1  F20B17.2                                      250   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775698.1|  PREDICTED: syntaxin-52-like isoform X1             249   8e-79    Phoenix dactylifera
ref|XP_006304162.1|  hypothetical protein CARUB_v10010186mg             247   3e-78    Capsella rubella
gb|KJB62826.1|  hypothetical protein B456_009G444600                    242   2e-76    Gossypium raimondii
ref|XP_006339244.1|  PREDICTED: syntaxin-51-like                        243   2e-76    Solanum tuberosum [potatoes]
ref|XP_009606725.1|  PREDICTED: syntaxin-52-like                        242   2e-76    Nicotiana tomentosiformis
ref|XP_004491441.1|  PREDICTED: syntaxin-52-like isoform X2             241   3e-76    Cicer arietinum [garbanzo]
ref|XP_009773941.1|  PREDICTED: syntaxin-52-like                        241   5e-76    Nicotiana sylvestris
ref|XP_004249335.1|  PREDICTED: syntaxin-51                             241   5e-76    Solanum lycopersicum
ref|XP_010646520.1|  PREDICTED: syntaxin-52-like                        244   1e-75    Vitis vinifera
ref|XP_008240610.1|  PREDICTED: syntaxin-51-like                        239   4e-75    Prunus mume [ume]
gb|EMT28389.1|  hypothetical protein F775_28894                         240   5e-75    
ref|XP_008775700.1|  PREDICTED: syntaxin-52-like isoform X2             238   7e-75    Phoenix dactylifera
gb|ABK23110.1|  unknown                                                 238   1e-74    Picea sitchensis
ref|XP_010673197.1|  PREDICTED: syntaxin-52-like                        236   5e-74    Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ84463.1|  unknown                                                 234   8e-74    Medicago truncatula
ref|XP_007202519.1|  hypothetical protein PRUPE_ppa010912mg             234   4e-73    Prunus persica
gb|ABK92902.1|  unknown                                                 232   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_011041363.1|  PREDICTED: syntaxin-52-like                        232   3e-72    Populus euphratica
ref|XP_006399472.1|  hypothetical protein EUTSA_v10015786mg             229   5e-72    
ref|XP_006373681.1|  hypothetical protein POPTR_0016s02990g             231   1e-71    
ref|XP_006373682.1|  hypothetical protein POPTR_0016s02990g             231   1e-71    
ref|XP_011040717.1|  PREDICTED: syntaxin-52-like                        230   2e-71    Populus euphratica
gb|ACG48507.1|  SNARE domain containing protein                         230   2e-71    Zea mays [maize]
ref|XP_011040715.1|  PREDICTED: syntaxin-52-like                        226   4e-70    Populus euphratica
ref|XP_009377637.1|  PREDICTED: syntaxin-51-like                        226   8e-70    Pyrus x bretschneideri [bai li]
ref|XP_006406341.1|  hypothetical protein EUTSA_v10021502mg             225   8e-70    
gb|KJB22168.1|  hypothetical protein B456_004G032900                    221   2e-68    Gossypium raimondii
gb|KJB11954.1|  hypothetical protein B456_002G094300                    219   8e-68    Gossypium raimondii
gb|KJB81691.1|  hypothetical protein B456_013G156800                    219   1e-67    Gossypium raimondii
gb|KJB62825.1|  hypothetical protein B456_009G444600                    216   4e-67    Gossypium raimondii
ref|XP_006373683.1|  hypothetical protein POPTR_0016s03000g             214   2e-65    
ref|XP_002892898.1|  hypothetical protein ARALYDRAFT_471821             213   1e-64    
gb|KCW66897.1|  hypothetical protein EUGRSUZ_F00647                     208   2e-63    Eucalyptus grandis [rose gum]
ref|XP_011041367.1|  PREDICTED: syntaxin-52-like                        208   6e-63    Populus euphratica
ref|NP_001077546.1|  syntaxin-51                                        206   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531208.1|  syntaxin, putative                                 203   4e-62    
gb|EYU33678.1|  hypothetical protein MIMGU_mgv1a021393mg                199   1e-59    Erythranthe guttata [common monkey flower]
gb|KJB22169.1|  hypothetical protein B456_004G032900                    195   2e-58    Gossypium raimondii
ref|XP_008676698.1|  PREDICTED: uncharacterized protein LOC100217...    195   3e-58    Zea mays [maize]
ref|XP_002307951.1|  hypothetical protein POPTR_0006s03120g             194   7e-58    
gb|KJB81686.1|  hypothetical protein B456_013G156800                    193   1e-57    Gossypium raimondii
gb|KCW66898.1|  hypothetical protein EUGRSUZ_F00647                     182   1e-53    Eucalyptus grandis [rose gum]
gb|AFW61961.1|  hypothetical protein ZEAMMB73_963395                    169   2e-48    
gb|EMS60104.1|  Syntaxin-51                                             171   2e-48    Triticum urartu
gb|ACN36591.1|  unknown                                                 168   3e-48    Zea mays [maize]
gb|AAM52319.1|AC105363_8  Hypothetical protein                          162   4e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AFK42434.1|  unknown                                                 156   8e-44    Lotus japonicus
ref|XP_001778077.1|  predicted protein                                  154   3e-42    
gb|EAY88317.1|  hypothetical protein OsI_09776                          155   1e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_001751913.1|  Qc-SNARE, SYP5 family                              149   5e-40    
ref|XP_010111270.1|  hypothetical protein L484_027923                   144   5e-39    
ref|NP_173073.2|  Target SNARE coiled-coil domain protein               144   1e-38    
ref|XP_003562169.2|  PREDICTED: syntaxin-52-like                        142   4e-38    Brachypodium distachyon [annual false brome]
ref|XP_003617659.1|  Syntaxin-51                                        140   1e-37    Medicago truncatula
gb|KJB22166.1|  hypothetical protein B456_004G032900                    136   2e-36    Gossypium raimondii
gb|KJB22167.1|  hypothetical protein B456_004G032900                    137   3e-36    Gossypium raimondii
gb|EMT07622.1|  hypothetical protein F775_07967                         136   2e-35    
gb|KJB81687.1|  hypothetical protein B456_013G156800                    133   6e-35    Gossypium raimondii
gb|KJB81689.1|  hypothetical protein B456_013G156800                    132   9e-35    Gossypium raimondii
gb|KJB11950.1|  hypothetical protein B456_002G094300                    132   2e-34    Gossypium raimondii
gb|KJB11948.1|  hypothetical protein B456_002G094300                    132   2e-34    Gossypium raimondii
gb|KJB11947.1|  hypothetical protein B456_002G094300                    132   2e-34    Gossypium raimondii
gb|KJB11949.1|  hypothetical protein B456_002G094300                    132   2e-34    Gossypium raimondii
emb|CBI25899.3|  unnamed protein product                                128   7e-34    Vitis vinifera
gb|KCW70251.1|  hypothetical protein EUGRSUZ_F03509                     126   4e-32    Eucalyptus grandis [rose gum]
gb|AAZ32890.1|  syntaxin of plants                                      124   1e-31    Medicago sativa [alfalfa]
ref|XP_002970090.1|  hypothetical protein SELMODRAFT_441012             124   7e-31    Selaginella moellendorffii
ref|XP_005649717.1|  Qc-snare protein, Syn8/Syntaxin8-family            124   2e-30    Coccomyxa subellipsoidea C-169
ref|XP_002985281.1|  hypothetical protein SELMODRAFT_446189             121   1e-29    Selaginella moellendorffii
ref|XP_002465967.1|  hypothetical protein SORBIDRAFT_01g049130          122   1e-29    Sorghum bicolor [broomcorn]
gb|EMS59036.1|  Syntaxin-51                                             119   6e-29    Triticum urartu
ref|NP_683311.2|  putative syntaxin-type t-SNARE protein                112   2e-26    Arabidopsis thaliana [mouse-ear cress]
gb|ABI84247.1|  syntaxin                                                110   3e-26    Arachis hypogaea [goober]
gb|ACF80713.1|  unknown                                                 108   9e-26    Zea mays [maize]
gb|AFW61957.1|  hypothetical protein ZEAMMB73_963395                    110   1e-25    
gb|EAZ06340.1|  hypothetical protein OsI_28572                          106   6e-25    Oryza sativa Indica Group [Indian rice]
gb|ABK92777.1|  unknown                                                 100   1e-22    Populus trichocarpa [western balsam poplar]
ref|XP_002951465.1|  Qc-SNARE, Syn8/Syntaxin8-family                    101   5e-22    Volvox carteri f. nagariensis
ref|XP_004987204.1|  PREDICTED: syntaxin-52-like                        100   9e-22    
ref|XP_006380963.1|  hypothetical protein POPTR_0006s03130g           95.1    2e-20    
ref|XP_001691539.1|  Qc-SNARE protein, Syn8/Syntaxin8-family          96.7    3e-20    Chlamydomonas reinhardtii
ref|XP_011398897.1|  Syntaxin-52                                      94.4    2e-19    Auxenochlorella protothecoides
ref|XP_005850452.1|  hypothetical protein CHLNCDRAFT_59611            91.7    1e-18    Chlorella variabilis
ref|XP_003064731.1|  predicted protein                                87.0    6e-17    Micromonas pusilla CCMP1545
gb|KIZ07812.1|  Syntaxin-51                                           85.9    2e-16    Monoraphidium neglectum
gb|KDD75355.1|  hypothetical protein H632_c726p1                      84.7    2e-16    Helicosporidium sp. ATCC 50920
ref|XP_002504673.1|  predicted protein                                84.0    5e-16    Micromonas commoda
ref|XP_004363668.1|  hypothetical protein CAOG_03940                  83.6    8e-16    Capsaspora owczarzaki ATCC 30864
dbj|BAC57351.1|  unknown protein                                      82.4    5e-15    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006836710.1|  hypothetical protein AMTR_s00088p00114030        77.4    6e-15    
ref|XP_009050690.1|  hypothetical protein LOTGIDRAFT_205331           77.0    2e-13    Lottia gigantea
ref|XP_002676758.1|  predicted protein                                76.3    3e-13    Naegleria gruberi strain NEG-M
ref|XP_011418529.1|  PREDICTED: syntaxin-8-like                       75.5    4e-13    Crassostrea gigas
ref|XP_011027754.1|  PREDICTED: syntaxin-61                           73.2    3e-12    Populus euphratica
ref|XP_011109213.1|  hypothetical protein H072_3230                   73.6    7e-12    
ref|XP_010499380.1|  PREDICTED: syntaxin-61 isoform X2                70.9    1e-11    Camelina sativa [gold-of-pleasure]
ref|XP_006304138.1|  hypothetical protein CARUB_v10010122mg           70.5    3e-11    Capsella rubella
ref|NP_001031102.2|  syntaxin-61                                      69.7    4e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003293989.1|  hypothetical protein DICPUDRAFT_42819            68.9    9e-11    Dictyostelium purpureum
emb|CEG64180.1|  hypothetical protein RMATCC62417_01202               70.1    1e-10    Rhizopus microsporus
ref|XP_002305773.2|  Syntaxin 61 family protein                       68.6    1e-10    Populus trichocarpa [western balsam poplar]
ref|XP_010499379.1|  PREDICTED: syntaxin-61 isoform X1                68.6    1e-10    Camelina sativa [gold-of-pleasure]
gb|KFM68060.1|  Syntaxin-8                                            68.6    1e-10    Stegodyphus mimosarum
ref|XP_010478222.1|  PREDICTED: syntaxin-61-like                      68.2    2e-10    Camelina sativa [gold-of-pleasure]
ref|XP_001750756.1|  hypothetical protein                             67.8    2e-10    Monosiga brevicollis MX1
gb|AAL59937.1|  unknown protein                                       68.2    2e-10    Arabidopsis thaliana [mouse-ear cress]
emb|CEG84861.1|  hypothetical protein RMATCC62417_18612               69.3    2e-10    Rhizopus microsporus
ref|XP_001762590.1|  Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family           67.4    3e-10    
ref|NP_564310.1|  syntaxin-61                                         67.4    3e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007841269.1|  hypothetical protein PFICI_14497                 68.2    6e-10    Pestalotiopsis fici W106-1
gb|ELQ69118.1|  v-SNARE                                               68.2    6e-10    Magnaporthe oryzae P131
ref|XP_007510233.1|  conserved hypothetical protein                   67.0    7e-10    Bathycoccus prasinos
ref|NP_001045485.1|  Os01g0963300                                     66.2    7e-10    
ref|XP_011273343.1|  Vacuolar morphogenesis protein 7                 67.0    1e-09    Wickerhamomyces ciferrii
gb|EMG46432.1|  t-SNARE syntaxin protein, vesicular/late Golgi fu...  65.5    1e-09    Candida maltosa Xu316
ref|XP_007778861.1|  hypothetical protein W97_02772                   66.6    2e-09    Coniosporium apollinis CBS 100218
ref|XP_010097811.1|  hypothetical protein L484_000959                 65.5    2e-09    Morus notabilis
ref|XP_006645352.1|  PREDICTED: syntaxin-61-like                      65.1    2e-09    Oryza brachyantha
gb|AGT16573.1|  hypothetical protein SHCRBa_250_M20_R_30              64.3    4e-09    Saccharum hybrid cultivar R570
gb|ELQ35584.1|  v-SNARE                                               65.5    5e-09    Magnaporthe oryzae Y34
gb|KIL62800.1|  hypothetical protein M378DRAFT_12590                  63.9    6e-09    Amanita muscaria Koide BX008
emb|CEI88428.1|  hypothetical protein RMCBS344292_02818               63.5    6e-09    Rhizopus microsporus
ref|NP_001141746.1|  uncharacterized protein LOC100273880             63.5    6e-09    Zea mays [maize]
gb|KIV88423.1|  hypothetical protein PV10_08109                       65.1    7e-09    Exophiala mesophila
gb|EWC44037.1|  hypothetical protein DRE_01389                        65.1    7e-09    Drechslerella stenobrocha 248
ref|XP_011001211.1|  PREDICTED: syntaxin-61-like                      63.9    7e-09    Populus euphratica
gb|KIJ58063.1|  hypothetical protein HYDPIDRAFT_103340                63.2    9e-09    Hydnomerulius pinastri MD-312
ref|XP_003081442.1|  SNARE protein TLG1/Syntaxin 6 (ISS)              62.0    9e-09    
emb|CDS13496.1|  hypothetical protein LRAMOSA05672                    63.2    9e-09    Lichtheimia ramosa
ref|XP_009102902.1|  PREDICTED: syntaxin-61-like isoform X2           62.8    1e-08    Brassica rapa
ref|XP_007798885.1|  putative snare complex subunit protein           63.2    1e-08    
dbj|BAJ92922.1|  predicted protein                                    63.2    1e-08    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CCO30006.1|  syntaxin 8                                           62.4    1e-08    Rhizoctonia solani AG-1 IB
ref|XP_002459155.1|  hypothetical protein SORBIDRAFT_03g046820        62.8    1e-08    Sorghum bicolor [broomcorn]
emb|CEL53532.1|  syntaxin-like protein                                62.8    1e-08    Rhizoctonia solani AG-1 IB
ref|XP_006965434.1|  v-SNARE protein                                  64.3    1e-08    Trichoderma reesei QM6a
gb|KIY72806.1|  syntaxin                                              63.9    1e-08    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_010760450.1|  hypothetical protein PADG_04959                  63.9    2e-08    Paracoccidioides brasiliensis Pb18
ref|XP_007593744.1|  PX domain-containing protein                     63.9    2e-08    
gb|EEH22350.1|  hypothetical protein PABG_04561                       63.9    2e-08    Paracoccidioides brasiliensis Pb03
emb|CCF43512.1|  SYP5 family Qc-SNARE                                 60.5    2e-08    Colletotrichum higginsianum
ref|XP_002730935.1|  PREDICTED: syntaxin-8-like                       62.0    3e-08    Saccoglossus kowalevskii
ref|XP_636754.1|  hypothetical protein DDB_G0288439                   62.4    3e-08    Dictyostelium discoideum AX4
ref|XP_006377433.1|  Syntaxin 61 family protein                       62.0    3e-08    
gb|KFH72613.1|  hypothetical protein MVEG_02902                       63.2    3e-08    Mortierella verticillata NRRL 6337
ref|XP_001248034.1|  hypothetical protein CIMG_01805                  63.2    3e-08    Coccidioides immitis RS
ref|XP_002792978.1|  v-SNARE                                          63.2    3e-08    Paracoccidioides lutzii Pb01
ref|XP_007583335.1|  putative snare complex subunit protein           63.2    3e-08    
ref|XP_007917370.1|  putative snare complex subunit protein           63.2    3e-08    Phaeoacremonium minimum UCRPA7
ref|XP_001767575.1|  predicted protein                                60.1    3e-08    
ref|XP_002987597.1|  hypothetical protein SELMODRAFT_183263           61.6    4e-08    Selaginella moellendorffii
ref|WP_027225949.1|  hypothetical protein                             59.3    4e-08    Legionella pneumophila
emb|CEF99252.1|  Target SNARE coiled-coil domain                      62.0    4e-08    
ref|XP_004971361.1|  PREDICTED: syntaxin-61-like                      61.6    4e-08    
ref|XP_010269839.1|  PREDICTED: syntaxin-61-like isoform X5           61.6    4e-08    
gb|EHK15368.1|  hypothetical protein TRIVIDRAFT_87333                 62.8    4e-08    
ref|XP_002987656.1|  hypothetical protein SELMODRAFT_126511           61.6    5e-08    
ref|XP_002551155.1|  conserved hypothetical protein                   61.2    5e-08    
ref|XP_003065464.1|  SNARE domain containing protein                  62.4    5e-08    
ref|XP_010269838.1|  PREDICTED: syntaxin-61-like isoform X4           61.6    5e-08    
ref|XP_010269837.1|  PREDICTED: syntaxin-61-like isoform X3           61.6    5e-08    
ref|XP_007919747.1|  hypothetical protein MYCFIDRAFT_26335            62.4    5e-08    
emb|CDR38347.1|  CYFA0S02e00584g1_1                                   62.4    6e-08    
gb|KEF52767.1|  regulator-vacuolar morphogenesis                      62.4    6e-08    
ref|XP_010269836.1|  PREDICTED: syntaxin-61-like isoform X2           61.6    6e-08    
gb|EFQ26986.1|  PX domain-containing protein                          62.0    6e-08    
gb|EFW16590.1|  SNARE complex subunit                                 62.0    6e-08    
ref|XP_004336630.1|  syntaxin 6, putative                             59.3    7e-08    
ref|XP_001272946.1|  SNARE complex subunit (Vam7), putative           62.0    7e-08    
ref|XP_010269835.1|  PREDICTED: syntaxin-61-like isoform X1           61.6    8e-08    
ref|WP_042754549.1|  hypothetical protein                             58.5    8e-08    
gb|EDK38858.2|  hypothetical protein PGUG_02956                       60.8    8e-08    
emb|CDX94628.1|  BnaC07g10300D                                        60.8    8e-08    
ref|XP_007588843.1|  putative snare complex subunit protein           61.2    9e-08    
gb|ESA08803.1|  hypothetical protein GLOINDRAFT_81281                 61.6    1e-07    
ref|WP_011947286.1|  hypothetical protein                             58.2    1e-07    
gb|KFH66682.1|  hypothetical protein MVEG_07207                       60.5    1e-07    
ref|XP_957713.1|  V-SNARE                                             61.6    1e-07    
gb|KIK26202.1|  hypothetical protein PISMIDRAFT_28592                 60.1    1e-07    
ref|XP_008660430.1|  PREDICTED: syntaxin-61-like                      60.1    1e-07    
ref|WP_027219386.1|  hypothetical protein                             57.8    1e-07    
ref|XP_003710288.1|  hypothetical protein MGG_05428                   61.2    1e-07    
ref|XP_006415648.1|  hypothetical protein EUTSA_v10008609mg           60.1    1e-07    
ref|XP_009102901.1|  PREDICTED: syntaxin-61-like isoform X1           60.1    1e-07    
ref|XP_009109711.1|  PREDICTED: syntaxin-61                           60.1    2e-07    
gb|EQB47405.1|  hypothetical protein CGLO_13450                       60.8    2e-07    
ref|XP_003347819.1|  hypothetical protein SMAC_06654                  60.8    2e-07    
ref|XP_001485227.1|  hypothetical protein PGUG_02956                  59.3    2e-07    
emb|CDM86912.1|  unnamed protein product                              59.3    2e-07    
gb|EMS59908.1|  Syntaxin-61                                           59.3    2e-07    
gb|KDN60171.1|  putative PX domain-containing protein                 60.5    3e-07    
gb|KEQ84661.1|  Phox-like protein                                     60.1    3e-07    
ref|XP_009851020.1|  hypothetical protein NEUTE1DRAFT_146434          60.5    3e-07    
ref|XP_001764511.1|  Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family           59.3    3e-07    
ref|XP_003632086.1|  PREDICTED: syntaxin-61                           59.3    3e-07    
ref|XP_004252790.1|  PREDICTED: syntaxin-61                           59.3    3e-07    
ref|XP_006342585.1|  PREDICTED: syntaxin-61-like isoform X1           59.3    3e-07    
ref|XP_007886702.1|  PREDICTED: syntaxin-8 isoform X2                 58.9    4e-07    
gb|KIW12793.1|  hypothetical protein PV08_07980                       59.7    4e-07    
ref|XP_007776580.1|  hypothetical protein W97_00476                   59.3    4e-07    
ref|XP_006452410.1|  hypothetical protein CICLE_v10009295mg           58.9    4e-07    
ref|XP_001211637.1|  conserved hypothetical protein                   59.3    4e-07    
emb|CBI24703.3|  unnamed protein product                              59.3    4e-07    
gb|KIW36945.1|  hypothetical protein PV06_10846                       59.7    5e-07    
ref|XP_008226891.1|  PREDICTED: syntaxin-61                           58.9    5e-07    
ref|XP_643701.1|  syntaxin 8                                          57.0    5e-07    
gb|KIW60454.1|  hypothetical protein PV05_00669                       59.3    5e-07    
ref|XP_007211922.1|  hypothetical protein PRUPE_ppa010587mg           58.5    5e-07    
ref|XP_009113654.1|  PREDICTED: syntaxin-61-like isoform X3           58.9    5e-07    
ref|XP_003856245.1|  hypothetical protein MYCGRDRAFT_65974            59.3    5e-07    
gb|KJB34885.1|  hypothetical protein B456_006G088600                  58.5    5e-07    
gb|EYE98114.1|  hypothetical protein EURHEDRAFT_400263                59.3    5e-07    
gb|KGK39348.1|  hypothetical protein JL09_g1589                       59.3    5e-07    
gb|KIW01181.1|  hypothetical protein PV09_07464                       59.3    6e-07    
gb|KFY75448.1|  hypothetical protein V499_04573                       59.3    6e-07    
ref|XP_002837830.1|  hypothetical protein                             59.3    6e-07    
ref|XP_002555114.1|  KLTH0G01672p                                     59.3    6e-07    
ref|XP_001591719.1|  hypothetical protein SS1G_07165                  59.3    6e-07    
ref|WP_027268297.1|  hypothetical protein                             55.8    6e-07    
gb|KIW82692.1|  hypothetical protein Z517_05719                       59.3    7e-07    
ref|XP_007743844.1|  regulator-vacuolar morphogenesis                 58.9    7e-07    
ref|XP_010938949.1|  PREDICTED: syntaxin-61-like                      58.2    8e-07    
emb|CDH55400.1|  phox-like protein                                    58.9    8e-07    
dbj|GAM41329.1|  hypothetical protein TCE0_042f14373                  58.9    8e-07    
emb|CDS07615.1|  hypothetical protein LRAMOSA01564                    58.9    8e-07    
ref|XP_001265830.1|  SNARE complex subunit (Vam7), putative           58.9    8e-07    
ref|XP_006456069.1|  hypothetical protein AGABI2DRAFT_77482           58.2    9e-07    
ref|NP_001241250.1|  uncharacterized protein LOC100787129             58.2    9e-07    
ref|XP_001557128.1|  hypothetical protein BC1G_04378                  58.5    9e-07    
ref|XP_007331899.1|  hypothetical protein AGABI1DRAFT_93362           59.3    1e-06    
gb|KIW91048.1|  hypothetical protein Z519_07942                       58.5    1e-06    
ref|XP_006475038.1|  PREDICTED: syntaxin-61-like                      57.8    1e-06    
gb|EKG17311.1|  hypothetical protein MPH_05377                        58.5    1e-06    
ref|NP_956669.1|  syntaxin-8                                          57.8    1e-06    
ref|XP_009842820.1|  hypothetical protein H257_16166                  58.2    1e-06    
gb|EHK41462.1|  hypothetical protein TRIATDRAFT_321677                58.5    1e-06    
ref|XP_007805442.1|  hypothetical protein EPUS_08076                  58.5    1e-06    
ref|XP_007297340.1|  PX domain-containing protein                     58.5    1e-06    
gb|KIK96619.1|  hypothetical protein PAXRUDRAFT_825765                57.4    1e-06    
gb|KFZ12938.1|  hypothetical protein V502_06857                       58.5    1e-06    
ref|XP_009156700.1|  hypothetical protein HMPREF1120_04328            58.5    1e-06    
ref|XP_009113656.1|  PREDICTED: syntaxin-61-like isoform X4           57.8    1e-06    
gb|KFY85141.1|  hypothetical protein V500_08671                       58.2    1e-06    
ref|WP_014844538.1|  hypothetical protein                             55.1    1e-06    
gb|EXX61188.1|  Vam7p                                                 58.2    1e-06    
ref|XP_009300622.1|  PREDICTED: syntaxin-8 isoform X1                 57.8    1e-06    
ref|XP_001804975.1|  hypothetical protein SNOG_14797                  58.2    1e-06    
gb|KHG08114.1|  Syntaxin-61 -like protein                             57.4    1e-06    
ref|XP_001907727.1|  hypothetical protein                             58.2    1e-06    
gb|KIW52063.1|  hypothetical protein PV05_07734                       58.2    2e-06    
ref|XP_009222585.1|  V-SNARE                                          58.2    2e-06    
ref|XP_001551407.1|  hypothetical protein BC1G_10233                  58.2    2e-06    
gb|ESZ98025.1|  hypothetical protein SBOR_1556                        57.8    2e-06    
ref|XP_009113653.1|  PREDICTED: syntaxin-61-like isoform X2           57.4    2e-06    
gb|ACO14773.1|  Syntaxin-8                                            56.6    2e-06    
ref|XP_002487191.1|  SNARE  complex subunit (Syn8), putative          57.4    2e-06    
gb|AFW89304.1|  hypothetical protein ZEAMMB73_776234                  54.3    2e-06    
gb|EEH18379.1|  hypothetical protein PABG_00942                       57.4    2e-06    
ref|XP_003551880.1|  PREDICTED: syntaxin-61                           57.0    2e-06    
ref|XP_002606107.1|  hypothetical protein BRAFLDRAFT_88017            56.6    2e-06    
ref|XP_009113652.1|  PREDICTED: syntaxin-61-like isoform X1           57.4    2e-06    
gb|KDQ23319.1|  hypothetical protein PLEOSDRAFT_52938                 56.6    2e-06    
gb|ACO12656.1|  Syntaxin-8                                            56.2    2e-06    
gb|KJB69576.1|  hypothetical protein B456_011G031000                  57.0    2e-06    
ref|XP_007886703.1|  PREDICTED: syntaxin-8 isoform X3                 56.6    2e-06    
gb|KFY52674.1|  hypothetical protein V496_08260                       58.2    2e-06    
gb|KIX95136.1|  hypothetical protein Z520_09052                       57.4    2e-06    
gb|KIW40133.1|  hypothetical protein PV06_07361                       57.0    2e-06    
ref|XP_007930811.1|  hypothetical protein MYCFIDRAFT_178564           57.4    2e-06    
ref|XP_004363183.1|  syntaxin 8                                       55.8    3e-06    
gb|KIW21033.1|  hypothetical protein PV08_01612                       57.0    3e-06    
gb|KIW31260.1|  hypothetical protein PV07_02923                       57.4    3e-06    
gb|KHC58766.1|  hypothetical protein MGE_04333                        56.6    3e-06    
ref|XP_008868274.1|  hypothetical protein H310_05357                  57.0    3e-06    
gb|KJB69574.1|  hypothetical protein B456_011G031000                  56.6    3e-06    
gb|KIV78564.1|  hypothetical protein PV11_06208                       57.0    3e-06    
gb|EGE84994.1|  SNARE complex subunit                                 57.0    3e-06    
gb|EMT10766.1|  60S ribosomal protein L3                              57.4    3e-06    
ref|XP_004145007.1|  PREDICTED: syntaxin-61-like                      56.6    3e-06    
ref|WP_014842407.1|  hypothetical protein                             53.9    3e-06    
ref|XP_008460099.1|  PREDICTED: syntaxin-61                           56.6    3e-06    
gb|KJB69575.1|  hypothetical protein B456_011G031000                  57.0    3e-06    
gb|KGQ86815.1|  hypothetical protein MEU_04355                        56.2    3e-06    
emb|CDM33993.1|  Target SNARE coiled-coil domain                      57.0    4e-06    
ref|XP_003565128.1|  PREDICTED: syntaxin-61                           56.2    4e-06    
gb|ELR06050.1|  hypothetical protein GMDG_07761                       57.0    4e-06    
ref|XP_010139400.1|  PREDICTED: syntaxin-8                            55.8    4e-06    
ref|XP_010693150.1|  PREDICTED: syntaxin-61                           55.8    5e-06    
ref|XP_007265644.1|  syntaxin                                         56.6    5e-06    
emb|CDY30816.1|  BnaC05g21920D                                        55.8    5e-06    
dbj|GAN11214.1|  conserved hypothetical protein                       55.8    5e-06    
ref|XP_009283487.1|  PREDICTED: syntaxin-8                            55.8    5e-06    
ref|XP_005994381.1|  PREDICTED: syntaxin-10 isoform X1                55.8    5e-06    
dbj|GAD99760.1|  SNARE complex subunit (Vam7), putative               56.6    5e-06    
gb|KDR70265.1|  hypothetical protein GALMADRAFT_255160                55.8    5e-06    
ref|XP_002490634.1|  hypothetical protein                             56.2    6e-06    
ref|XP_009651958.1|  hypothetical protein VDAG_03579                  53.9    6e-06    
ref|XP_007727281.1|  regulator-vacuolar morphogenesis                 56.2    6e-06    
gb|ESZ96756.1|  hypothetical protein SBOR_2900                        56.2    6e-06    
ref|XP_003655374.1|  hypothetical protein THITE_2119033               56.2    6e-06    
dbj|GAM34833.1|  SNARE complex subunit                                55.8    7e-06    
ref|XP_011121561.1|  hypothetical protein AOL_s00076g707              56.2    7e-06    
emb|CDP31873.1|  Putative vacuolar morphogenesis protein 7            56.2    7e-06    
ref|XP_721968.1|  hypothetical protein CaO19.11379                    55.5    7e-06    
ref|XP_006843554.1|  hypothetical protein AMTR_s00007p00074210        54.7    7e-06    
gb|KGQ84655.1|  hypothetical protein MEO_04294                        55.5    7e-06    
ref|XP_009497815.1|  hypothetical protein H696_05726                  54.3    7e-06    
ref|XP_002145360.1|  SNARE  complex subunit (Syn8), putative          55.8    7e-06    
ref|XP_001930523.1|  SNARE complex subunit (Vam7)                     56.2    7e-06    
gb|KFH48913.1|  Vacuolar morphogenesis protein-like protein           55.8    8e-06    
ref|XP_008087215.1|  PX                                               55.8    8e-06    
ref|XP_008805691.1|  PREDICTED: syntaxin-61-like isoform X2           55.5    9e-06    
gb|ELU09551.1|  hypothetical protein CAPTEDRAFT_162904                55.1    9e-06    
ref|XP_008805690.1|  PREDICTED: syntaxin-61-like isoform X1           55.5    9e-06    
ref|XP_010758855.1|  hypothetical protein PADG_03417                  55.5    9e-06    
gb|KHC85498.1|  hypothetical protein I503_04431                       55.1    9e-06    
ref|XP_007758895.1|  regulator-vacuolar morphogenesis                 55.8    9e-06    
gb|EEH09075.1|  V-SNARE                                               55.8    9e-06    
gb|KEQ96015.1|  hypothetical protein AUEXF2481DRAFT_656932            55.8    9e-06    
gb|EER44166.1|  SNARE complex subunit                                 55.8    9e-06    
gb|EMS53312.1|  Syntaxin-61                                           55.5    9e-06    
ref|XP_002151660.1|  SNARE complex subunit (Vam7), putative           55.8    9e-06    
gb|KFX43472.1|  Vacuolar morphogenesis protein 7 like                 55.8    1e-05    
ref|XP_003676483.1|  hypothetical protein NCAS_0E00520                55.8    1e-05    
ref|XP_451073.1|  hypothetical protein                                55.5    1e-05    
ref|XP_003301022.1|  hypothetical protein PTT_12421                   55.8    1e-05    
ref|XP_009092873.1|  PREDICTED: syntaxin-8                            55.1    1e-05    
ref|XP_006574424.1|  PREDICTED: uncharacterized protein LOC100795...  54.7    1e-05    
ref|XP_007375482.1|  hypothetical protein SPAPADRAFT_61289            55.1    1e-05    
ref|XP_003014858.1|  hypothetical protein ARB_07419                   55.5    1e-05    
gb|KFY20159.1|  hypothetical protein V493_07735                       53.9    1e-05    
ref|XP_003023204.1|  hypothetical protein TRV_02667                   55.1    1e-05    
ref|XP_007886701.1|  PREDICTED: syntaxin-8 isoform X1                 55.1    1e-05    
emb|CCX34381.1|  Similar to Vacuolar morphogenesis protein 7 homo...  55.5    1e-05    
ref|XP_002842880.1|  V-SNARE                                          55.1    1e-05    
ref|XP_007721647.1|  hypothetical protein A1O1_02546                  55.1    1e-05    
gb|KDP21907.1|  hypothetical protein JCGZ_03045                       54.7    1e-05    
gb|KIM43594.1|  hypothetical protein M413DRAFT_443509                 55.1    1e-05    
gb|KEY76809.1|  SNARE complex subunit Vam7                            55.5    1e-05    
ref|XP_010912452.1|  PREDICTED: syntaxin-61-like isoform X3           54.7    1e-05    
dbj|GAA96498.1|  hypothetical protein E5Q_03166                       55.5    1e-05    
gb|AAF16768.1|AC010155_21  F3M18.7                                    54.7    1e-05    
ref|NP_001025869.1|  syntaxin-8                                       54.7    1e-05    
ref|XP_008041429.1|  hypothetical protein TRAVEDRAFT_171625           54.7    1e-05    
gb|KFY63045.1|  hypothetical protein V496_04250                       53.5    1e-05    
gb|KEF55470.1|  hypothetical protein A1O9_08220                       55.1    1e-05    
ref|XP_008728386.1|  hypothetical protein G647_05838                  55.1    1e-05    
gb|KIP02422.1|  hypothetical protein PHLGIDRAFT_297239                54.7    1e-05    
ref|XP_003644268.1|  hypothetical protein Ecym_1203                   55.1    2e-05    
ref|XP_005427922.1|  PREDICTED: syntaxin-8                            53.9    2e-05    
gb|KIW97842.1|  hypothetical protein Z519_01426                       54.7    2e-05    
emb|CEP10513.1|  hypothetical protein                                 55.1    2e-05    
ref|XP_007025513.1|  Syntaxin of plants 61                            54.3    2e-05    
ref|XP_001695523.1|  Qc-SNARE protein, Tlg1/Syntaxin 6-family         54.3    2e-05    
gb|KEQ63817.1|  Phox-like protein                                     55.1    2e-05    
gb|EMC88951.1|  Syntaxin-8                                            54.3    2e-05    
ref|XP_010719537.1|  PREDICTED: syntaxin-8 isoform X1                 54.3    2e-05    
dbj|GAD91743.1|  conserved hypothetical protein                       54.7    2e-05    
gb|EZF12034.1|  hypothetical protein H100_06976                       53.9    2e-05    
gb|EYC14993.1|  hypothetical protein Y032_0038g3563                   52.4    2e-05    
gb|EGE05756.1|  V-SNARE                                               54.3    2e-05    
ref|XP_010274513.1|  PREDICTED: syntaxin-61-like                      54.3    2e-05    
ref|XP_010577797.1|  PREDICTED: syntaxin-8                            54.3    2e-05    
gb|EGD95450.1|  SNARE complex subunit Syn8                            54.3    2e-05    
ref|XP_010538187.1|  PREDICTED: syntaxin-61-like                      54.3    2e-05    
ref|XP_003188714.1|  SNARE complex subunit (Vam7)                     54.7    2e-05    
ref|XP_006675157.1|  hypothetical protein BATDEDRAFT_18214            54.7    2e-05    
dbj|GAA85279.1|  SNARE complex subunit                                54.7    2e-05    
ref|XP_008498021.1|  PREDICTED: syntaxin-8                            54.3    2e-05    
ref|XP_003835040.1|  similar to SNARE complex subunit (Vam7)          54.7    2e-05    
gb|EYC14992.1|  hypothetical protein Y032_0038g3563                   52.4    2e-05    
gb|EHA24073.1|  hypothetical protein ASPNIDRAFT_129824                55.1    2e-05    
emb|CAJ81883.1|  syntaxin 8                                           53.1    2e-05    



>ref|XP_011097825.1| PREDICTED: syntaxin-51-like [Sesamum indicum]
Length=235

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQPLTEKE+NRRKDM+A LRSK NQMASTLNMSNFANRD LLGP
Sbjct  56   GTRLDSLQSLLSKLPGKQPLTEKEMNRRKDMVANLRSKVNQMASTLNMSNFANRDSLLGP  115

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN G+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  116  EIKPADAMSRTTGLDNHGIVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  175

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRLQRVQ+RLAILNKRTKGGCSC+C+L+SVIGIVVL+AVIYML K+L
Sbjct  176  LIDDLDQHVEVTDSRLQRVQRRLAILNKRTKGGCSCLCLLLSVIGIVVLVAVIYMLVKYL  235



>ref|XP_011095474.1| PREDICTED: syntaxin-52-like [Sesamum indicum]
Length=233

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ LTEKE+NRR DM+A LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQSLTEKEMNRRADMVANLRSKVNQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+KPVDAMSR NGLDN GVV LQRQIM+EQDEGLEKLEETVISTKHIALAVNEEL L  R
Sbjct  114  EVKPVDAMSRANGLDNQGVVGLQRQIMREQDEGLEKLEETVISTKHIALAVNEELDLHAR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQ+RLAILNKRTKGGCSC+C+++SVIGIVVL+A++YML K+L
Sbjct  174  LIDDLDEHVDVTDSRLQRVQRRLAILNKRTKGGCSCLCLMLSVIGIVVLVALVYMLIKYL  233



>ref|XP_009591371.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591379.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591390.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591398.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
 ref|XP_009591404.1| PREDICTED: syntaxin-51-like [Nicotiana tomentosiformis]
Length=233

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FANRD LLGP
Sbjct  54   GTRLDNLQSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPVDAMSRATGLDNYGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LDEHVDVTDSRLQRVQK+LAILNKRTKGGCSCMC+L+SV+GIVVL+  IYML K+L
Sbjct  174  LIDNLDEHVDVTDSRLQRVQKKLAILNKRTKGGCSCMCLLLSVLGIVVLVVAIYMLIKYL  233



>ref|XP_009786725.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786781.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786839.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
 ref|XP_009786902.1| PREDICTED: syntaxin-51-like [Nicotiana sylvestris]
Length=233

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+SLLSKLP KQPLTEKE+NRRKDMLA L+SK  QMASTLNMS+FANRD LLGP
Sbjct  54   GTRLDNLQSLLSKLPGKQPLTEKEMNRRKDMLANLKSKVTQMASTLNMSSFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPVDAMSRATGLDNYGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LDEHVDVTDSRLQRVQK+LAILNKRTKGGCSCMC+L+SV+G+VVL+  IYML K+L
Sbjct  174  LIDNLDEHVDVTDSRLQRVQKKLAILNKRTKGGCSCMCLLLSVLGMVVLVVAIYMLIKYL  233



>ref|XP_004244081.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum lycopersicum]
Length=233

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRD LLGP
Sbjct  54   GTRLDNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN+GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPVDAMSRATGLDNNGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQ++L ILNKRTKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  174  LIDDLDEHVDVTDSRLQRVQRKLGILNKRTKGGCSCMCMLLAVLGIVILVVAIYMLIKYL  233



>ref|XP_010324299.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum lycopersicum]
Length=238

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRD LLGP
Sbjct  59   GTRLDNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLGP  118

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN+GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  119  EIKPVDAMSRATGLDNNGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  178

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQ++L ILNKRTKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  179  LIDDLDEHVDVTDSRLQRVQRKLGILNKRTKGGCSCMCMLLAVLGIVILVVAIYMLIKYL  238



>ref|XP_006346178.1| PREDICTED: syntaxin-51-like isoform X1 [Solanum tuberosum]
Length=238

 Score =   315 bits (807),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRD LLGP
Sbjct  59   GTRLDNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLGP  118

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  119  EIKPVDAMSRATGLDNYGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  178

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQ++L ILNKRTKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  179  LIDDLDEHVDVTDSRLQRVQRKLGILNKRTKGGCSCMCMLLAVLGIVLLVFAIYMLIKYL  238



>ref|XP_006346179.1| PREDICTED: syntaxin-51-like isoform X2 [Solanum tuberosum]
Length=233

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S+LSKLP KQPL+EKE+NRRKDMLA L+SK +QMASTLNMS+FANRD LLGP
Sbjct  54   GTRLDNLQSILSKLPGKQPLSEKEMNRRKDMLANLKSKVSQMASTLNMSSFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAMSR  GLDN GVV LQRQIMKEQDEGLE LEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPVDAMSRATGLDNYGVVGLQRQIMKEQDEGLESLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQ++L ILNKRTKGGCSCMCML++V+GIV+L+  IYML K+L
Sbjct  174  LIDDLDEHVDVTDSRLQRVQRKLGILNKRTKGGCSCMCMLLAVLGIVLLVFAIYMLIKYL  233



>ref|XP_009625656.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score =   312 bits (800),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDN  VV LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR
Sbjct  114  ETKAADAMSRTTGLDNYSVVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRV ++LAILNKR+KGGCSCMCML+SVIGIV+L+AVIYML K+L
Sbjct  174  LIDDLDEHVDVTDSRLQRVGRKLAILNKRSKGGCSCMCMLLSVIGIVLLVAVIYMLIKYL  233



>ref|XP_002277100.1| PREDICTED: syntaxin-51 [Vitis vinifera]
 emb|CBI26707.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQPLTEKE+NRRKDM+A L+SKANQMASTLNMSNFANRD LLGP
Sbjct  53   GTRLDSLQSLLSKLPGKQPLTEKEMNRRKDMVANLKSKANQMASTLNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAM+RT GLDN G+V LQRQIMKEQDEGLEKLEETV STKHIALAVNEEL L TR
Sbjct  113  EIKPADAMNRTTGLDNYGLVGLQRQIMKEQDEGLEKLEETVYSTKHIALAVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD+HVD+TDSRL+RVQK LAILNKRTKGGCSC+C+L+SV+GIV+LI  I++L K+L
Sbjct  173  LIDNLDQHVDITDSRLKRVQKNLAILNKRTKGGCSCLCLLLSVVGIVILIVAIWLLVKYL  232



>ref|XP_009625654.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625655.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana tomentosiformis]
Length=250

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+ S LP KQ LTEKE+NRRKDMLA L+SKA QMASTLNMSNFANRD LLGP
Sbjct  71   GTRLDSLQSIDSNLPGKQRLTEKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLGP  130

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDN  VV LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR
Sbjct  131  ETKAADAMSRTTGLDNYSVVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  190

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRV ++LAILNKR+KGGCSCMCML+SVIGIV+L+AVIYML K+L
Sbjct  191  LIDDLDEHVDVTDSRLQRVGRKLAILNKRSKGGCSCMCMLLSVIGIVLLVAVIYMLIKYL  250



>ref|XP_009765138.1| PREDICTED: syntaxin-51-like isoform X2 [Nicotiana sylvestris]
Length=233

 Score =   310 bits (793),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDN GVV LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR
Sbjct  114  EKKAADAMSRTTGLDNYGVVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRV ++LA+LNKRTKGGCSC+CML+SVIGIV+L+AVIYML K+L
Sbjct  174  LIDDLDEHVDVTDSRLQRVGRKLAVLNKRTKGGCSCLCMLLSVIGIVLLVAVIYMLIKYL  233



>ref|XP_009765136.1| PREDICTED: syntaxin-51-like isoform X1 [Nicotiana sylvestris]
Length=250

 Score =   310 bits (794),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+ SKLP  + LT+KE+NRRKDMLA L+SKA QMASTLNMSNFANRD LLGP
Sbjct  71   GTRLDSLQSIDSKLPGMERLTKKEMNRRKDMLANLKSKATQMASTLNMSNFANRDSLLGP  130

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDN GVV LQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR
Sbjct  131  EKKAADAMSRTTGLDNYGVVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  190

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRV ++LA+LNKRTKGGCSC+CML+SVIGIV+L+AVIYML K+L
Sbjct  191  LIDDLDEHVDVTDSRLQRVGRKLAVLNKRTKGGCSCLCMLLSVIGIVLLVAVIYMLIKYL  250



>ref|XP_010245902.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245903.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
 ref|XP_010245904.1| PREDICTED: syntaxin-51-like [Nelumbo nucifera]
Length=233

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+LSKLP+KQP+TEKE++RR+DMLA  RSKANQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSILSKLPSKQPITEKEMHRRQDMLANFRSKANQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KP D MSRT GLDN G V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  114  DTKPTDVMSRTTGLDNYGHVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELSLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            L+D LDEHVD TDSRLQR+QKRLAILNKRTKGGCSCMCML++VIGIV+L  VI+ L K+L
Sbjct  174  LLDTLDEHVDSTDSRLQRMQKRLAILNKRTKGGCSCMCMLLAVIGIVILAVVIWALIKYL  233



>ref|XP_010246481.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
 ref|XP_010246482.1| PREDICTED: syntaxin-52-like [Nelumbo nucifera]
Length=233

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP+KQP+TEKE++RR+DMLA L+SKANQMASTLNMSNFANRD L+GP
Sbjct  54   GTRLDSLQSLLSKLPSKQPITEKEMHRRQDMLANLKSKANQMASTLNMSNFANRDSLIGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KP D MSRT GLDN G+V  QRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  114  DKKPADVMSRTTGLDNHGLVGFQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELSLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID LDEHV+ TDSRLQRVQKRLAILNKRTKGGCSCMC+L SVIGIV+L  V++ L K+L
Sbjct  174  LIDTLDEHVESTDSRLQRVQKRLAILNKRTKGGCSCMCLLFSVIGIVILAVVVWALIKYL  233



>gb|EYU27391.1| hypothetical protein MIMGU_mgv1a013014mg [Erythranthe guttata]
Length=233

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SL SKLP KQ L+EKE+NRR+DM+A LRSK  QMAS LNMSNFA RD LLGP
Sbjct  54   GTRLDSLQSLFSKLPGKQSLSEKEMNRRRDMVANLRSKVTQMASALNMSNFAIRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSR  GLDN GVV LQRQIMKEQDEGLE+LEETV+STKHIALAVNEEL L TR
Sbjct  114  EIKQADAMSRATGLDNHGVVGLQRQIMKEQDEGLERLEETVLSTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LDEHV+VTDSRLQRVQ++LAILNKRTKGGCSCMC+L+SVIGI++L+AVIYML K+L
Sbjct  174  LIDNLDEHVEVTDSRLQRVQRKLAILNKRTKGGCSCMCLLISVIGIILLVAVIYMLIKYL  233



>ref|XP_006595709.1| PREDICTED: syntaxin-51-like [Glycine max]
 gb|KHN23883.1| Syntaxin-51 [Glycine soja]
Length=232

 Score =   300 bits (768),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAM+R  GLDN+G+V LQRQIMKEQD+GLE+LEETV STKHIALAVNEEL L TR
Sbjct  114  ERKP-DAMTRMVGLDNNGLVGLQRQIMKEQDDGLEQLEETVASTKHIALAVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIV LI VI++L K+L
Sbjct  173  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVALIVVIWLLVKYL  232



>ref|XP_007146536.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
 gb|ESW18530.1| hypothetical protein PHAVU_006G048900g [Phaseolus vulgaris]
Length=229

 Score =   300 bits (768),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLGNLRTKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  111  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELDLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIVVL+AVI++L K+L
Sbjct  170  LIDDLDEHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVVLVAVIWLLIKYL  229



>gb|ACU19604.1| unknown [Glycine max]
Length=232

 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDML+ LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLSNLRSKVNQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DA +R  GLDN+G+V LQRQIMKEQD+GLE+LEETV STKHIA+AVNEEL L TR
Sbjct  114  ERKP-DATTRMVGLDNNGLVGLQRQIMKEQDDGLEQLEETVASTKHIAVAVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIV LI VI++L K+L
Sbjct  173  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVALIVVIWLLVKYL  232



>gb|AFK34675.1| unknown [Medicago truncatula]
Length=229

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMSRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  170  LIDDLDEHVDVTDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>ref|XP_003600182.1| Syntaxin-52 [Medicago truncatula]
Length=233

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  58   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  114

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  115  EIKP-DAMSRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  174  LIDDLDEHVDVTDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  233



>gb|KEH18882.1| syntaxin of plants protein [Medicago truncatula]
Length=229

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMSRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVD+TDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  170  LIDDLDEHVDITDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>ref|XP_007020672.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 ref|XP_007020674.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12197.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
 gb|EOY12199.1| Syntaxin of plants 51 isoform 2 [Theobroma cacao]
Length=207

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFA+RD LLGP
Sbjct  30   GTRLDGLQSLLSR-PTGRPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFASRDSLLGP  88

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDNSG+V LQRQIMKEQDEGLEKLE TV+STKHIALAVNEEL L T 
Sbjct  89   EIKP-DAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEGTVVSTKHIALAVNEELDLHTS  147

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL RVQK LAILNKRTKGGCSCMCML++VIGIV+L+  IY+L K+L
Sbjct  148  LIDDLDRHVDVTDSRLARVQKNLAILNKRTKGGCSCMCMLLAVIGIVILVVAIYLLIKYL  207



>ref|XP_008447706.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=233

 Score =   295 bits (755),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S L KL  KQP+ EKE+NRR+DM+  LRSKA QMAS LNMSNFANRD LLGP
Sbjct  54   GTRLDTLQSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D M+RT GLDN G+V  QRQIM+EQDEGLEKLE T+ISTKHIALAVNEEL L TR
Sbjct  114  EIKPADVMNRTEGLDNRGLVGFQRQIMREQDEGLEKLEGTIISTKHIALAVNEELNLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQKRLAILNKRTKGGC+CM M++SV+GIVVLIAVI++L K+L
Sbjct  174  LIDDLDEHVDVTDSRLRRVQKRLAILNKRTKGGCTCMSMILSVVGIVVLIAVIWLLVKYL  233



>ref|XP_007020671.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 ref|XP_007020673.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12196.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
 gb|EOY12198.1| Syntaxin of plants 51 isoform 1 [Theobroma cacao]
Length=231

 Score =   295 bits (754),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFA+RD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGRPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFASRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDNSG+V LQRQIMKEQDEGLEKLE TV+STKHIALAVNEEL L T 
Sbjct  113  EIKP-DAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEGTVVSTKHIALAVNEELDLHTS  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL RVQK LAILNKRTKGGCSCMCML++VIGIV+L+  IY+L K+L
Sbjct  172  LIDDLDRHVDVTDSRLARVQKNLAILNKRTKGGCSCMCMLLAVIGIVILVVAIYLLIKYL  231



>gb|AES70433.2| syntaxin of plants protein [Medicago truncatula]
Length=261

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  86   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  142

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  143  EIKP-DAMSRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  201

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  202  LIDDLDEHVDVTDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  261



>gb|KJB81690.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81692.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=231

 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLHSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT G DNSG+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  113  ETK-ADAMSRTVGSDNSGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIVVL+  IY+L K+L
Sbjct  172  LIDDLDQHVEVTDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVVLVVAIYLLIKYL  231



>emb|CDP13772.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 160/180 (89%), Gaps = 9/180 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
             TRL+SL+SLLS+LP KQ LTEKE+NRRKDMLA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   STRLESLQSLLSRLPGKQ-LTEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKPVDAM+R  GLDN GVV        EQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  113  EIKPVDAMTRAKGLDNYGVV--------EQDEGLEKLEETVISTKHIALAVNEELDLHTR  164

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LDEHVDVTDSRLQRVQKRLAILNK+TKGGCSCMC+L+SVIGIVVL+AVIY+L K+L
Sbjct  165  LIDNLDEHVDVTDSRLQRVQKRLAILNKKTKGGCSCMCLLLSVIGIVVLVAVIYLLVKYL  224



>ref|XP_004151390.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 ref|XP_004156357.1| PREDICTED: syntaxin-51-like [Cucumis sativus]
 gb|KGN43995.1| hypothetical protein Csa_7G084710 [Cucumis sativus]
Length=233

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+L+S L KL  KQP+ EKE+NRR+DM+  LRSKA QMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDTLQSQLPKLQGKQPIPEKEMNRRRDMIGNLRSKAKQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D ++RT GLDN G+V  QRQIM+EQDEGLEKLE T+ISTKHIALAVNEEL L TR
Sbjct  114  EIKPADVVNRTEGLDNRGLVGFQRQIMREQDEGLEKLEGTIISTKHIALAVNEELNLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQKRLAILNK+ KGGC+CM M++SV+GIVVLIAVI++L K+L
Sbjct  174  LIDDLDEHVDVTDSRLRRVQKRLAILNKQIKGGCTCMSMILSVVGIVVLIAVIWLLVKYL  233



>gb|KJB11946.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11951.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11952.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
 gb|KJB11953.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=230

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDNSG+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEETVMSTKHIALAVNEELDLHTR  170

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRL+RVQK LAILNKR KG CSCMCML++V+GIV+L+  IY+L K+L
Sbjct  171  LIDDLDEHVDVTDSRLRRVQKNLAILNKRAKGSCSCMCMLLAVVGIVILVVAIYLLVKYL  230



>gb|AFK35227.1| unknown [Medicago truncatula]
Length=229

 Score =   290 bits (741),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 161/180 (89%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NR KD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRCKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAM RT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMGRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVD+TDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV L+ VI++L K+L
Sbjct  170  LIDDLDEHVDITDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVGLVLVIWLLVKYL  229



>ref|XP_006452473.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 ref|XP_006474986.1| PREDICTED: syntaxin-51-like [Citrus sinensis]
 gb|ESR65713.1| hypothetical protein CICLE_v10009364mg [Citrus clementina]
 gb|KDO62148.1| hypothetical protein CISIN_1g026774mg [Citrus sinensis]
Length=233

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDMLA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  D M+R  GLDN G+V  QRQIM+EQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  114  EIKSADVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LAILNKRTKGGC+CMCML++VIGIVVL+ VIYML K+L
Sbjct  174  LIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMLLAVIGIVVLVVVIYMLIKYL  233



>ref|XP_008345031.1| PREDICTED: syntaxin-52-like isoform X3 [Malus domestica]
 ref|XP_008355319.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
Length=231

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRD LLGP
Sbjct  53   GTRLDSLQSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  112  EINKTDAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  172  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>gb|KHG11788.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=238

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 161/187 (86%), Gaps = 9/187 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK-------EQDEGLEKLEETVISTKHIALAVNE  385
            E K  DAMSRT GLDNSG+V LQRQIMK       EQDEGLEKLEETV STKHIALAVNE
Sbjct  113  ETKE-DAMSRTVGLDNSGLVGLQRQIMKGKCLFEAEQDEGLEKLEETVTSTKHIALAVNE  171

Query  384  ELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVI  205
            EL L TRLIDDLD+HVDVTDSRL+RVQK LAILNKRTKGGCSCMCML++VIGIV+L+  I
Sbjct  172  ELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCSCMCMLLAVIGIVILVVAI  231

Query  204  YMLFKFL  184
            Y+L K+L
Sbjct  232  YLLIKYL  238



>ref|XP_008345029.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
 ref|XP_008345030.1| PREDICTED: syntaxin-52-like isoform X2 [Malus domestica]
 ref|XP_008355318.1| PREDICTED: syntaxin-52-like isoform X1 [Malus domestica]
Length=240

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRD LLGP
Sbjct  62   GTRLDSLQSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLGP  120

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  121  EINKTDAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  180

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  181  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>gb|KJB22165.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=231

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 160/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAMSRT GLDNSG+V LQRQIMKEQDE LEKLEET++STKHIALAVNEEL LQTR
Sbjct  113  ESKP-DAMSRTVGLDNSGLVGLQRQIMKEQDEDLEKLEETIVSTKHIALAVNEELDLQTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDV+DSRL+RVQK LA+LN+RT+  CSCMCML++VIGIV+L  +IY+L K+L
Sbjct  172  LIDDLDQHVDVSDSRLRRVQKNLAVLNRRTRDSCSCMCMLLAVIGIVILAVIIYLLIKYL  231



>gb|KDP39206.1| hypothetical protein JCGZ_00963 [Jatropha curcas]
Length=233

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+KLP KQ ++EKE+NRRKDM+A LR+K NQMAS+LNMSNFA+RD L GP
Sbjct  54   GTRLDSLQSLLTKLPGKQQVSEKEMNRRKDMVANLRTKVNQMASSLNMSNFAHRDSLFGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAM RT GLDN GVV LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L +R
Sbjct  114  EIKPADAMRRTEGLDNHGVVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHSR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LAILNKRTKGGCSC+CML+S +G+V L+ VIY+L K+L
Sbjct  174  LIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCSCLCMLLSFVGVVGLVVVIYLLIKYL  233



>ref|XP_010099994.1| hypothetical protein L484_014031 [Morus notabilis]
 gb|EXB81099.1| hypothetical protein L484_014031 [Morus notabilis]
Length=223

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 155/180 (86%), Gaps = 8/180 (4%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+S+L+KLP KQP++EKE+NRRKDMLA LRSK NQMAS LNMSNFANRD LLGP
Sbjct  52   GTRLDGLQSILTKLPGKQPISEKEMNRRKDMLANLRSKVNQMASALNMSNFANRDSLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GL+NSGVV        EQDEGLEKLEETV+STKHIALAVNEEL L  R
Sbjct  112  EIKPADAMSRTVGLENSGVV--------EQDEGLEKLEETVVSTKHIALAVNEELDLHAR  163

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA LNKRTKGGCSCMCML SV+GIV L+AVI++L K+L
Sbjct  164  LIDDLDYHVDVTDSRLRRVQKSLAFLNKRTKGGCSCMCMLSSVLGIVGLVAVIFLLVKYL  223



>ref|XP_009361064.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRD LLG 
Sbjct  53   GTRLDSLQSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLGS  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  112  EINKTDAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  172  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_009361063.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ ++EKE+NRRKDM+  LRSK  QMASTL  SN +NRD LLG 
Sbjct  62   GTRLDSLQSLLSKLPGKQHISEKEMNRRKDMIGNLRSKVKQMASTLT-SNSSNRDSLLGS  120

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  121  EINKTDAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  180

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  181  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>ref|XP_007211870.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13069.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=232

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM++TL  S+ ANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPISEKELNRRKDMIGTLRSKVLQMSTTLT-SHSANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L  R
Sbjct  113  EINKADAMGRTVGLDNYGLVGLQRQVMKEQDEGLEKLEETVVSTKHIALAVNEELDLHAR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  173  LIDDLDEHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  232



>ref|XP_009343644.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=240

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG 
Sbjct  62   GTRLDSLQSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLGS  120

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  121  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEELDLHTR  180

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  181  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>ref|XP_009343645.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343646.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG 
Sbjct  53   GTRLDSLQSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLGS  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  172  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_009334173.1| PREDICTED: syntaxin-52-like isoform X3 [Pyrus x bretschneideri]
Length=231

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG 
Sbjct  53   GTRLDSLQSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLGS  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEE+ L TR
Sbjct  112  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEEIDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  172  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  231



>ref|XP_010060271.1| PREDICTED: syntaxin-51-like isoform X2 [Eucalyptus grandis]
Length=232

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RD LLGPE
Sbjct  55   TRLDSLQNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLGPE  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP DAMSRT GLDN G+V LQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  114  IKPADAMSRTAGLDNQGIVVLQRQVMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRL  173

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ID+LD+HVDVTDSRL+RVQK LAILNKRTKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  174  IDNLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMILSVIGIVILVVAVYLLIKFL  232



>ref|XP_009334172.1| PREDICTED: syntaxin-52-like isoform X2 [Pyrus x bretschneideri]
Length=240

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG 
Sbjct  62   GTRLDSLQSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLGS  120

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEE+ L TR
Sbjct  121  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEEIDLHTR  180

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  181  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  240



>gb|KCW66896.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=234

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RD LLGPE
Sbjct  57   TRLDSLQNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLGPE  115

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP DAMSRT GLDN G+V LQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  116  IKPADAMSRTAGLDNQGIVVLQRQVMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRL  175

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ID+LD+HVDVTDSRL+RVQK LAILNKRTKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  176  IDNLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMILSVIGIVILVVAVYLLIKFL  234



>ref|XP_007211871.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
 gb|EMJ13070.1| hypothetical protein PRUPE_ppa010128mg [Prunus persica]
Length=262

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM++TL  S+ ANRD LLGP
Sbjct  84   GTRLDSLQSLLSKLPGKQPISEKELNRRKDMIGTLRSKVLQMSTTLT-SHSANRDSLLGP  142

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L  R
Sbjct  143  EINKADAMGRTVGLDNYGLVGLQRQVMKEQDEGLEKLEETVVSTKHIALAVNEELDLHAR  202

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  203  LIDDLDEHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  262



>ref|XP_010060270.1| PREDICTED: syntaxin-51-like isoform X1 [Eucalyptus grandis]
Length=242

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RD LLGPE
Sbjct  65   TRLDSLQNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLGPE  123

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP DAMSRT GLDN G+V LQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  124  IKPADAMSRTAGLDNQGIVVLQRQVMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRL  183

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ID+LD+HVDVTDSRL+RVQK LAILNKRTKGGC+CMCM++SVIGIV+L+  +Y+L KFL
Sbjct  184  IDNLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMILSVIGIVILVVAVYLLIKFL  242



>ref|XP_006344878.1| PREDICTED: syntaxin-52-like [Solanum tuberosum]
Length=238

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            G RLD L+S+ SKLP KQ LTEKE+NRRKDMLA L+SKA +MASTLNMSNFANRD LLGP
Sbjct  59   GFRLDILQSIDSKLPGKQHLTEKEMNRRKDMLANLKSKAAEMASTLNMSNFANRDSLLGP  118

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DA SRT GLDN GVV LQRQIMKEQDEGLEKLEE+++S KHIALAVNEEL LQTR
Sbjct  119  ETKAADATSRTTGLDNYGVVGLQRQIMKEQDEGLEKLEESMMSFKHIALAVNEELDLQTR  178

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LI  LDEHVDVTDSRLQRV +++ ILNKRTK GCSC+CML+SVIGIV+L+A+IYML K+L
Sbjct  179  LIATLDEHVDVTDSRLQRVGRKVGILNKRTKCGCSCLCMLLSVIGIVLLVALIYMLIKYL  238



>ref|XP_008227024.1| PREDICTED: syntaxin-52-like [Prunus mume]
Length=232

 Score =   282 bits (721),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQP++EKE+NRRKDM+ TLRSK  QM+STL  S+ ANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPISEKELNRRKDMIGTLRSKVVQMSSTLT-SHSANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L   
Sbjct  113  EINKADAMGRTVGLDNYGLVGLQRQVMKEQDEGLEKLEETVVSTKHIALAVNEELDLHAA  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+ V+GIVVL+AVI++L K+L
Sbjct  173  LIDDLDQHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLCVVGIVVLLAVIFLLIKYL  232



>gb|AFK40726.1| unknown [Lotus japonicus]
Length=233

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 2/181 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLG  547
            GTRLDSL+SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+NRD L G
Sbjct  54   GTRLDSLQSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSNRDSLFG  113

Query  546  PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQT  367
            PEIKP DAMSRTNGLDN GV+ LQRQIMKEQDEGLEKLEE+V STKHIALAVNEEL L T
Sbjct  114  PEIKP-DAMSRTNGLDNKGVIGLQRQIMKEQDEGLEKLEESVTSTKHIALAVNEELDLHT  172

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  187
             LIDDLD+HVDVTDSRL+RVQK LA+LNKRT GGCSC+CML+SVIGI VL+ VI +L K+
Sbjct  173  SLIDDLDQHVDVTDSRLRRVQKNLAVLNKRTNGGCSCLCMLLSVIGIAVLVVVIGLLVKY  232

Query  186  L  184
            L
Sbjct  233  L  233



>ref|XP_008449105.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449106.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449108.1| PREDICTED: syntaxin-51-like [Cucumis melo]
 ref|XP_008449109.1| PREDICTED: syntaxin-51-like [Cucumis melo]
Length=231

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT++D L+SLLSKLP KQPL+EKEINRRKDML  +RS+  QMASTLNMSNFANRD LLGP
Sbjct  53   GTKVDGLQSLLSKLPVKQPLSEKEINRRKDMLIQMRSEVKQMASTLNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+K VD MS+T  LDN G+V  QRQIMKEQDEGLEKLEET+ISTKHIALAVNEEL L TR
Sbjct  113  EMKSVDVMSKTAELDNQGLVGFQRQIMKEQDEGLEKLEETIISTKHIALAVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYML  196
            LIDDLD+HVDV DSRL RVQKRL I+NKR KG CSC  ML+SV+GIVVLI VI++L
Sbjct  173  LIDDLDQHVDVIDSRLARVQKRLGIMNKRAKGSCSCFGMLLSVVGIVVLITVIWLL  228



>emb|CDX88551.1| BnaC06g39950D [Brassica napus]
Length=233

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAM+R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  ETKPDDAMNRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LI+DLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIEDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_009334171.1| PREDICTED: syntaxin-52-like isoform X1 [Pyrus x bretschneideri]
Length=287

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRD LLG 
Sbjct  109  GTRLDSLQSLLSKLPEKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDSLLGS  167

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEE+ L TR
Sbjct  168  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEEIDLHTR  227

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HV+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+GIVVLIAVI++L K+L
Sbjct  228  LIDDLDDHVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGIVVLIAVIFLLIKYL  287



>ref|XP_009128371.1| PREDICTED: syntaxin-52 isoform X1 [Brassica rapa]
 ref|XP_009128374.1| PREDICTED: syntaxin-52 isoform X3 [Brassica rapa]
Length=236

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRD LLGP
Sbjct  57   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLGP  116

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KP DA++R +G+DN G+V  QRQIM+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  117  DTKPDDAINRVSGMDNQGIVGFQRQIMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  176

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  177  LIDDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  236



>gb|KHG00459.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=237

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 9/187 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK-------EQDEGLEKLEETVISTKHIALAVNE  385
            E K  DAMSRT GLDNSG+V LQRQIMK       EQDEGLEKLEETV+S KHIALAVNE
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMKGKVCFQAEQDEGLEKLEETVMSAKHIALAVNE  170

Query  384  ELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVI  205
            EL L TRLIDDLD+HVDVTDSRL+RVQK LAILNKR KG CSCMCML++V+GIV+L+  I
Sbjct  171  ELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKRAKGSCSCMCMLLAVVGIVILVVAI  230

Query  204  YMLFKFL  184
            Y++ K+L
Sbjct  231  YLVVKYL  237



>ref|XP_009128372.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 ref|XP_009128373.1| PREDICTED: syntaxin-52 isoform X2 [Brassica rapa]
 emb|CDY49743.1| BnaA02g19290D [Brassica napus]
Length=234

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRD LLGP
Sbjct  55   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLGP  114

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KP DA++R +G+DN G+V  QRQIM+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  115  DTKPDDAINRVSGMDNQGIVGFQRQIMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  174

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  175  LIDDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  234



>ref|XP_004149588.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
 ref|XP_004161879.1| PREDICTED: syntaxin-52-like [Cucumis sativus]
Length=233

 Score =   279 bits (714),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT++D L+SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFANRD LLGP
Sbjct  54   GTKVDGLQSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+K  D MS+T  LDN G+V  QR+IMKEQDEGLEKLEET+ STKHIALAVNEEL L TR
Sbjct  114  EMKSADVMSKTAELDNQGLVGFQRKIMKEQDEGLEKLEETITSTKHIALAVNEELSLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDS+L RVQKRL I+NKR KG CSC  ML+SV+GIVVLI VI++L ++L
Sbjct  174  LIDDLDQHVDVTDSQLARVQKRLGIMNKRAKGSCSCFGMLLSVVGIVVLITVIWLLVQYL  233



>ref|XP_007142350.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 ref|XP_007142351.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14344.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
 gb|ESW14345.1| hypothetical protein PHAVU_008G273200g [Phaseolus vulgaris]
Length=232

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+NRD LLGP
Sbjct  54   GTRLDSLQSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSNRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAM+RT G+DN+G+V  QRQ+MKEQDEGLE+LEET+ STKHIALAVNEELGL TR
Sbjct  114  EGKP-DAMARTVGMDNNGLVGFQRQLMKEQDEGLEQLEETIASTKHIALAVNEELGLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID LD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SV+GIV+L+ VI++L K+L
Sbjct  173  LIDGLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVVGIVLLVIVIWLLVKYL  232



>ref|XP_010675821.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=234

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLLSK P+K+ +TEKE+N RKDML+ LR+K NQMA+TLNMSNFANRD LLGP
Sbjct  55   GTRLDSLESLLSKPPSKKSITEKELNHRKDMLSNLRTKTNQMATTLNMSNFANRDSLLGP  114

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KPVDAM+R  GLDN G+V+LQRQIM+EQDEGLE+LEETV+STKHIAL VNEEL L TR
Sbjct  115  ESKPVDAMTRVAGLDNQGIVSLQRQIMREQDEGLEQLEETVMSTKHIALTVNEELELHTR  174

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD+HV+ T SRLQR+ + LA LNK+TKGGCSC+C+L++V GIV+LI  I++L K+L
Sbjct  175  LIDNLDQHVEFTGSRLQRISRSLANLNKKTKGGCSCLCLLVAVAGIVILILAIFVLIKYL  234



>ref|XP_004491440.1| PREDICTED: syntaxin-52-like isoform X1 [Cicer arietinum]
Length=232

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+KP D M+R  GLDN+G+V  QRQ+MKEQDEGLE LE+TVISTKHIALAVNEELGL TR
Sbjct  114  EVKP-DVMNRIVGLDNNGLVGFQRQVMKEQDEGLESLEQTVISTKHIALAVNEELGLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLD+HVDVTDSRL+RVQK LAILNKRTKGGCSC CML+S
Sbjct  173  LIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCSCFCMLLS  214



>ref|XP_009117773.1| PREDICTED: syntaxin-51-like [Brassica rapa]
Length=233

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRD LLG 
Sbjct  55   GTRLDSLQSLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLGS  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D MSR + +DN G+V  QRQ+MKEQDEGLEKLEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPDDTMSRVSSMDNQGIVGFQRQVMKEQDEGLEKLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  233



>ref|XP_006302763.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
 gb|EOA35661.1| hypothetical protein CARUB_v10020885mg [Capsella rubella]
Length=233

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ +++KE+NRRKDM+A LRSK NQ+ASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKQNVSDKEMNRRKDMVANLRSKTNQVASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP DA++R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DIKPDDALNRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVD TDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDATDSRLRRVQKSLAVMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>gb|KHM99515.1| Syntaxin-51 [Glycine soja]
Length=234

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFANRD LLGP
Sbjct  59   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFANRDSLLGP  115

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  116  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  174

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  175  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  234



>ref|XP_003532151.1| PREDICTED: syntaxin-51-like isoform X1 [Glycine max]
 ref|XP_006586106.1| PREDICTED: syntaxin-51-like isoform X2 [Glycine max]
Length=228

 Score =   277 bits (709),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDMLA LR+K NQMASTLNMSNFANRD LLGP
Sbjct  53   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLANLRTKVNQMASTLNMSNFANRDSLLGP  109

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  110  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  168

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  169  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  228



>ref|XP_010472824.1| PREDICTED: syntaxin-52 [Camelina sativa]
Length=233

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP DAM R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DIKPDDAMKRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKSLAVMNKSMKSGCSCMSMLISVLGIVGLALVIWLLVKYL  233



>ref|XP_010429855.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKQNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP DAM R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DIKPDDAMKRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKSLAVMNKSMKSGCSCMSMLISVLGIVGLALVIWLLVKYL  233



>ref|XP_006389870.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 ref|XP_006389871.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27156.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
 gb|ESQ27157.1| hypothetical protein EUTSA_v10019084mg [Eutrema salsugineum]
Length=233

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL KLP KQ ++EKE+NRRKDM+  LR KANQ+AS LNMSNFANRD L GP
Sbjct  54   GTRLDSLQSLLVKLPGKQHVSEKEMNRRKDMVGNLRIKANQVASALNMSNFANRDSLFGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+KP DAM+R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  EMKPDDAMNRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD HVDVTDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDELDYHVDVTDSRLRRVQKSLAVMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>gb|EPS71742.1| hypothetical protein M569_03017, partial [Genlisea aurea]
Length=245

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 13/193 (7%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL  + ++ P  Q L+EKE+NRR+D+++ LRSK NQMA++LNMSNFANRD LLGP
Sbjct  53   GTRLDSLSQVSARSPGNQSLSEKELNRRRDLVSGLRSKVNQMAASLNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK-------------EQDEGLEKLEETVISTKHI  403
            E K  DA+ R NGLDN G+V+LQRQIM+             EQDEGLEKLEETV+STKHI
Sbjct  113  ETKSADAIGRANGLDNHGIVSLQRQIMRGKFPNFVFTISTAEQDEGLEKLEETVMSTKHI  172

Query  402  ALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIV  223
            ALAVNEEL L TRLID+LDEHVDVTDSRL+RVQKRLAILNKRTK GCSC CM++SVIGIV
Sbjct  173  ALAVNEELDLHTRLIDNLDEHVDVTDSRLKRVQKRLAILNKRTKAGCSCFCMMLSVIGIV  232

Query  222  VLIAVIYMLFKFL  184
             LI VIY+L K+L
Sbjct  233  ALIGVIYLLVKYL  245



>emb|CDY52847.1| BnaA09g56390D [Brassica napus]
Length=233

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRD LLG 
Sbjct  55   GTRLDSLQSLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLGS  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D MSR + +DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPDDTMSRVSSMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  233



>ref|XP_011461087.1| PREDICTED: syntaxin-52-like [Fragaria vesca subsp. vesca]
Length=232

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S LS LP KQ +T KE+NRRKDM+A L+SK +QM+STL  S+  NRD LLGP
Sbjct  54   GTRLDSLQSELSTLPGKQHITAKEMNRRKDMIANLKSKVSQMSSTLT-SHSGNRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQ+MKEQDEGL++LEETV+STKHIALAVNEEL L TR
Sbjct  113  EISKADAMGRTAGLDNYGLVGLQRQVMKEQDEGLDRLEETVVSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLDEHVDVTDSRLQRVQK LA LNKRTKGGCSCMCML++V+GIV L+AVI++L K+L
Sbjct  173  LIDDLDEHVDVTDSRLQRVQKNLAALNKRTKGGCSCMCMLLAVLGIVGLVAVIFLLIKYL  232



>ref|XP_003551745.1| PREDICTED: syntaxin-52-like isoform X1 [Glycine max]
Length=229

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRD L GP
Sbjct  54   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  111  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  170  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>ref|XP_010459159.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT+LDSL+SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRD LLGP
Sbjct  54   GTKLDSLQSLLAQVHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D+MSR  G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIA+AV EEL LQTR
Sbjct  113  EIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEKLEETVMSTKHIAMAVGEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRLQRVQK+LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  173  LIDDLDYHVDVTDSRLQRVQKQLAVMNKNMKSGCSCMAMLLSVLGIVGLAVVIWLLVKYL  232



>ref|XP_010537838.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
 ref|XP_010537839.1| PREDICTED: syntaxin-51 [Tarenaya hassleriana]
Length=233

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+K+P KQP++EKE+NRRKDM+  LRSKANQMAS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLAKIPGKQPISEKEMNRRKDMIGNLRSKANQMASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSR +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  EIKPADAMSRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELDLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLD HVDVTDSRL+RVQK LA +NKR +GGCSC+ ML+S
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKSLAFMNKRMRGGCSCISMLLS  215



>gb|AFK40910.1| unknown [Lotus japonicus]
Length=229

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 4/162 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMSRTAGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLDEHVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML++
Sbjct  170  LIDDLDEHVDVTDSRLRRVQKHLAVLNKRTKGGCSCLCMLLA  211



>ref|XP_004500114.1| PREDICTED: syntaxin-52-like [Cicer arietinum]
Length=229

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 148/162 (91%), Gaps = 4/162 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDNSG+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMSRTVGLDNSGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLDEHVDVTDSRL+RVQK LAILNKRTKGGCSC+CML+S
Sbjct  170  LIDDLDEHVDVTDSRLRRVQKNLAILNKRTKGGCSCLCMLLS  211



>ref|XP_010647220.1| PREDICTED: syntaxin-51-like [Vitis vinifera]
Length=233

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL KLP KQP+TEKE+NRRKDML+ LRSK +QMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLLKLPGKQPITEKEMNRRKDMLSNLRSKVSQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN G+V LQRQIMKEQDEGL+ LEETVISTKHIALAVNEEL L TR
Sbjct  114  EIKPADAMSRTTGLDNQGLVGLQRQIMKEQDEGLDNLEETVISTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCM  247
            LID LD+HVD TDSRL RVQK LAILNKRTKGGC+C CM
Sbjct  174  LIDTLDQHVDTTDSRLGRVQKNLAILNKRTKGGCTCFCM  212



>gb|KHN30881.1| Syntaxin-51 [Glycine soja]
Length=229

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 161/180 (89%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDML  LR+K NQMASTLNMSNFANRD L GP
Sbjct  54   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLLNLRTKVNQMASTLNMSNFANRDSLFGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  111  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  170  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>ref|XP_006602182.1| PREDICTED: syntaxin-52-like isoform X2 [Glycine max]
Length=251

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRD L GP
Sbjct  76   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFGP  132

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  133  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  191

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDSRL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  192  LIDDLDQHVDVTDSRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  251



>ref|XP_002887794.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64053.1| hypothetical protein ARALYDRAFT_477131 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKIPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP DA++R +G+DN G+V  QRQIM+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DIKPDDAINRVSGMDNQGIVGFQRQIMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD  VDVTDSRL+RVQK LA++NK  K GCSCM M++SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYQVDVTDSRLRRVQKSLAVMNKSMKSGCSCMSMVLSVLGIVGLALVIWLLVKYL  233



>ref|XP_010476728.1| PREDICTED: syntaxin-51 [Camelina sativa]
Length=232

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT+LDSL+SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFANRD LLGP
Sbjct  54   GTKLDSLQSLLAQIHGK-PISEKEMNRRKDMVGNLRSKSNQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D+MSR  G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIA+AV EEL LQTR
Sbjct  113  EIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEKLEETVMSTKHIAMAVGEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRLQRVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  173  LIDDLDYHVDVTDSRLQRVQKNLAVMNKNMKSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  232



>ref|XP_010417628.1| PREDICTED: syntaxin-52-like [Camelina sativa]
Length=233

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P K  +++KE+NRRKDM+  LRSK NQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKLNVSDKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP DAM R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DIKPDDAMKRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVDVTDSRLRRVQKSLAVMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|XP_009416129.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416130.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSLESLLSKLP+ QP+ +K++++R++MLA ++SKANQMASTLNMSNF NR+ L G  
Sbjct  55   TRLDSLESLLSKLPSMQPIKDKDLHKRQEMLANMKSKANQMASTLNMSNFGNREDLFGDG  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IK  D MSRT+GLDN G+VALQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  115  IKSADVMSRTSGLDNQGIVALQRQVMREQDEGLEKLEETVLSTKHIALAVNEELDLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L+ V ++L K+L
Sbjct  175  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILVIVAWLLIKYL  233



>ref|XP_010497722.1| PREDICTED: syntaxin-51-like [Camelina sativa]
 ref|XP_010497725.1| PREDICTED: syntaxin-51-like [Camelina sativa]
Length=232

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT+LDSL+SLL+++  K P++EKE+NRRKDM+  LRSK+NQMA+ LNMSNFANRD LLGP
Sbjct  54   GTKLDSLQSLLAQIHGK-PVSEKEMNRRKDMVGNLRSKSNQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D+MSR  G+DN G+V  QRQ+M+EQDEGLE+LEETV+STKHIA+AV EEL LQTR
Sbjct  113  EIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLERLEETVMSTKHIAMAVGEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRLQRVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  173  LIDDLDYHVDVTDSRLQRVQKHLAVMNKNMKSGCSCMSMLLSVLGIVGLAVVIWLLVKYL  232



>gb|ACU23148.1| unknown [Glycine max]
Length=229

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 4/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSK+P K   TEKE+NRRKDML+ LR+K NQMASTLNMSNFANRD L GP
Sbjct  54   GTRLDSLQSLLSKVPAK---TEKEMNRRKDMLSNLRTKVNQMASTLNMSNFANRDSLFGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TR
Sbjct  111  EIKS-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLEETVISTKHIALAVNEELNLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTD RL+RVQK LA+LNKRTKGGCSC+CML+SVIGIV L+ VI++L K+L
Sbjct  170  LIDDLDQHVDVTDFRLRRVQKNLAVLNKRTKGGCSCLCMLLSVIGIVGLVVVIWLLVKYL  229



>emb|CDY68585.1| BnaAnng27700D [Brassica napus]
Length=236

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRD LLGP
Sbjct  56   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLGP  115

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK-EQDEGLEKLEETVISTKHIALAVNEELGLQT  367
            + KP DA++R +G+DN G+V  QRQIM+ EQDEGLEKLEETV+S+KHIALAVNEEL LQT
Sbjct  116  DTKPDDAINRVSGMDNQGIVGFQRQIMRVEQDEGLEKLEETVMSSKHIALAVNEELTLQT  175

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  187
            RLIDDLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GI  L  VI++L K+
Sbjct  176  RLIDDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIAGLALVIWLLVKY  235

Query  186  L  184
            +
Sbjct  236  M  236



>ref|XP_010063061.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 ref|XP_010063062.1| PREDICTED: syntaxin-52-like [Eucalyptus grandis]
 gb|KCW70249.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70250.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=233

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN   RD LLGP
Sbjct  54   GTRLDSLQSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSNSRIRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KP DAMSRT GLDN G+V LQRQ+MKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  114  DAKPADAMSRTVGLDNQGIVGLQRQVMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID LD+ VDVTDSRL+RVQK LAILNKR KG C+CM ML++VI IV+L+  IY++ K++
Sbjct  174  LIDSLDQQVDVTDSRLRRVQKNLAILNKRMKGSCTCMSMLLAVIAIVILVVAIYLVIKYV  233



>ref|XP_008787642.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=232

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT+LDSLESLLSKLP+KQP++ KE+++R+DML+ LRSKA QMASTLNMSNFA R+ LLG 
Sbjct  54   GTKLDSLESLLSKLPSKQPISNKELHKRRDMLSNLRSKAKQMASTLNMSNFAKREDLLG-  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D ++RT GLDN GVV LQRQIM+EQDEGLE+LEETV+STKHIAL VNEEL L TR
Sbjct  113  QSKSTDEINRTAGLDNHGVVGLQRQIMREQDEGLERLEETVLSTKHIALTVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD HVD+T SRLQRVQ+RLAILNKRTKGGCSCMC+L+SV+ +V+L  +++ L K+L
Sbjct  173  LIDNLDHHVDLTGSRLQRVQRRLAILNKRTKGGCSCMCLLLSVVAMVILAVIVWALIKYL  232



>emb|CDX81754.1| BnaC08g38470D [Brassica napus]
Length=233

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMA+TLNMSNFANRD LLG 
Sbjct  55   GTRLDSLQSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMANTLNMSNFANRDSLLGS  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D +SR + +DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEELGLQTR
Sbjct  114  EIKPDDTLSRVSSMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELGLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HV+VTDSRL+RVQK LA++NK  + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  174  LIDDLDYHVEVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  233



>emb|CDX87371.1| BnaA07g35020D [Brassica napus]
Length=526

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSKANQ+AS LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKANQVASALNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAM+R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  ETKPDDAMNRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LI+DLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIEDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>gb|AFK34174.1| unknown [Lotus japonicus]
Length=233

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 147/163 (90%), Gaps = 2/163 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLG  547
            GTRLDSL+SLLSKLP  KQP++EKE+NRRKDMLA+LRS+ N+MASTL+M NF+NRD L G
Sbjct  54   GTRLDSLQSLLSKLPAGKQPVSEKELNRRKDMLASLRSRVNEMASTLSMPNFSNRDSLFG  113

Query  546  PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQT  367
            PEIKP DAMSRTNGLDN GV+ LQRQIMKEQDEGLEKLEE+V STKHIALAVNEEL L T
Sbjct  114  PEIKP-DAMSRTNGLDNKGVIGLQRQIMKEQDEGLEKLEESVTSTKHIALAVNEELDLHT  172

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
             LIDDLD+HVD TDSRL+RVQK LA+LNKRT GGCSC+CML+S
Sbjct  173  SLIDDLDQHVDATDSRLRRVQKNLAVLNKRTNGGCSCLCMLLS  215



>emb|CDY33349.1| BnaC05g12340D [Brassica napus]
Length=232

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRL+SL SLLSK+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFANRD LLG 
Sbjct  54   GTRLESLHSLLSKIHGK-PISEKEMNRRKDMIGNLRSQANQMASVLNMSNFANRDSLLGS  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  D+MSR   +DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEELGLQTR
Sbjct  113  EIKADDSMSRVASMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELGLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  173  LIDDLDYHVDVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  232



>ref|XP_009149057.1| PREDICTED: syntaxin-51 [Brassica rapa]
 emb|CDY35073.1| BnaA06g10830D [Brassica napus]
Length=232

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRL+SL+SLL+K+  K P++EKE+NRRKDM+  LRS+ANQMAS LNMSNFANRD LLG 
Sbjct  54   GTRLESLQSLLAKIHGK-PISEKEMNRRKDMIGNLRSQANQMASALNMSNFANRDSLLGS  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIK  D+MSR   +DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEELGLQTR
Sbjct  113  EIKADDSMSRVASMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELGLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+S++GIV L  VI++L K+L
Sbjct  173  LIDDLDYHVDVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSMLGIVGLAVVIWLLVKYL  232



>gb|KGN56069.1| hypothetical protein Csa_3G064180 [Cucumis sativus]
Length=230

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT++D L+SLL KLP KQPL+EKEINRRKDML  +RSK  QMASTLNMSNFANRD LLGP
Sbjct  54   GTKVDGLQSLLLKLPVKQPLSEKEINRRKDMLVQMRSKVKQMASTLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+K  D MS+T  LDN G+V  QR+IMKEQDEGLEKLEET+ STKHIALAVNEEL L TR
Sbjct  114  EMKSADVMSKTAELDNQGLVGFQRKIMKEQDEGLEKLEETITSTKHIALAVNEELSLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVTDS+L    KRL I+NKR KG CSC  ML+SV+GIVVLI VI++L ++L
Sbjct  174  LIDDLDQHVDVTDSQL---AKRLGIMNKRAKGSCSCFGMLLSVVGIVVLITVIWLLVQYL  230



>ref|XP_009106789.1| PREDICTED: syntaxin-52-like [Brassica rapa]
Length=232

 Score =   268 bits (684),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+ +LRSKAN++AS LNMSNFANRD LLGP
Sbjct  53   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGSLRSKANKVASALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAM+R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  113  ETKPDDAMNRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAV  208
            LI+DLD HVDVTDSRL+RVQK LA++NK  KGGCSCM ML+SV+GIV L  V
Sbjct  173  LIEDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALV  224



>ref|XP_004976388.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=231

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL+++P K  +T+KE+++R+DML+ L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLLTRIPPKS-ITDKEMHKRQDMLSNLKSKAKQMATSFNMSNFANREDLLG-  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  QSKKADDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SVI IV+L  ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVIAIVILAVIVWLLVKYL  231



>gb|KHG18509.1| Syntaxin-51 -like protein [Gossypium arboreum]
Length=223

 Score =   266 bits (681),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 153/180 (85%), Gaps = 10/180 (6%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAMSRT G+DNSG+V        EQDE LEKLEET++STKHIALAVNEEL LQTR
Sbjct  113  ESKP-DAMSRTVGVDNSGLV--------EQDEDLEKLEETIVSTKHIALAVNEELDLQTR  163

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDV+DSRL+RVQK LA+LN+RT+  CSCMCML++VIGIV+L  VIY+L K+L
Sbjct  164  LIDDLDQHVDVSDSRLRRVQKNLAVLNRRTRDSCSCMCMLLAVIGIVILAVVIYLLIKYL  223



>ref|XP_010909005.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=232

 Score =   267 bits (682),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GT+LDSLESLLSKLP+KQP+++KE+ +R+DML+ LRSKA QMASTLNMSNFANR+ LLG 
Sbjct  54   GTKLDSLESLLSKLPSKQPISDKELLKRQDMLSNLRSKAKQMASTLNMSNFANREDLLG-  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D ++RT GLDN GVV LQRQIM+EQDEGL +LEETV+STKHIAL VNEEL L T+
Sbjct  113  QSKSTDEINRTAGLDNYGVVGLQRQIMREQDEGLGRLEETVLSTKHIALTVNEELDLHTK  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD H D+T+SRLQRVQ+RLAILNKRTKGGCSCMC+L SV+ IV+L  +++ L K+L
Sbjct  173  LIDNLDHHADLTNSRLQRVQRRLAILNKRTKGGCSCMCLLSSVVAIVILAVIVWALIKYL  232



>ref|XP_006659260.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE+LLSK+P K  LT+KE+++R+D L+ L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLEALLSKIPPK-TLTDKELHKRQDTLSNLKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V LQRQ MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKAADDMSRVAGLDNQGIVGLQRQTMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L  ++++L ++L
Sbjct  173  LIDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIRYL  232



>ref|XP_006416838.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 ref|XP_006416839.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35191.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
 gb|ESQ35192.1| hypothetical protein EUTSA_v10008662mg [Eutrema salsugineum]
Length=232

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRL+SL+SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN ANRD LLG E
Sbjct  55   TRLESLQSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLANRDSLLGSE  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP D M + +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEELGLQTRL
Sbjct  114  IKPDDTMRQVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELGLQTRL  173

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDLD HVD+TDSRL+RVQK LA++NK  + GCSCM ML+SV GIV L  VIY+L K+L
Sbjct  174  IDDLDYHVDITDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSVFGIVGLAVVIYLLVKYL  232



>ref|XP_010532045.1| PREDICTED: syntaxin-51-like isoform X2 [Tarenaya hassleriana]
Length=234

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFANRD LLGP
Sbjct  55   GTRLDSLQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFANRDSLLGP  114

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  D+MSR  G+DN G+V  QRQ+M+EQDEGLEKLEETVISTKHIALAVNEEL LQTR
Sbjct  115  ETKQTDSMSRVAGMDNQGIVGFQRQVMREQDEGLEKLEETVISTKHIALAVNEELNLQTR  174

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLD HVDVTDSRL+RVQK LA++NKR +GGCSC+ ML+S
Sbjct  175  LIDDLDYHVDVTDSRLRRVQKSLAVMNKRMRGGCSCVSMLLS  216



>ref|NP_563994.1| syntaxin-51 [Arabidopsis thaliana]
 ref|NP_001031054.1| syntaxin-51 [Arabidopsis thaliana]
 sp|Q9SA23.1|SYP51_ARATH RecName: Full=Syntaxin-51; Short=AtSYP51 [Arabidopsis thaliana]
 gb|AAD34675.1|AC006341_3 ESTs gb|F15498, gb|H37515, gb|T41906, gb|T22448, gb|W43356 and 
gb|T20739 come from this gene [Arabidopsis thaliana]
 gb|AAK40223.1|AF355755_1 syntaxin of plants 51 [Arabidopsis thaliana]
 gb|AAL75885.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM19898.1| At1g16240/F3O9_4 [Arabidopsis thaliana]
 gb|AAM62551.1| unknown [Arabidopsis thaliana]
 dbj|BAH20194.1| AT1G16240 [Arabidopsis thaliana]
 gb|AEE29423.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29424.1| syntaxin-51 [Arabidopsis thaliana]
Length=232

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            G +LDSL+SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRD LLGP
Sbjct  54   GNKLDSLQSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP D+MSR  G+DN G+V  QRQ+M+EQDEGLE+LE TV+STKHIALAV+EEL LQTR
Sbjct  113  DIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+SV+GIV L  VI+ML K++
Sbjct  173  LIDDLDYHVDVTDSRLRRVQKSLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIWMLVKYM  232



>ref|NP_565213.1| syntaxin-52 [Arabidopsis thaliana]
 ref|NP_001031301.1| syntaxin-52 [Arabidopsis thaliana]
 sp|Q94KK7.1|SYP52_ARATH RecName: Full=Syntaxin-52; Short=AtSYP52 [Arabidopsis thaliana]
 gb|AAK40224.1|AF355756_1 syntaxin of plants 52 [Arabidopsis thaliana]
 gb|AAO41986.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04091.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36269.1| syntaxin-52 [Arabidopsis thaliana]
 gb|AEE36270.1| syntaxin-52 [Arabidopsis thaliana]
Length=233

 Score =   265 bits (677),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRD L G 
Sbjct  54   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGT  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            ++KP DA++R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD  VD+TDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|NP_001136935.1| uncharacterized protein LOC100217094 [Zea mays]
 gb|ACF82924.1| unknown [Zea mays]
 gb|AFW61960.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG-  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  QSKKADDMSRVAGLDNQGIVVLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAIL+KRTKGGCSCMC+L+SV+ IV+L  ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRLQRVQKRLAILSKRTKGGCSCMCLLLSVVAIVILAVIVWLLVKYL  231



>ref|NP_001061436.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAC99744.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF23350.1| Os08g0277900 [Oryza sativa Japonica Group]
 dbj|BAG93077.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG  
Sbjct  55   TRLDSLEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQN  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  114  KKAADDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRL  173

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  174  IDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  232



>ref|XP_010532042.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010532044.1| PREDICTED: syntaxin-51-like isoform X1 [Tarenaya hassleriana]
Length=235

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+K+P KQP++EKE+NRRKDM++ LRSKA+QMAS LN+SNFANRD LLGP
Sbjct  55   GTRLDSLQSLLAKIPGKQPISEKEMNRRKDMISNLRSKASQMASALNVSNFANRDSLLGP  114

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  D+MSR  G+DN G+V  QRQ+M+EQDEGLEKLEETVISTKHIALAVNEEL LQTR
Sbjct  115  ETKQTDSMSRVAGMDNQGIVGFQRQVMREQDEGLEKLEETVISTKHIALAVNEELNLQTR  174

Query  363  LIDDLDEHVDVTDSRL-QRVQKRLAILNKRTKGGCSCMCMLMS  238
            LIDDLD HVDVTDSRL QRVQK LA++NKR +GGCSC+ ML+S
Sbjct  175  LIDDLDYHVDVTDSRLRQRVQKSLAVMNKRMRGGCSCVSMLLS  217



>gb|AAM64357.1| unknown [Arabidopsis thaliana]
Length=233

 Score =   263 bits (671),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRD L G 
Sbjct  54   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGT  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            ++KP DA++R +G+DN G+V  QRQ+M+ QDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DLKPDDAINRVSGMDNQGIVVFQRQVMRXQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD  VD+TDSRL+RVQK LA++NK  K GCSCM ML+SV+GIV L  VI++L K+L
Sbjct  174  LIDDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL  233



>ref|NP_001131944.1| uncharacterized protein LOC100193337 [Zea mays]
 gb|ACF80577.1| unknown [Zea mays]
Length=231

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
               P D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKMP-DDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>gb|AFW61956.1| SNARE domain containing protein [Zea mays]
Length=275

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 157/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  98   GTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG-  155

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  156  QSKKADDMSRVAGLDNQGIVVLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  215

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAIL+KRTKGGCSCMC+L+SV+ IV+L  ++++L K+L
Sbjct  216  LIDDLEDHVDVTNSRLQRVQKRLAILSKRTKGGCSCMCLLLSVVAIVILAVIVWLLVKYL  275



>ref|XP_008385825.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385826.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008385827.1| PREDICTED: syntaxin-52-like [Malus domestica]
 ref|XP_008359248.1| PREDICTED: syntaxin-52-like [Malus domestica]
Length=231

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQ +TEKE+NRRKDM+  LR K  QMASTL  SN ANRDILLG 
Sbjct  53   GTRLDSLQSLLSKLPGKQHITEKEMNRRKDMIGNLRLKVKQMASTLT-SNTANRDILLGS  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EI   DAM RT GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  EINKADAMGRTVGLDNYGLVGLQRQIMKEQDEGLEKLEETVVSTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+ V+VTDSRL+RVQK LA+LNKRTKGGCSCMCML+SV+G+VVL+AVI++L K+L
Sbjct  172  LIDDLDDQVEVTDSRLRRVQKNLAVLNKRTKGGCSCMCMLLSVVGMVVLVAVIFLLIKYL  231



>gb|EAY84230.1| hypothetical protein OsI_05611 [Oryza sativa Indica Group]
Length=232

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLEALLSRIPPKS-ITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V+LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKAADDMSRVAGLDNQGIVSLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVT+SRLQRVQKRLAILNKR KGGCSCM +L+SV+ IV L  + ++L K L
Sbjct  173  LIDDLDDHVDVTNSRLQRVQKRLAILNKRVKGGCSCMALLISVVAIVFLAVIAWLLIKHL  232



>gb|AHA84215.1| syntaxin-51 [Phaseolus vulgaris]
Length=359

 Score =   266 bits (679),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+SLLSK P KQP++EKE+NRRKDMLA+LRS+ NQMASTLNMSNF+NRD LLGPE
Sbjct  182  TRLDSLQSLLSKFPGKQPISEKEMNRRKDMLASLRSRVNQMASTLNMSNFSNRDSLLGPE  241

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             KP DAM+RT G+DN+G+V  QR +MKEQDEGLE+LEET+ STKHIALAVNEELGL  RL
Sbjct  242  GKP-DAMARTVGMDNNGLVGFQRLLMKEQDEGLEQLEETIASTKHIALAVNEELGLPPRL  300

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ID LD+HV+VTDS L+RVQK LA+LNKRTKGGCSC+CML+SV+GIV+L+ VI++L K+L
Sbjct  301  IDGLDQHVEVTDSPLRRVQKNLAVLNKRTKGGCSCLCMLLSVVGIVLLVIVIWLLVKYL  359



>ref|XP_008784838.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784839.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784840.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
 ref|XP_008784841.1| PREDICTED: syntaxin-52-like [Phoenix dactylifera]
Length=233

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+LESLLSK P+ QP  +KE+ +R+DM+A L+SKANQMAS LNMS+F+ R+ LLGP
Sbjct  54   GTRLDTLESLLSKHPSTQPKMQKELQKRQDMVANLKSKANQMASALNMSSFSKREDLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K VD + RT+GLDN GVV LQRQIMKEQDE LEKLEETVISTKHIALAVNEEL L TR
Sbjct  114  SKKSVDEIERTSGLDNYGVVHLQRQIMKEQDESLEKLEETVISTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVD T+SRLQRVQKRLA+ N+R K  CSC C+L+SV  IV+L A+ ++L K+L
Sbjct  174  LIDDLDQHVDSTNSRLQRVQKRLAVFNRRVKRSCSCKCLLLSVGAIVILAAIAFILIKYL  233



>ref|XP_008668816.1| PREDICTED: syntaxin-52-like [Zea mays]
Length=231

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNF NR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFTNREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
               P D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKMP-DDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>ref|XP_006646793.1| PREDICTED: syntaxin-52-like [Oryza brachyantha]
Length=232

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLEALLSRVPPKS-ITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKSADDMSRVAGLDNQGIVTLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVDVT+SRLQRVQK LAILNKRTKGGCSCM +++SV+ IV L  ++++L K++
Sbjct  173  LIDDLDDHVDVTNSRLQRVQKTLAILNKRTKGGCSCMSLMLSVVAIVFLTVIVWLLIKYM  232



>ref|XP_010940839.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940848.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
 ref|XP_010940854.1| PREDICTED: syntaxin-52-like [Elaeis guineensis]
Length=233

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLLSK P+ QP  +KE+ +R+DM+A L+SKA QMASTLNMSNF+ R+ LLGP
Sbjct  54   GTRLDSLESLLSKHPSTQPKMQKELQKRQDMVANLKSKAKQMASTLNMSNFSKREDLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K VD + RT+GLDN GVV +QRQIMKEQDE LEKLEETVISTKHIALAVNEEL L TR
Sbjct  114  SKKSVDEIDRTSGLDNYGVVHVQRQIMKEQDESLEKLEETVISTKHIALAVNEELDLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVD T+SRLQRVQ RLA+LN+R K  CSC C+L+S+  IV+L AV ++L K+L
Sbjct  174  LIDDLDQHVDSTNSRLQRVQMRLAVLNRRVKRSCSCKCLLLSMGAIVILAAVAFILIKYL  233



>gb|EEE68383.1| hypothetical protein OsJ_26713 [Oryza sativa Japonica Group]
Length=346

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG  
Sbjct  169  TRLDSLEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQN  227

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  228  KKAADDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRL  287

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  288  IDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  346



>ref|NP_001045701.1| Os02g0119400 [Oryza sativa Japonica Group]
 dbj|BAD08125.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAD07621.1| putative syntaxin of plants 52 [Oryza sativa Japonica Group]
 dbj|BAF07615.1| Os02g0119400 [Oryza sativa Japonica Group]
 gb|EAZ21521.1| hypothetical protein OsJ_05145 [Oryza sativa Japonica Group]
 dbj|BAG95712.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=232

 Score =   259 bits (662),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE+LLS++P K  +T+KE+++R+DML+ L+S+A QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLEALLSRIPPKS-ITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V+LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKAADDMSRVAGLDNQGIVSLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD++VDVT+SRLQRVQKRLAILNKR KGGCSCM +L+SV+ IV L  + ++L K L
Sbjct  173  LIDDLDDYVDVTNSRLQRVQKRLAILNKRVKGGCSCMALLISVVAIVFLAVIAWLLIKHL  232



>gb|ACG31926.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   259 bits (662),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++ +SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSFKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
               P D MSR  GLDN G+V LQRQIMKEQDEGLE LEETV+STKHIALAVNEEL L TR
Sbjct  113  SKMP-DDMSRVAGLDNQGIVXLQRQIMKEQDEGLEXLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSC C+L+SV+ IV+L  ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCTCLLLSVVAIVILAVIVWLLVKYL  231



>ref|XP_009407478.1| PREDICTED: syntaxin-52-like [Musa acuminata subsp. malaccensis]
Length=233

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRL+SLES+LSKLP+ QP+ +KE+N+R++MLA L+SKA+QMAS LNMSNF+NR  L G  
Sbjct  55   TRLESLESILSKLPSLQPIKDKELNKRQEMLANLKSKADQMASELNMSNFSNRKDLFGDG  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D +SRT GLDN G+V LQRQIM+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  115  KKSADVVSRTAGLDNQGIVGLQRQIMREQDEGLEKLEETVLSTKHIALAVNEELDLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDLDEHVD+TD+RLQRVQKRLAIL+KRTKGGCSCMC+L+SV+ IV+LI + ++L K+L
Sbjct  175  IDDLDEHVDITDTRLQRVQKRLAILSKRTKGGCSCMCLLLSVVAIVILIVIAWVLIKYL  233



>gb|ABR25694.1| syntaxin 51 [Oryza sativa Indica Group]
Length=174

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 150/175 (86%), Gaps = 1/175 (1%)
 Frame = -2

Query  708  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPV  529
            SLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG   K  
Sbjct  1    SLEALLSKIPPK-SLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAA  59

Query  528  DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDL  349
            D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TRLIDDL
Sbjct  60   DDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDL  119

Query  348  DEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  120  EDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  174



>gb|EEC83251.1| hypothetical protein OsI_28573 [Oryza sativa Indica Group]
Length=396

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG  
Sbjct  219  TRLDSLEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQN  277

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  278  KKAADDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRL  337

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDL++HVDVT+SRLQRVQKRLAILNKRTKGGCSCMC+L+SV+ IV+L  ++++L K++
Sbjct  338  IDDLEDHVDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIKYM  396



>dbj|BAJ85147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95155.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS45154.1| Syntaxin-52 [Triticum urartu]
Length=232

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFANR+ LLG 
Sbjct  54   GTRLDSLVTLLSRIPPKS-LTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V LQRQ+M+EQDEGLE+LEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKAADDMSRVAGLDNQGIVGLQRQVMREQDEGLERLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SRLQRVQKRLAILNKR KGGCSCMC+++SV  IV+L  ++++L K+L
Sbjct  173  LIDDLEDHVDVTNSRLQRVQKRLAILNKRAKGGCSCMCLMLSVAAIVLLAVIVWLLIKYL  232



>dbj|BAJ97107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD+LE +L++LP K  +T+KE+++R+DML+ L+S+A QMA + NMS FANR+ LLG 
Sbjct  54   GTRLDTLEGMLARLPPKS-ITDKELHKRRDMLSNLKSRAKQMAESFNMSTFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLE+TV+S KH+ALAVNEEL L  R
Sbjct  113  SKKAADDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEQTVLSAKHVALAVNEELDLHAR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD+HVD T+SRLQRVQKRLA+LNKR KGGCSCM +L+S +GIV+L+ ++++L K+L
Sbjct  173  LIDDLDDHVDGTNSRLQRVQKRLAVLNKRAKGGCSCMSLLLSTVGIVMLVVIVWLLIKYL  232



>ref|XP_003573428.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233716.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
 ref|XP_010233717.1| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=231

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE  LS++P K  +T+KE+++R+DML+ LRS+A QMAS+ NMS  ANR+ LLG 
Sbjct  53   GTRLDSLEGSLSRVPPKS-ITDKELHKRQDMLSNLRSRAKQMASSFNMSTSANREDLLGQ  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              KP D MSR   LD+ G+V LQRQIMKEQDEGLEKLE+TV+STKHIALAVNEEL L T+
Sbjct  112  TKKPADDMSRVAALDSQGIVGLQRQIMKEQDEGLEKLEQTVLSTKHIALAVNEELDLHTK  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LI+DLD+HVD T+SRLQRVQK+LA+LNKR KGGCSCM +L+SV+ IV+L+ ++++L KFL
Sbjct  172  LIEDLDDHVDGTNSRLQRVQKKLAVLNKRAKGGCSCMSLLLSVVSIVMLVVIVWLLMKFL  231



>gb|AAF68106.1|AC010793_1 F20B17.2 [Arabidopsis thaliana]
Length=260

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 153/207 (74%), Gaps = 27/207 (13%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL K+P KQ ++EKE+NRRKDM+  LRSK NQ+AS LNMSNFANRD L G 
Sbjct  54   GTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGT  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            ++KP DA++R +G+DN G+V  QRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL LQTR
Sbjct  114  DLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTR  173

Query  363  LI---------------------------DDLDEHVDVTDSRLQRVQKRLAILNKRTKGG  265
            LI                           DDLD  VD+TDSRL+RVQK LA++NK  K G
Sbjct  174  LIVCLRCCSLLFLLILISYSNEMGLSSMQDDLDYDVDITDSRLRRVQKSLALMNKSMKSG  233

Query  264  CSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            CSCM ML+SV+GIV L  VI++L K+L
Sbjct  234  CSCMSMLLSVLGIVGLALVIWLLVKYL  260



>ref|XP_008775698.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
 ref|XP_008775699.1| PREDICTED: syntaxin-52-like isoform X1 [Phoenix dactylifera]
Length=232

 Score =   249 bits (635),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FANR+ LLG 
Sbjct  54   GTRLDSLESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFANREDLLG-  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D ++RT GLDN G+V LQRQIMKEQDEGLEKL+ETV+STKHIAL VNEEL L TR
Sbjct  113  QSKSTDEVNRTVGLDNYGIVGLQRQIMKEQDEGLEKLKETVLSTKHIALTVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LID+LD HVD+T SRLQRVQ+RLAILNKRTKGGCSCMC+L+ V+ IV+L+ +++ L K+L
Sbjct  173  LIDNLDHHVDLTGSRLQRVQRRLAILNKRTKGGCSCMCLLLLVVAIVILVVIVWALIKYL  232



>ref|XP_006304162.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 ref|XP_006304163.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37060.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
 gb|EOA37061.1| hypothetical protein CARUB_v10010186mg [Capsella rubella]
Length=232

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+L+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSILAKIHGK-PISEKEMNRRKDMVGNLRSKANQMATALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP D+MSR   +DN G+V  QR++MKEQDEGLE+LE TV+STKHIAL V+EELGLQTR
Sbjct  113  ETKPDDSMSRVASMDNQGIVGYQRKVMKEQDEGLEELEGTVMSTKHIALTVSEELGLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDLD HVDVTDSRL+RVQK LA+++K  + GCSCM ML+SV+GIV L+ VI++L K++
Sbjct  173  LIDDLDYHVDVTDSRLRRVQKNLAVMSKNMRSGCSCMSMLLSVLGIVGLVVVIWLLVKYM  232



>gb|KJB62826.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=218

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD L+SLLSK  T +PLT+KE+NR KDM+  LRSK+NQMAS  NMSNFANRD LLGPE
Sbjct  42   TRLDGLQSLLSK-HTGKPLTDKEMNRCKDMVTNLRSKSNQMASAFNMSNFANRDSLLGPE  100

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             KP D MSRT GLDNSG++ LQRQIMKEQDEGLEKLEET++STKHIALAV+EEL L T L
Sbjct  101  TKP-DTMSRTIGLDNSGLIGLQRQIMKEQDEGLEKLEETLVSTKHIALAVSEELDLHTTL  159

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            IDDL +HVDVTDS LQRVQK + ILNK   GG SCMCM ++VIGIVVL+ +IY+L K+L
Sbjct  160  IDDLGQHVDVTDSHLQRVQKNMGILNKHINGGWSCMCMPLAVIGIVVLLVLIYLLIKYL  218



>ref|XP_006339244.1| PREDICTED: syntaxin-51-like [Solanum tuberosum]
Length=231

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD+L+SLL  LP+KQPL++KE+ RR DML  + +KANQ+A+TLNM+N ANRD LLGPE
Sbjct  55   TRLDTLQSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQLATTLNMNNLANRDSLLGPE  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D +SR  GLDN  +V  QRQ++KEQDE L+KLEETVISTKH+ALA+NEEL L T L
Sbjct  115  TKRPDVISRATGLDNQDLVGFQRQVIKEQDEDLDKLEETVISTKHVALAINEELNLHTAL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD HVD T+SRLQRVQ++LA LNKRTKGGC+ +C+L  VI IV+L  VI++L KFL
Sbjct  175  LDNLDYHVDTTNSRLQRVQRKLAFLNKRTKGGCTWLCLL--VIFIVILAVVIFLLVKFL  231



>ref|XP_009606725.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
 ref|XP_009606726.1| PREDICTED: syntaxin-52-like [Nicotiana tomentosiformis]
Length=231

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD+L+SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N ANRD LLGPE
Sbjct  55   TRLDTLQSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLANRDSLLGPE  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D +SR  GLDN G+V  QRQ++KEQDE L+KLEETV STKH+ALA+NEEL L T L
Sbjct  115  TKRPDVISRATGLDNQGLVGFQRQVIKEQDEDLDKLEETVTSTKHVALAINEELNLHTAL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD HVD T+SRL RVQ++LA LNKRTKGGC+ +C+L  VI IV+L  VI++L KFL
Sbjct  175  LDNLDYHVDTTNSRLLRVQRKLAFLNKRTKGGCTWLCLL--VIFIVILAVVIFLLVKFL  231



>ref|XP_004491441.1| PREDICTED: syntaxin-52-like isoform X2 [Cicer arietinum]
Length=198

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQPL+EKE+NRRKDMLA LRSK NQMAS+LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPGKQPLSEKEMNRRKDMLANLRSKVNQMASSLNMSNFANRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E+KP D M+R  GLDN+G+V  QRQ+MKEQDEGLE LE+TVISTKHIALAVNEELGL TR
Sbjct  114  EVKP-DVMNRIVGLDNNGLVGFQRQVMKEQDEGLESLEQTVISTKHIALAVNEELGLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAIL  286
            LIDDLD+HVDVTDSRL+RVQK L  L
Sbjct  173  LIDDLDQHVDVTDSRLRRVQKNLTFL  198



>ref|XP_009773941.1| PREDICTED: syntaxin-52-like [Nicotiana sylvestris]
Length=231

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD+L+SLL  LP+KQPLT+KE+ RR DML  + +KANQMA+TLNM+N ANRD LLGPE
Sbjct  55   TRLDTLQSLLPTLPSKQPLTKKEMKRRHDMLDNMITKANQMATTLNMNNLANRDSLLGPE  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D +SR  GLDN G+V  QRQ++KEQDE L+KLEETV STKH+ALA+NEEL L T L
Sbjct  115  TKRPDVISRATGLDNQGLVGFQRQVIKEQDEDLDKLEETVTSTKHVALAINEELNLHTAL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD HVD T+SRL RVQ++LA LNKRTKGGC+ +C+L  VI IV+L  VI++L K+L
Sbjct  175  LDNLDYHVDTTNSRLLRVQRKLAFLNKRTKGGCTWLCLL--VIFIVILAVVIFLLVKYL  231



>ref|XP_004249335.1| PREDICTED: syntaxin-51 [Solanum lycopersicum]
Length=231

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD+L+SLL  LP+KQPL++KE+ RR DML  + +KANQMASTLNM+N ANRD LLGPE
Sbjct  55   TRLDTLQSLLQTLPSKQPLSKKEMKRRHDMLDNMITKANQMASTLNMNNLANRDSLLGPE  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D +SR  GLDN  +V  QRQ++KEQDE L+KLEETV+STKH+ALA+NEEL L T L
Sbjct  115  TKRPDVISRATGLDNQDLVGFQRQVIKEQDEDLDKLEETVVSTKHVALAINEELNLHTAL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD HVD T+SRLQRVQ++LA LNKRTKGGC+ +C+L  +I IV+L   I++L K+L
Sbjct  175  LDNLDYHVDTTNSRLQRVQRKLAFLNKRTKGGCTWLCLL--IIFIVILAVAIFLLVKYL  231



>ref|XP_010646520.1| PREDICTED: syntaxin-52-like [Vitis vinifera]
Length=334

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  684  LPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAMSRTNG  505
            LP     TEKE+NRRKDML+ LRSK +QMASTLNMSNFANRD LLGPEIKP DAMSRT G
Sbjct  168  LPFVSHRTEKEMNRRKDMLSNLRSKVSQMASTLNMSNFANRDSLLGPEIKPADAMSRTTG  227

Query  504  LDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTD  325
            LDN G+V LQRQIMKEQDEGL+ LEETVISTKHIALAVNEEL L TRLID LD+HVD TD
Sbjct  228  LDNQGLVGLQRQIMKEQDEGLDNLEETVISTKHIALAVNEELDLHTRLIDTLDQHVDTTD  287

Query  324  SRLQRVQKRLAILNKRTKGGCSCMCM  247
            SRL RVQK LAILNKRTKGGC+C CM
Sbjct  288  SRLGRVQKNLAILNKRTKGGCTCFCM  313



>ref|XP_008240610.1| PREDICTED: syntaxin-51-like [Prunus mume]
Length=230

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+L++L+SLLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ ANR  LLGP+
Sbjct  54   TKLETLQSLLSKLPNKQSITGKEINRRKDMLKNLSSKADQMAIALNMSSLANRQNLLGPD  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D MSRT  LDN G+V+ QRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L T L
Sbjct  114  KKMDDIMSRTADLDNHGLVSFQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTML  173

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD+HVD T+S LQRVQK+LA+LNKRTKGGCS + +L  V+ +V+L  V + L K+L
Sbjct  174  LDNLDQHVDSTNSNLQRVQKKLAVLNKRTKGGCSSLILL--VLAVVILTIVTWALIKYL  230



>gb|EMT28389.1| hypothetical protein F775_28894 [Aegilops tauschii]
Length=258

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 152/206 (74%), Gaps = 27/206 (13%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL +LLS++P K  LT+KE+++R+D L+ L+SKA QM ++ N+SNFANR+ LLG 
Sbjct  54   GTRLDSLVTLLSRIPPKS-LTDKEMHKRQDALSNLKSKAKQMGTSFNVSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K  D MSR  GLDN G+V LQRQ+M+EQDEGLE+LEETV+STKHIALAVNEEL L TR
Sbjct  113  SKKAADDMSRVAGLDNQGIVGLQRQVMREQDEGLERLEETVLSTKHIALAVNEELTLHTR  172

Query  363  LIDDLDEHVDVTDSRL--------------------------QRVQKRLAILNKRTKGGC  262
            LIDDL++HVDVT+SRL                          QRVQKRLAILNKR KGGC
Sbjct  173  LIDDLEDHVDVTNSRLQVDILLLLFDIEVPFTWMCTDVTLLIQRVQKRLAILNKRAKGGC  232

Query  261  SCMCMLMSVIGIVVLIAVIYMLFKFL  184
            SCMC+++SV  IV+L  ++++L K+L
Sbjct  233  SCMCLMLSVAAIVLLAVIVWLLIKYL  258



>ref|XP_008775700.1| PREDICTED: syntaxin-52-like isoform X2 [Phoenix dactylifera]
Length=222

 Score =   238 bits (607),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLLSKLP+KQP+++KE+++ +DML+ LRSKA QMASTLNMS+FANR+ LLG 
Sbjct  54   GTRLDSLESLLSKLPSKQPISDKELHKCQDMLSNLRSKAKQMASTLNMSSFANREDLLG-  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D ++RT GLDN G+V LQRQIMKEQDEGLEKL+ETV+STKHIAL VNEEL L TR
Sbjct  113  QSKSTDEVNRTVGLDNYGIVGLQRQIMKEQDEGLEKLKETVLSTKHIALTVNEELDLHTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIG  229
            LID+LD HVD+T SRLQRVQ+RLAILNKRTKGGCSC       +G
Sbjct  173  LIDNLDHHVDLTGSRLQRVQRRLAILNKRTKGGCSCQIKFEDNVG  217



>gb|ABK23110.1| unknown [Picea sitchensis]
Length=233

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE+LL KLP++QP++EKE++RR+DML  LRSK+NQMAS LNMS F NR  LLG 
Sbjct  54   GTRLDSLENLLPKLPSRQPISEKELHRRQDMLVNLRSKSNQMASALNMSRFGNRSDLLGQ  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + KPV  ++RT GLDN G+V LQRQIMKEQDEGL KLEETVISTKHIALAVNEEL L +R
Sbjct  114  DNKPVSEINRTTGLDNYGLVGLQRQIMKEQDEGLGKLEETVISTKHIALAVNEELDLHSR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            L+D LD+ VD T+SRLQR QKRLA+L+K+ K  CSCMC L+ VI +V+L  VI+ L KFL
Sbjct  174  LLDSLDQDVDGTNSRLQRAQKRLAMLSKKAKSSCSCMCSLVMVIVLVILAVVIWALIKFL  233



>ref|XP_010673197.1| PREDICTED: syntaxin-52-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
             T+L++LESLL+KLP+ Q +T KEINRR D+L  ++SK NQMA+TLN  + A RD LLGP
Sbjct  54   NTKLENLESLLAKLPSMQAITGKEINRRNDLLTNMKSKVNQMANTLNSYSAAYRDRLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            ++K  D + R + +DN G+V  QRQIM+EQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  114  DLKSDDVIKRASNMDNQGIVGFQRQIMREQDEGLEKLEETVISTKHIALAVNEELNLHTR  173

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            L+D LD+HV+ T+SRLQR+Q+RLA+ NKRTKGGC+C+C+L  VI IV LI V+  L K+ 
Sbjct  174  LLDTLDDHVESTNSRLQRIQRRLAVFNKRTKGGCTCLCLL--VILIVFLILVVLALIKYF  231



>gb|ACJ84463.1| unknown [Medicago truncatula]
Length=194

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP DAMSRT GLDN+G+V LQRQ+MKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  111  EIKP-DAMSRTVGLDNNGLVGLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  169

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAI  289
            LIDDLDEHVD+TDSRL+RVQK LA 
Sbjct  170  LIDDLDEHVDITDSRLRRVQKNLAF  194



>ref|XP_007202519.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
 gb|EMJ03718.1| hypothetical protein PRUPE_ppa010912mg [Prunus persica]
Length=230

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+L++L+SLLSKLP KQ +T KEINRRKDML  L SKA+QMA  LNMS+ AN+  LLGP+
Sbjct  54   TKLETLQSLLSKLPNKQSITGKEINRRKDMLTNLSSKADQMAIALNMSSLANKQNLLGPD  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D M RT  LDN G+V+ QRQIMKEQDEGL KLEETVISTKHIALAVNEEL L T L
Sbjct  114  KKMDDIMRRTEDLDNHGLVSFQRQIMKEQDEGLGKLEETVISTKHIALAVNEELDLHTML  173

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +D+LD+HVD T+S LQRVQK+ A+LNKRTKGGCS + +L  V+ +V+LI V + L K+L
Sbjct  174  LDNLDQHVDSTNSNLQRVQKKFAVLNKRTKGGCSSLILL--VLAVVILIIVTWALIKYL  230



>gb|ABK92902.1| unknown [Populus trichocarpa]
Length=231

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + ANR+ LLGP+
Sbjct  55   TKLDILQSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAANRENLLGPD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D ++R +G DN G+V  QRQIM+EQDEGLEKLEETVISTKHIALAVNEEL L TRL
Sbjct  115  SKTDDVINRASGFDNQGLVGFQRQIMREQDEGLEKLEETVISTKHIALAVNEELTLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCM  247
            +DDLDEHVDVT+SRLQRVQK LAILNKRTKGGC+C   
Sbjct  175  LDDLDEHVDVTNSRLQRVQKNLAILNKRTKGGCACWVF  212



>ref|XP_011041363.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR+ LLGP+
Sbjct  55   TKLDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSVANRENLLGPD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D + R +GLDN G+V  QRQ+MKEQD+GLEKLEETVISTKHIALAVNEEL L TRL
Sbjct  115  KKTDDIVDRASGLDNHGLVGFQRQVMKEQDQGLEKLEETVISTKHIALAVNEELSLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC  256
            +DDLDEHVDVT+SRLQ VQ++LA LNKRTKGGCSC
Sbjct  175  LDDLDEHVDVTNSRLQMVQRKLAFLNKRTKGGCSC  209



>ref|XP_006399472.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
 gb|ESQ40925.1| hypothetical protein EUTSA_v10015786mg [Eutrema salsugineum]
Length=169

 Score =   229 bits (584),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 139/178 (78%), Gaps = 18/178 (10%)
 Frame = -2

Query  717  RLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEI  538
            RL+SL+SLL+KL  K P++EKE+NRRKDM+  LRS+ANQMA+ LNMSN ANRD LLG EI
Sbjct  10   RLESLQSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMANALNMSNLANRDSLLGSEI  68

Query  537  KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLI  358
            KP + MS+                  EQDEGLEKLEETV+STKHIALAVNEELGLQTRLI
Sbjct  69   KPDNTMSQL-----------------EQDEGLEKLEETVMSTKHIALAVNEELGLQTRLI  111

Query  357  DDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            DDLD HVDVTDSRL+RVQK LA++NK  + GCSCM ML+SV+GIV L  VIY+L K+L
Sbjct  112  DDLDYHVDVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIYLLVKYL  169



>ref|XP_006373681.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51478.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=231

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR+ LLGP+
Sbjct  55   TKLDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRENLLGPD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D M+R  GL+N G+V  QRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TRL
Sbjct  115  KKTDDIMNRATGLNNHGLVGFQRQIMKEQDQGLEKLEETVISTKHIALAVNEELSLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCM  253
            +DDLDEHVDVT+SRLQ VQ++LA LNK TKGGCSC 
Sbjct  175  LDDLDEHVDVTNSRLQMVQRKLAFLNKSTKGGCSCW  210



>ref|XP_006373682.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
 gb|ERP51479.1| hypothetical protein POPTR_0016s02990g [Populus trichocarpa]
Length=243

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS+LP+KQP+T KE+NRR+DML  L +K NQMAS LNMS+ ANR+ LLGP+
Sbjct  67   TKLDILQSLLSELPSKQPITGKEMNRRQDMLKNLSTKVNQMASILNMSSAANRENLLGPD  126

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D M+R  GL+N G+V  QRQIMKEQD+GLEKLEETVISTKHIALAVNEEL L TRL
Sbjct  127  KKTDDIMNRATGLNNHGLVGFQRQIMKEQDQGLEKLEETVISTKHIALAVNEELSLHTRL  186

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCM  253
            +DDLDEHVDVT+SRLQ VQ++LA LNK TKGGCSC 
Sbjct  187  LDDLDEHVDVTNSRLQMVQRKLAFLNKSTKGGCSCW  222



>ref|XP_011040717.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS LP+KQPL+ KE+NRR++ML  L +K NQMAS LNM + ANR+ LLGP+
Sbjct  55   TKLDILQSLLSALPSKQPLSGKEMNRRQEMLKNLSTKVNQMASALNMFSAANRENLLGPD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D ++R +G DN G+V  QRQIM+EQDEGLEKLEETV STKHIALAVNEEL L TRL
Sbjct  115  SKTDDVINRASGFDNQGLVGFQRQIMREQDEGLEKLEETVTSTKHIALAVNEELTLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCM  247
            +DDLDEHVDVT+SRLQRVQK LAILNKRTKGGC+C   
Sbjct  175  LDDLDEHVDVTNSRLQRVQKNLAILNKRTKGGCACWVF  212



>gb|ACG48507.1| SNARE domain containing protein [Zea mays]
Length=231

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
               P D MSR  GLDN G+V LQRQIMKEQDEGLEKLE TV+S KHIALAVNEEL L  R
Sbjct  113  SKMP-DDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEXTVLSXKHIALAVNEELTLHXR  171

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            LIDDL++HVDVT+SR Q VQKRLAILNKR KGGCS  C+L+SV+ IV+   ++++L K+L
Sbjct  172  LIDDLEDHVDVTNSRXQXVQKRLAILNKRXKGGCSXTCLLLSVVAIVIXAVIVWLLVKYL  231



>ref|XP_011040715.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011040716.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLNMS+ ANR+ LLGP+
Sbjct  55   TKLDILQSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNMSSAANRENLLGPD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D + R +GLDN G+V  QRQIMKEQDEGLEKLEETV STKHIALAVNEEL L T+L
Sbjct  115  KKTDDIVDRASGLDNHGLVGFQRQIMKEQDEGLEKLEETVTSTKHIALAVNEELTLHTKL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            +DDLDEHVDVT+SRLQ VQ++LA+LNKRTKGGCS  C+++ VI IV+LI VI  LFK+L
Sbjct  175  LDDLDEHVDVTNSRLQTVQRKLALLNKRTKGGCS--CVILPVIAIVILIVVIRGLFKYL  231



>ref|XP_009377637.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
 ref|XP_009377638.1| PREDICTED: syntaxin-51-like [Pyrus x bretschneideri]
Length=234

 Score =   226 bits (575),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQ--PLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLG  547
            T+L++L SLLSKLPTKQ   +T KE+NRRKDMLA+L SKA+QMA+TLNMS+ ANR+ LLG
Sbjct  56   TKLETLHSLLSKLPTKQKESITGKEMNRRKDMLASLSSKADQMATTLNMSSLANRNNLLG  115

Query  546  PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQT  367
            P+ K  D MSRT GLDN G+V  QRQI+KEQDEGL+KLEETVISTKHIALAVNEEL L T
Sbjct  116  PDKKMDDIMSRTTGLDNHGLVGFQRQIIKEQDEGLDKLEETVISTKHIALAVNEELDLHT  175

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC  256
            RL+D+LD+ V+ T+S LQRVQK+LA+LNKR KGGCSC
Sbjct  176  RLLDNLDQQVESTNSNLQRVQKKLAVLNKRNKGGCSC  212



>ref|XP_006406341.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
 gb|ESQ47794.1| hypothetical protein EUTSA_v10021502mg [Eutrema salsugineum]
Length=215

 Score =   225 bits (573),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 137/178 (77%), Gaps = 18/178 (10%)
 Frame = -2

Query  717  RLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEI  538
            RL+SL+SLL+KL  K P++EKE+NRRKDM+  LRS+ANQM + LNMSN ANRD LLG EI
Sbjct  56   RLESLQSLLAKLHGK-PISEKEMNRRKDMIGNLRSQANQMVNALNMSNLANRDSLLGSEI  114

Query  537  KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLI  358
            KP + MS+                  EQDEGLEKLEETV+STKHIALAVNEELGLQTRLI
Sbjct  115  KPDNTMSQL-----------------EQDEGLEKLEETVMSTKHIALAVNEELGLQTRLI  157

Query  357  DDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            DDLD HV VTDSRL+RVQK LA++NK  + GCSCM ML+SV+GIV L  VIY+L K+L
Sbjct  158  DDLDYHVYVTDSRLRRVQKNLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIYLLVKYL  215



>gb|KJB22168.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=190

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 2/137 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAMSRT GLDNSG+V LQRQIMKEQDE LEKLEET++STKHIALAVNEEL LQTR
Sbjct  113  ESKP-DAMSRTVGLDNSGLVGLQRQIMKEQDEDLEKLEETIVSTKHIALAVNEELDLQTR  171

Query  363  LIDDLDEHVDVTDSRLQ  313
            LIDDLD+HVDV+DSRL+
Sbjct  172  LIDDLDQHVDVSDSRLR  188



>gb|KJB11954.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=192

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 2/137 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT GLDNSG+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMKEQDEGLEKLEETVMSTKHIALAVNEELDLHTR  170

Query  363  LIDDLDEHVDVTDSRLQ  313
            LIDDLDEHVDVTDSRL+
Sbjct  171  LIDDLDEHVDVTDSRLR  187



>gb|KJB81691.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=195

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLHSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT G DNSG+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  113  ETK-ADAMSRTVGSDNSGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  171

Query  363  LIDDLDEHVDVTDSRLQR  310
            LIDDLD+HV+VTDSRL+ 
Sbjct  172  LIDDLDQHVEVTDSRLRH  189



>gb|KJB62825.1| hypothetical protein B456_009G444600 [Gossypium raimondii]
Length=155

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = -2

Query  651  INRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQR  472
            +NR KDM+  LRSK+NQMAS  NMSNFANRD LLGPE KP D MSRT GLDNSG++ LQR
Sbjct  1    MNRCKDMVTNLRSKSNQMASAFNMSNFANRDSLLGPETKP-DTMSRTIGLDNSGLIGLQR  59

Query  471  QIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLA  292
            QIMKEQDEGLEKLEET++STKHIALAV+EEL L T LIDDL +HVDVTDS LQRVQK + 
Sbjct  60   QIMKEQDEGLEKLEETLVSTKHIALAVSEELDLHTTLIDDLGQHVDVTDSHLQRVQKNMG  119

Query  291  ILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
            ILNK   GG SCMCM ++VIGIVVL+ +IY+L K+L
Sbjct  120  ILNKHINGGWSCMCMPLAVIGIVVLLVLIYLLIKYL  155



>ref|XP_006373683.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
 gb|ERP51480.1| hypothetical protein POPTR_0016s03000g [Populus trichocarpa]
Length=231

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LDSL+SLL  LP KQP++ KEINRR++ML  L +K NQM++ LNM+  ANR+ LLG +
Sbjct  55   TKLDSLQSLLLALPGKQPISGKEINRRQEMLKNLSTKVNQMSTALNMAGAANRENLLGSD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D + R +GLDN G+V  QRQ M+EQDEGLEKL+ETV STKHIALAVNEEL L TRL
Sbjct  115  SKTDDIIYRASGLDNQGLVGFQRQTMREQDEGLEKLDETVTSTKHIALAVNEELTLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCM  253
            +DDLDEHVDVT+SR+QRVQ+ LA LNKRTK GC+C 
Sbjct  175  LDDLDEHVDVTNSRMQRVQRNLAFLNKRTKSGCACW  210



>ref|XP_002892898.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69157.1| hypothetical protein ARALYDRAFT_471821 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLL+K+  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLAKIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            EIKP D+MSR  G+DN G+V  QRQ+M+EQDEGLE+LE TV+STKHIALAV+EEL LQTR
Sbjct  113  EIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQK  301
            LIDDLD HVDVTDSRL+  ++
Sbjct  173  LIDDLDYHVDVTDSRLRSAEE  193



>gb|KCW66897.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=200

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RD LLGPE
Sbjct  55   TRLDSLQNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLGPE  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP DAMSRT GLDN G+V LQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  114  IKPADAMSRTAGLDNQGIVVLQRQVMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRL  173

Query  360  IDDLDEHVDVTDSRLQ  313
            ID+LD+HVDVTDSRL+
Sbjct  174  IDNLDQHVDVTDSRLR  189



>ref|XP_011041367.1| PREDICTED: syntaxin-52-like [Populus euphratica]
 ref|XP_011041368.1| PREDICTED: syntaxin-52-like [Populus euphratica]
Length=231

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS LP+KQ ++ KEINRR++ML  L +K NQM++ L M+  ANR+ LLG +
Sbjct  55   TKLDILQSLLSALPSKQSISGKEINRRQEMLKNLSTKVNQMSTALKMAGAANRENLLGSD  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D ++R +GLD+ G+V  QRQ M+EQDEGLEKL+ETV STKHIALAVNEEL L TRL
Sbjct  115  SKTDDIINRASGLDSQGLVGFQRQTMREQDEGLEKLDETVTSTKHIALAVNEELTLHTRL  174

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCM  253
            +DDLDEHVDVT+SR+QRVQ+ LA LNKRTK GC+C 
Sbjct  175  LDDLDEHVDVTNSRMQRVQRNLAFLNKRTKSGCACW  210



>ref|NP_001077546.1| syntaxin-51 [Arabidopsis thaliana]
 gb|AEE29425.1| syntaxin-51 [Arabidopsis thaliana]
Length=228

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            G +LDSL+SLL+++  K P++EKE+NRRKDM+  LRSKANQMA+ LNMSNFANRD LLGP
Sbjct  54   GNKLDSLQSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            +IKP D+MSR  G+DN G+V  QRQ+M+EQDEGLE+LE TV+STKHIALAV+EEL LQTR
Sbjct  113  DIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTR  172

Query  363  LIDDLDEHVDVTDSRLQRVQK  301
            LIDDLD HVDVTDSRL+  ++
Sbjct  173  LIDDLDYHVDVTDSRLRSAEE  193



>ref|XP_002531208.1| syntaxin, putative [Ricinus communis]
 gb|EEF31185.1| syntaxin, putative [Ricinus communis]
Length=147

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 110/138 (80%), Gaps = 16/138 (12%)
 Frame = -2

Query  651  INRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQR  472
            +NRRKDM+  LR+K NQMA+TLNMSNFANRD L GPEIKP DAM RT             
Sbjct  1    MNRRKDMVTNLRTKVNQMATTLNMSNFANRDSLFGPEIKPADAMRRT-------------  47

Query  471  QIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLA  292
               +EQDEGLEKLEETV STKHIALAVNEEL L TRLIDDLD+HVDVTDSRL+RVQK LA
Sbjct  48   ---EEQDEGLEKLEETVTSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLA  104

Query  291  ILNKRTKGGCSCMCMLMS  238
            ILNKRTKGGCSC+CM +S
Sbjct  105  ILNKRTKGGCSCLCMTLS  122



>gb|EYU33678.1| hypothetical protein MIMGU_mgv1a021393mg [Erythranthe guttata]
Length=230

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = -2

Query  705  LESLLSKLPT--KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKP  532
            LESL   LP+   +  T +E+  RKDM+  LR   N++   LNMSNFANRD  L P+   
Sbjct  57   LESLQHSLPSALNESSTAEEMKIRKDMVTKLRLNVNEINYALNMSNFANRDRSLEPD---  113

Query  531  VDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLID-  355
             DA+SRT GLDN G+V LQRQIM+EQDEGL KL  T+IST+HIALAVNEEL L TRL+D 
Sbjct  114  SDAISRTIGLDNQGIVDLQRQIMREQDEGLGKLAATMISTRHIALAVNEELSLHTRLVDY  173

Query  354  DLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL  184
              +EHV+VT+SRLQ+VQ++LA+LNKR    CSC C+++SVIGI+VLIA++Y++ K+L
Sbjct  174  TANEHVEVTNSRLQQVQRKLALLNKRNTDRCSCPCLVLSVIGIIVLIAIVYIMKKYL  230



>gb|KJB22169.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=196

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E KP DAMSRT GLDNSG+V LQRQIMKEQDE LEKLEET++STKHIALAVNEEL LQTR
Sbjct  113  ESKP-DAMSRTVGLDNSGLVGLQRQIMKEQDEDLEKLEETIVSTKHIALAVNEELDLQTR  171

Query  363  LI  358
            LI
Sbjct  172  LI  173



>ref|XP_008676698.1| PREDICTED: uncharacterized protein LOC100217094 isoform X1 [Zea 
mays]
 gb|ACN34822.1| unknown [Zea mays]
 gb|AFW61959.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=196

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG-  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  QSKKADDMSRVAGLDNQGIVVLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LIDDLDEHVDVTDSRLQRV  307
            LIDDL++HVDVT+SRLQ V
Sbjct  172  LIDDLEDHVDVTNSRLQIV  190



>ref|XP_002307951.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
 gb|EEE91474.1| hypothetical protein POPTR_0006s03120g [Populus trichocarpa]
Length=221

 Score =   194 bits (494),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 12/156 (8%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ ANR+ LLGP+
Sbjct  55   TKLDILQSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAANRENLLGPD  114

Query  540  IKPVD-AMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
             K  D  ++R +GLDN            EQDEGLEKLEETV STKHIALAVNEEL L T+
Sbjct  115  KKTDDDVVNRASGLDN-----------HEQDEGLEKLEETVTSTKHIALAVNEELTLHTK  163

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC  256
            L+DDLDEHVDVT+SRLQ VQ++LA+LNKRTKGGCSC
Sbjct  164  LLDDLDEHVDVTNSRLQTVQRKLALLNKRTKGGCSC  199



>gb|KJB81686.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=190

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLHSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E K  DAMSRT G DNSG+V LQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL L TR
Sbjct  113  ETK-ADAMSRTVGSDNSGLVGLQRQIMKEQDEGLEKLEETVISTKHIALAVNEELDLHTR  171

Query  363  LI  358
            LI
Sbjct  172  LI  173



>gb|KCW66898.1| hypothetical protein EUGRSUZ_F00647 [Eucalyptus grandis]
Length=175

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSL+++L+K P  +P+TEKEINRRKD+L+ LR++ NQM STL MS+ A RD LLGPE
Sbjct  55   TRLDSLQNILTK-PFSRPITEKEINRRKDLLSNLRTRVNQMDSTLKMSHSATRDSLLGPE  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
            IKP DAMSRT GLDN G+V LQRQ+M+EQDEGLEKLEETV+STKHIALAVNEEL L TRL
Sbjct  114  IKPADAMSRTAGLDNQGIVVLQRQVMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRL  173

Query  360  I  358
            I
Sbjct  174  I  174



>gb|AFW61961.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=177

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 2/122 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG-  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            + K  D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  112  QSKKADDMSRVAGLDNQGIVVLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LI  358
            LI
Sbjct  172  LI  173



>gb|EMS60104.1| Syntaxin-51 [Triticum urartu]
Length=241

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 113/173 (65%), Gaps = 35/173 (20%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLE +L++LP K  +T+KE+N+R+D L+ L+S+A QMA + NMS FANR+ LLG 
Sbjct  54   GTRLDSLEGMLARLPPKS-ITDKELNKRRDTLSNLKSRAKQMAESFNMSTFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK--------------------------------  460
              K  D MSR  GLDN G+V LQRQIMK                                
Sbjct  113  SKKAADDMSRVAGLDNQGIVGLQRQIMKGIDSGWLLDVMAGLSPSISTTLRQIRQCGRDM  172

Query  459  --EQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRV  307
              EQDEGLEKLE+TV+STKHIALAVNEEL L  RLIDDLD+HVD T+SRLQ V
Sbjct  173  WGEQDEGLEKLEQTVLSTKHIALAVNEELDLHARLIDDLDDHVDGTNSRLQVV  225



>gb|ACN36591.1| unknown [Zea mays]
Length=177

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
               P D MSR  GLDN G+V LQRQIMKEQDEGLEKLEETV+STKHIALAVNEEL L TR
Sbjct  113  SKMP-DDMSRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTR  171

Query  363  LI  358
            LI
Sbjct  172  LI  173



>gb|AAM52319.1|AC105363_8 Hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ25394.1| hypothetical protein OsJ_09212 [Oryza sativa Japonica Group]
Length=324

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLD ++  LS+LP KQ ++ KE+N+     +TL SK  ++ +      F+NR  LLGP+
Sbjct  146  TRLDMMQEDLSQLPNKQRISLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSNRSDLLGPD  205

Query  540  --IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQT  367
                 +D  S  N +DN  ++ LQR ++KEQD+ L+KLEET++STKHIALA+NEEL L T
Sbjct  206  DNHAKIDVSSIAN-MDNREIIELQRNVIKEQDDELDKLEETIVSTKHIALAINEELDLHT  264

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  187
            RLIDDLDE  + T ++LQR QK+L  +  R +   SC C+L+SVI +V+L+A+++ L  +
Sbjct  265  RLIDDLDEKTEETSNQLQRAQKKLKSVTTRMRKSASCSCLLLSVIAVVILVALLWALIMY  324



>gb|AFK42434.1| unknown [Lotus japonicus]
Length=149

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 87/98 (89%), Gaps = 4/98 (4%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDTLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLE  430
            EIKP DAMSRT GLDNSG+V LQRQIMKEQD+GLEKLE
Sbjct  111  EIKP-DAMSRTVGLDNSGLVGLQRQIMKEQDDGLEKLE  147



>ref|XP_001778077.1| predicted protein [Physcomitrella patens]
 gb|EDQ57083.1| predicted protein [Physcomitrella patens]
Length=223

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = -2

Query  717  RLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEI  538
            +LD LESLL     K  L+EKE+ RR++ML  +R K+ QM+++L+    A  + L+   I
Sbjct  53   KLDRLESLLQNGSLKSSLSEKELYRRQNMLVDIRYKSKQMSASLS---SAQDNSLMEGGI  109

Query  537  KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLI  358
             PV+   RT GLDNSG+V LQRQIMKEQD+ LE LE+TV+STKHIALAVNEEL L TRL+
Sbjct  110  APVET-GRTQGLDNSGLVKLQRQIMKEQDQDLESLEKTVMSTKHIALAVNEELNLHTRLL  168

Query  357  DDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCML  244
            DD+D+  DVT+++L   Q+RL  LNK    G S M M+
Sbjct  169  DDMDQSADVTNNKLLAAQRRLGFLNKNLGQGWSLMTMI  206



>gb|EAY88317.1| hypothetical protein OsI_09776 [Oryza sativa Indica Group]
Length=325

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 119/181 (66%), Gaps = 4/181 (2%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTE-KEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            TRLD ++  LS+LP K      KE+N+     +TL SK  ++ +      F+NR  LLGP
Sbjct  146  TRLDMMQEDLSQLPNKHACKSLKELNKLAAKHSTLSSKVKEVGAPFTRKRFSNRSDLLGP  205

Query  543  E--IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQ  370
            +     +D  S  N +DN  ++ LQR ++KEQD+ L+KLEET++STKHIALA+NEEL L 
Sbjct  206  DDNHAKIDVSSIAN-MDNREIIELQRNVIKEQDDELDKLEETIVSTKHIALAINEELDLH  264

Query  369  TRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFK  190
            TRLIDDLDE  + T ++LQR QK+L  +  R +   SC C+L+SVI +V+L+A+++ L  
Sbjct  265  TRLIDDLDEKTEETSNQLQRAQKKLKSVTTRMRKSASCSCLLLSVIAVVILVALLWALIM  324

Query  189  F  187
            +
Sbjct  325  Y  325



>ref|XP_001751913.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
 gb|EDQ83348.1| Qc-SNARE, SYP5 family [Physcomitrella patens]
Length=225

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
              +LD LESLL     K  L EKE+NRR++ML  +R K  QM+ +L+ S   NR  L+  
Sbjct  51   NNKLDRLESLLQSDSLKSSLNEKELNRRQNMLVDIRFKFKQMSESLS-STRDNRASLMEG  109

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
             I PV+  SRT  LDN+G+V LQRQIMKEQD+ LE LE+TV+ST HIALAVNEEL L TR
Sbjct  110  GIAPVET-SRTQDLDNTGLVKLQRQIMKEQDQDLESLEKTVLSTHHIALAVNEELDLHTR  168

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLM  241
            L+DD+D+  DVT++++   QKRL  LNK      S + M++
Sbjct  169  LLDDMDQDADVTNNKILAAQKRLGYLNKNLGQEWSLLTMII  209



>ref|XP_010111270.1| hypothetical protein L484_027923 [Morus notabilis]
 gb|EXC30748.1| hypothetical protein L484_027923 [Morus notabilis]
Length=182

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 11/136 (8%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+L++L+SLLSKLP+KQ L+ KE NRR+DML  L  +A +MA TLNMS  A+RD L G  
Sbjct  55   TKLETLQSLLSKLPSKQILSAKETNRRRDMLDKLSVQAGEMAPTLNMSMSADRDNLFGLN  114

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
             K  D M + N LDN            EQDE   +LEETV+STKHIALAVNEEL LQTRL
Sbjct  115  RKQDDMMKKANDLDN-----------HEQDEDFAQLEETVVSTKHIALAVNEELDLQTRL  163

Query  360  IDDLDEHVDVTDSRLQ  313
            +D+LDEHVD T+SRLQ
Sbjct  164  LDNLDEHVDSTNSRLQ  179



>ref|NP_173073.2| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
 gb|AEE29422.1| Target SNARE coiled-coil domain protein [Arabidopsis thaliana]
Length=193

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
             TR+ +L+ LL++   K  ++ KE++RRK     LRSKANQMAS L+M  F+N DILL P
Sbjct  54   ATRVQTLKYLLAESQGK-SISGKEMSRRKGTFENLRSKANQMASALDMLKFSNIDILLRP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
            E    D MSR  GLDN G+V L RQ+MKE DE L+ LEETV+  KH AL +NE++GLQTR
Sbjct  113  E--KDDIMSRVIGLDNQGIVGLHRQVMKEHDEALDMLEETVMRVKHNALVMNEQIGLQTR  170

Query  363  LIDDLDEHVDVTDSRLQRVQKR  298
            LID LD HVDV+DS ++ +  R
Sbjct  171  LIDGLDHHVDVSDSGVRVIHIR  192



>ref|XP_003562169.2| PREDICTED: syntaxin-52-like [Brachypodium distachyon]
Length=180

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  693  LSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN-RDILLGP----EIKPV  529
             S+L +KQ ++ KE+ +  +  + L  K  Q A+   M + +N R+ LLGP    +   +
Sbjct  8    FSQLSSKQHISLKEMRKLGESFSALSDKVKQAAAPFTMKHSSNNRNDLLGPSDLDKCAAI  67

Query  528  DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDL  349
            D +S T  +++  +V LQR +MK+QDE L++LEE++ STKHIALA+NEEL L T+LIDDL
Sbjct  68   D-VSSTANMEDREIVELQRTVMKKQDESLDRLEESIASTKHIALAINEELDLHTKLIDDL  126

Query  348  DEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  187
            D+  + T  +LQR QK+L  LN+R +   SC C+L++VI  V+ +AV++ L +F
Sbjct  127  DDRTEETAHQLQRAQKKLKSLNRRMRESGSCSCILLAVIAAVICVAVVWALIQF  180



>ref|XP_003617659.1| Syntaxin-51 [Medicago truncatula]
 gb|AET00618.1| syntaxin of plants protein [Medicago truncatula]
Length=167

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP KQPL+EKE NRR DMLA LRSK NQMASTLNMSNFAN+D L+GP
Sbjct  53   GTRLDSLQSLLSKLPGKQPLSEKEENRRMDMLANLRSKVNQMASTLNMSNFANKDRLVGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E+KP D MSRT GLDN+G+V  QRQIMK
Sbjct  113  EVKP-DVMSRTVGLDNNGLVGFQRQIMK  139



>gb|KJB22166.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=141

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E KP DAMSRT GLDNSG+V LQRQIMK
Sbjct  113  ESKP-DAMSRTVGLDNSGLVGLQRQIMK  139



>gb|KJB22167.1| hypothetical protein B456_004G032900 [Gossypium raimondii]
Length=152

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLTEKE+NRRKDM+A LRSK NQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLQSLLSR-PTGKPLTEKEMNRRKDMVANLRSKVNQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E KP DAMSRT GLDNSG+V LQRQIMK
Sbjct  113  ESKP-DAMSRTVGLDNSGLVGLQRQIMK  139



>gb|EMT07622.1| hypothetical protein F775_07967 [Aegilops tauschii]
Length=203

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = -2

Query  657  KEINRRKDMLATLRSKANQMASTLNMSNFA-NRDILLGP---EIKPVDAMSRTNGLDNSG  490
            KE+ +  +    L  K  ++A+   M   + NR+ LLGP       VD  S  N ++N  
Sbjct  44   KEMRKLAEKFDALELKVREVAAPFTMKKHSSNRNELLGPNDDRCTVVDIKSTAN-MENQE  102

Query  489  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  310
            +V LQR IMKEQDE L++LEET++STKHIALA+NEEL L  RLIDDLDE V+ T ++LQR
Sbjct  103  IVQLQRNIMKEQDECLDRLEETIVSTKHIALAINEELDLHVRLIDDLDERVEDTSTQLQR  162

Query  309  VQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKF  187
             QK+L  LN R +   SC  +L+S+I  V+ +AV++ L KF
Sbjct  163  AQKKLKSLNTRMRKSGSCTGILVSIIAGVIFVAVVWTLIKF  203



>gb|KJB81687.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
 gb|KJB81688.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=150

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLHSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT G DNSG+V LQRQIMK
Sbjct  113  ETK-ADAMSRTVGSDNSGLVGLQRQIMK  139



>gb|KJB81689.1| hypothetical protein B456_013G156800 [Gossypium raimondii]
Length=141

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L SL+S+ PT +PLTEKE+NRRKDM+A LRSKANQMAS  NMSNFANRD LLGP
Sbjct  54   GTRLDGLHSLMSR-PTGKPLTEKEMNRRKDMVANLRSKANQMASAFNMSNFANRDSLLGP  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT G DNSG+V LQRQIMK
Sbjct  113  ETK-ADAMSRTVGSDNSGLVGLQRQIMK  139



>gb|KJB11950.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=140

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11948.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=142

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11947.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=151

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMK  138



>gb|KJB11949.1| hypothetical protein B456_002G094300 [Gossypium raimondii]
Length=149

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+SLLS+ PT +PLT+KE+NRRKDM+A LRSKANQMAS  NMSNFANR+ LLGP
Sbjct  53   GTRLDGLQSLLSR-PTGKPLTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLLGP  111

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            E K  DAMSRT GLDNSG+V LQRQIMK
Sbjct  112  ETKQ-DAMSRTVGLDNSGLVGLQRQIMK  138



>emb|CBI25899.3| unnamed protein product [Vitis vinifera]
 emb|CBI25683.3| unnamed protein product [Vitis vinifera]
Length=94

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -2

Query  465  MKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAIL  286
            MKEQDEGL+ LEETVISTKHIALAVNEEL L TRLID LD+HVD TDSRL RVQK LAIL
Sbjct  1    MKEQDEGLDNLEETVISTKHIALAVNEELDLHTRLIDTLDQHVDTTDSRLGRVQKNLAIL  60

Query  285  NKRTKGGCSCMCM  247
            NKRTKGGC+C CM
Sbjct  61   NKRTKGGCTCFCM  73



>gb|KCW70251.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
 gb|KCW70252.1| hypothetical protein EUGRSUZ_F03509 [Eucalyptus grandis]
Length=177

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+S+L+K+P  +P++EKE+NRR+DML++LR+K +QMAS LNMSN   RD LLGP
Sbjct  54   GTRLDSLQSVLTKMPGNRPISEKEMNRRRDMLSSLRTKKDQMASALNMSNSRIRDSLLGP  113

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            + KP DAMSRT GLDN G+V LQRQ+MK
Sbjct  114  DAKPADAMSRTVGLDNQGIVGLQRQVMK  141



>gb|AAZ32890.1| syntaxin of plants [Medicago sativa]
Length=133

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 71/83 (86%), Gaps = 4/83 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSL+SLLSKLP K   +EKE+NRRKD LA LRSK NQMASTLNMSNFANRD LLGP
Sbjct  54   GTRLDSLQSLLSKLPVK---SEKEMNRRKDNLANLRSKVNQMASTLNMSNFANRDSLLGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQ  475
            EIKP DAMSRT GLDN+G+V L 
Sbjct  111  EIKP-DAMSRTVGLDNNGLVGLH  132



>ref|XP_002970090.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
 gb|EFJ29214.1| hypothetical protein SELMODRAFT_441012 [Selaginella moellendorffii]
Length=227

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = -2

Query  696  LLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAM  520
            L S L T +  L+EKE  RR+D + +L  +  Q+ S+   S  A  D+L      P    
Sbjct  57   LTSTLETLRGQLSEKEFFRRQDAIISLGLRVKQLDSSYKSSQNARDDLLADGTRGPPVET  116

Query  519  SRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEH  340
             +T GLDN G++A QRQ MK+QD  LE LE++V+STKHIAL VNEEL LQ  L+DD+D H
Sbjct  117  DKTTGLDNYGLIAFQRQTMKDQDVDLEDLEKSVVSTKHIALTVNEELDLQAHLLDDMDRH  176

Query  339  VDVTDSRLQRVQKRLAILNKRTKGGC-SCMC  250
             D T++ LQ V KRL +L+KR       C+C
Sbjct  177  ADRTNTVLQNVHKRLVVLSKRAGSSALGCLC  207



>ref|XP_005649717.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25173.1| Qc-snare protein, Syn8/Syntaxin8-family [Coccomyxa subellipsoidea 
C-169]
Length=236

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 109/184 (59%), Gaps = 10/184 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNM-SNFANRDILLG  547
            G  +DS+ S L      + +TE E NRR+D++  L+S+  QM  +L    N ANR  L+ 
Sbjct  54   GAAVDSMRSSLES-SALENITENERNRRRDLVNALKSRREQMLQSLRRDQNSANRTALME  112

Query  546  ---PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELG  376
               P+  P     +T  LDN G++ LQ Q M++QD  LE+LE TV STKHIAL VNEEL 
Sbjct  113  MNRPKA-PASETLQTADLDNRGILQLQDQSMRQQDAELEELERTVTSTKHIALTVNEELD  171

Query  375  LQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMC---MLMSVIGIVVLIAVI  205
            L  RL+DDLDE V+VT SR++  QK+L  +  R+ G C  MC   +LM  + +VV+I   
Sbjct  172  LHRRLLDDLDEDVEVTHSRMRTAQKKLKHVLARS-GNCRSMCVTMLLMIALAVVVIIGFK  230

Query  204  YMLF  193
               F
Sbjct  231  LAAF  234



>ref|XP_002985281.1| hypothetical protein SELMODRAFT_446189 [Selaginella moellendorffii]
 gb|EFJ13775.1| hypothetical protein SELMODRAFT_446189 [Selaginella moellendorffii]
Length=227

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 2/151 (1%)
 Frame = -2

Query  696  LLSKLPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAM  520
            L S L T +  L+EKE  R +D + +L  +  Q+ S+   S  A  D+L      P    
Sbjct  57   LTSTLETLRGQLSEKEFFRCQDAIISLGLRVKQLDSSYKSSQNARDDLLADGTRGPPVET  116

Query  519  SRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEH  340
             +T GLDN G++A QRQ MK+QD  LE LE++VISTKHIAL VNEEL LQ  L+DD+D H
Sbjct  117  DKTTGLDNYGLIAFQRQTMKDQDVDLEDLEKSVISTKHIALTVNEELDLQAHLLDDMDRH  176

Query  339  VDVTDSRLQRVQKRLAILNKRT-KGGCSCMC  250
             D T++ LQ V KRL +L+KR       C+C
Sbjct  177  ADRTNTVLQNVHKRLVVLSKRAGSSALGCLC  207



>ref|XP_002465967.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
 gb|EER92965.1| hypothetical protein SORBIDRAFT_01g049130 [Sorghum bicolor]
Length=251

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 114/177 (64%), Gaps = 2/177 (1%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+  LS LP +Q ++ K++ +  + LA + SKA ++     M   ++R+ L G 
Sbjct  75   GTRLDMLKEDLSDLPKRQNISLKQLGKLAEKLAGVCSKAQEVGGQFTMKYSSDRNDLCGW  134

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTR  364
              K +D  S  N +DN  +V LQR++MKEQD  L+ LEETV STKHIALA+N EL L T+
Sbjct  135  SAK-IDVNSIAN-MDNHEMVKLQRKVMKEQDAELKILEETVTSTKHIALAINGELDLHTK  192

Query  363  LIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLF  193
            LI+ LDE V+ T ++LQR  KRL  LN R +   SC  +++SV+ +V+ +AV + L 
Sbjct  193  LIEKLDEDVEETSNQLQRALKRLKALNTRMRKSRSCWGIVLSVVAVVICVAVFWALI  249



>gb|EMS59036.1| Syntaxin-51 [Triticum urartu]
Length=207

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 94/147 (64%), Gaps = 5/147 (3%)
 Frame = -2

Query  657  KEINRRKDMLATLRSKANQMASTLNMSNFA-NRDILLGPE---IKPVDAMSRTNGLDNSG  490
            KE+ +  +    L  K  ++A+   M   + NR+ LLGP       VD  S  N ++N  
Sbjct  26   KEMRKLAEKFDALELKVKEVAAPFTMKKHSSNRNELLGPSDDRCTVVDIKSTAN-MENQE  84

Query  489  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  310
            +V LQR IMKEQDE L++LEET++STKHIALA+NEEL L  RLIDDLDE V+ T ++LQR
Sbjct  85   IVQLQRNIMKEQDECLDRLEETIVSTKHIALAINEELDLHVRLIDDLDERVEDTSNQLQR  144

Query  309  VQKRLAILNKRTKGGCSCMCMLMSVIG  229
             QK+L  LN R +   SC  +L+S+I 
Sbjct  145  AQKKLKSLNTRMRKSGSCTGILVSIIA  171



>ref|NP_683311.2| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
 gb|AEE29421.1| putative syntaxin-type t-SNARE protein [Arabidopsis thaliana]
Length=199

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 13/157 (8%)
 Frame = -2

Query  708  SLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPV  529
            +L++LL++   K  ++ KE++R KDM+  LRSKA QMAS L+M  F+N   LLG +    
Sbjct  35   TLKNLLAESQGK-SISAKEMSRCKDMVEDLRSKAYQMASALDMLKFSNIGSLLGQD----  89

Query  528  DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDL  349
            D MSR   +DN  +V  QR  MK QD+ LE LE+ V+  K  ALA+N ELGLQTRLID L
Sbjct  90   DIMSRVIDMDNQEIVGFQRTTMKVQDKALEMLEKGVMHLKREALAMNMELGLQTRLIDRL  149

Query  348  DEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMS  238
            D HVDV+ S ++ +Q        R+     CM +L+S
Sbjct  150  DHHVDVSASDVEELQ--------RSIDTGVCMTLLLS  178



>gb|ABI84247.1| syntaxin [Arachis hypogaea]
Length=152

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            G RLDSL+SLLSK+P K   +EKE+NRR++ L TLRSK NQMASTLNMSNFANRD L GP
Sbjct  54   GIRLDSLQSLLSKVPGK---SEKEMNRRRETLTTLRSKVNQMASTLNMSNFANRDSLFGP  110

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMKEQD  451
            EIKP DAMSR  G      + L R IMKE +
Sbjct  111  EIKP-DAMSRNVGWITVDSLGLSRPIMKEPE  140



>gb|ACF80713.1| unknown [Zea mays]
Length=148

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESL  ++P K  +T+KE+++R+DML++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  54   GTRLDSLESLFGRIPPKS-ITDKEMHKRQDMLSSLKSKAKQMATSFNMSNFANREDLLGQ  112

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
               P D MSR  GLDN G+V LQRQIMK
Sbjct  113  SKMP-DDMSRVAGLDNQGIVGLQRQIMK  139



>gb|AFW61957.1| hypothetical protein ZEAMMB73_963395 [Zea mays]
Length=192

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLDSLESLL ++P K  +T+KE+++R+DM ++L+SKA QMA++ NMSNFANR+ LLG 
Sbjct  98   GTRLDSLESLLGRIPPKS-ITDKEMHKRQDMFSSLKSKAKQMATSFNMSNFANREDLLG-  155

Query  543  EIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            + K  D MSR  GLDN G+V LQRQIMK
Sbjct  156  QSKKADDMSRVAGLDNQGIVVLQRQIMK  183



>gb|EAZ06340.1| hypothetical protein OsI_28572 [Oryza sativa Indica Group]
Length=146

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            TRLDSLE+LLSK+P K  L++KE+++R+D L+ L+SK  QMA++ NMSNFANR+ LLG  
Sbjct  55   TRLDSLEALLSKIPPKS-LSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQN  113

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMK  460
             K  D MSR  GLDN G+V LQRQIMK
Sbjct  114  KKAADDMSRVAGLDNQGIVGLQRQIMK  140



>gb|ABK92777.1| unknown [Populus trichocarpa]
Length=146

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLL+ LP+KQP+T KE+NR +DML  L +K NQMA+TLN+S+ ANR+ LLGP+
Sbjct  55   TKLDILQSLLTALPSKQPITGKEMNRLQDMLKNLSTKVNQMATTLNISSAANRENLLGPD  114

Query  540  IKP-VDAMSRTNGLDNSGVVALQRQIMK  460
             K   D ++R +GLDN G+V  QRQIMK
Sbjct  115  KKTDDDVVNRASGLDNHGLVGFQRQIMK  142



>ref|XP_002951465.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
 gb|EFJ47641.1| Qc-SNARE, Syn8/Syntaxin8-family [Volvox carteri f. nagariensis]
Length=234

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 109/184 (59%), Gaps = 11/184 (6%)
 Frame = -2

Query  705  LESLLSKLPTK--QPLTEKEINRRKDMLATLRSKANQMASTLNMSNF-ANRDILLG----  547
            L+ LL  L T   + L+E E NRR+D+L  LR++  QM   +  S   ++RD L G    
Sbjct  52   LDRLLRWLDTSDAEALSEPEKNRRRDLLYDLRNRREQMQLAIKRSQGQSDRDALFGGPSA  111

Query  546  ---PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELG  376
               P   P +  S T GLDN G++ LQ+Q+M++QDE LE +E+ V +TKHIALA+ EE+ 
Sbjct  112  SGGPAAPPRETES-TAGLDNRGLLGLQQQVMRQQDEELEAMEKVVHNTKHIALAIGEEVD  170

Query  375  LQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYML  196
            LQTRL+DDL + VDVT +RL+    R+  + K +      MC  + VI +V +I +   L
Sbjct  171  LQTRLLDDLADDVDVTHNRLRAATARVRHVLKSSSNWRLGMCAFLLVITLVAVILLTVKL  230

Query  195  FKFL  184
             KF 
Sbjct  231  SKFF  234



>ref|XP_004987204.1| PREDICTED: syntaxin-52-like [Setaria italica]
Length=221

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            GTRLD L+  LS LP KQ ++ K++N+  + L+ L SKA ++     M++ ++ + L G 
Sbjct  73   GTRLDMLQEDLSDLPKKQNISLKQLNKLAEKLSGLSSKAKEVGGQFTMNHSSDGNDLCGS  132

Query  543  EIKP--VDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQ  370
              K   +D  S  + +DN  +V LQR++MKEQD  LE LEETV+STKHIALA+NEEL LQ
Sbjct  133  SEKSTKIDVNSIAD-MDNRDMVNLQRKVMKEQDSQLEILEETVVSTKHIALAINEELDLQ  191

Query  369  TRLI  358
            TRLI
Sbjct  192  TRLI  195



>ref|XP_006380963.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
 gb|ERP58760.1| hypothetical protein POPTR_0006s03130g [Populus trichocarpa]
Length=164

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 74/158 (47%), Gaps = 67/158 (42%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPE  541
            T+LD L+SLLS LP+KQPL   E                  +++ N   F          
Sbjct  55   TKLDILQSLLSALPSKQPLERDE------------------SASRNAEKFE---------  87

Query  540  IKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRL  361
                                      K+QDEGLEKLEETVISTKHIALAVNEEL L TRL
Sbjct  88   -------------------------YKKQDEGLEKLEETVISTKHIALAVNEELTLHTRL  122

Query  360  IDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCM  247
            +               RVQK LAILNKRTKGGC+C   
Sbjct  123  L---------------RVQKNLAILNKRTKGGCACWVF  145



>ref|XP_001691539.1| Qc-SNARE protein, Syn8/Syntaxin8-family [Chlamydomonas reinhardtii]
 gb|EDP04647.1| Qc-SNARE protein, Syn8/Syntaxin8-family [Chlamydomonas reinhardtii]
Length=243

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 108/187 (58%), Gaps = 9/187 (5%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMS-NFANRDILL-  550
            G +LD L   L   P    L+E E NRR+D++  LR +   M  ++  S   A+RD L  
Sbjct  59   GVQLDKLLRWLDS-PEADSLSEPEKNRRRDLIHDLRGRREGMQMSIKRSTGAADRDALFS  117

Query  549  --GPEIKPVDA--MSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  382
              GP   P+       T  LDN G++ LQ+ +M+ QDE L  +E+TV STKHIALA+ EE
Sbjct  118  GAGPSSGPLPPRETEATAELDNRGLLGLQQAVMRRQDEELAAMEKTVASTKHIALAIGEE  177

Query  381  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC-MCMLMSVIGIVVLIAVI  205
            + LQTRL+DDL + VDVT SRL+    ++  L  R  G C   +C+ + ++ +VV+I + 
Sbjct  178  VDLQTRLLDDLADDVDVTQSRLKAATAKVKQL-MRDSGNCRLGVCVFILIVTLVVVIILT  236

Query  204  YMLFKFL  184
              L +FL
Sbjct  237  VKLARFL  243



>ref|XP_011398897.1| Syntaxin-52 [Auxenochlorella protothecoides]
 gb|KFM26001.1| Syntaxin-52 [Auxenochlorella protothecoides]
Length=240

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 93/166 (56%), Gaps = 16/166 (10%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL--NMSNFANRDILL  550
            GT+LD+L S +   P    LTE E NRR+D +A LR+K   M ++L  +  + A R  LL
Sbjct  53   GTKLDALRSGIEAAPD---LTENERNRRRDQVAALRNKREGMLTSLRRDGGHSAARAALL  109

Query  549  GPEIKPVDAMSRTNG--------LDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALA  394
                 P    +   G        L ++G++ LQR +M +QD  LE+LE  V STKH+AL 
Sbjct  110  SSPAAPSGPAAPGRGRESEATAPLTSAGLMELQRDVMSQQDRELEQLERGVASTKHVALR  169

Query  393  VNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC  256
            +NEE  L  RL++ L+E VDV+ SRL   Q+RL  +  R +   SC
Sbjct  170  INEEATLHNRLLEGLEEDVDVSRSRLAAAQRRLKGVMHRAR---SC  212



>ref|XP_005850452.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
 gb|EFN58350.1| hypothetical protein CHLNCDRAFT_59611 [Chlorella variabilis]
Length=242

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 98/169 (58%), Gaps = 20/169 (12%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSN-FANRDILL-  550
            G+ LD+L S L + P    LTE E NRR+D++A+LR +  QM ++L      A RD LL 
Sbjct  54   GSLLDALRSSL-EAPQYAGLTENERNRRRDLVASLRMRREQMLASLKREQPRAARDTLLG  112

Query  549  -----------GPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHI  403
                           +  DA +  +   + G++ +Q+Q+M++QD  LE LE TV+ TKHI
Sbjct  113  GGPGSGSSGSMATAGRETDATAERS---SQGLLQMQQQVMQQQDRDLESLERTVVGTKHI  169

Query  402  ALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC  256
            AL +NEE  L  RL+DDLDE VD T SRL   Q+RL ++ +R   G SC
Sbjct  170  ALQINEEADLHNRLLDDLDEEVDGTRSRLAAAQRRLKLVMRR---GGSC  215



>ref|XP_003064731.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51065.1| predicted protein [Micromonas pusilla CCMP1545]
Length=246

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 101/190 (53%), Gaps = 23/190 (12%)
 Frame = -2

Query  717  RLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDI------  556
            +LD LE+LL    T+  + EKE  RR+D++  LR +  ++ S L  +     ++      
Sbjct  60   KLDKLENLL----TETRINEKETTRRRDLMRGLRVRGEEVVSLLGENPSGGGEVVAVAAA  115

Query  555  ---------LLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHI  403
                     +   E       +RT GLD+  ++ LQR  M+EQD+ L+ L   V STKHI
Sbjct  116  ATTRDDASRMERGERSRTPETARTAGLDDDSLLQLQRNTMREQDDDLDDLSRIVTSTKHI  175

Query  402  ALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSC-MCMLMSVIGI  226
             LAV EE+ LQ+RL+D+LDE V  T S L+R    L I  +      +C + + MSV+  
Sbjct  176  GLAVGEEIDLQSRLLDELDEDVSRTGSALRRA---LRIAKRVFSKAENCKLLVYMSVLVA  232

Query  225  VVLIAVIYML  196
            ++L A++ +L
Sbjct  233  ILLAALVIVL  242



>gb|KIZ07812.1| Syntaxin-51 [Monoraphidium neglectum]
Length=239

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 107/189 (57%), Gaps = 19/189 (10%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN-MSNFANRDILLG  547
            GT LDSL   L        L+E+E  RR+D+L  L+++  Q+  +L      ++R+ L+ 
Sbjct  53   GTTLDSLYRWLDS-DDANSLSEQERFRRRDLLHVLKNRREQIQESLKRQQQHSDRESLMA  111

Query  546  PEIK------PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNE  385
                      P      T  LD+ G++ LQ Q+M++QD  LE++E+TV STKHIA+ + E
Sbjct  112  GGSSGRGGGGPARETEVTAQLDSRGMLQLQEQVMQQQDRELEQMEKTVTSTKHIAVTIGE  171

Query  384  ELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRT---KGGCSCMCMLMSVIGIVVLI  214
            EL L TRL+ DL+E VDVT SRL+   KR+  + K +   KGG       + + G++V++
Sbjct  172  ELDLHTRLLGDLEEDVDVTHSRLRAATKRVRHIIKHSSNWKGG-------LFIFGLIVVL  224

Query  213  AVIYMLFKF  187
             ++ ML  F
Sbjct  225  TLL-MLVAF  232



>gb|KDD75355.1| hypothetical protein H632_c726p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=191

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 10/142 (7%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFA-NRDILL-  550
            GT LD L+  L       P +E E NRR+D+++ LR +  QM   L     A  R  L  
Sbjct  53   GTILDRLKHGLDG-----PESENERNRRRDLISALRGRREQMLQALKRDGAAAQRGALFA  107

Query  549  ---GPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL  379
               G          +T  L+ +G+++LQ++IM +QD  LE LE +V  TKHIAL +NEE 
Sbjct  108  GSSGQGAPSGQETIQTAELNATGLLSLQQEIMSQQDRDLESLEHSVAGTKHIALQINEET  167

Query  378  GLQTRLIDDLDEHVDVTDSRLQ  313
             L  RL++DLDE V  T SR++
Sbjct  168  TLHNRLLEDLDEEVSATSSRMK  189



>ref|XP_002504673.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65931.1| predicted protein [Micromonas sp. RCC299]
Length=222

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 23/160 (14%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLG--  547
            ++LD+LE  LS       +TE+E  RR+ ML  LR+             F +  I +G  
Sbjct  54   SKLDTLEEDLSH----AIVTERESRRREGMLRELRA------------CFEDLQIRIGGP  97

Query  546  ----PEIKPVDA-MSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  382
                P + PV+  +     LDN  ++ LQR +M+EQDE LE+L   V STKHI LAV EE
Sbjct  98   GSPEPVVMPVETRVDVEEELDNRSILQLQRNLMREQDEELEELSRVVTSTKHIGLAVGEE  157

Query  381  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGC  262
            L L  RL+DDL++ V+ + S ++R       + + + GGC
Sbjct  158  LDLHARLLDDLEDDVERSGSMIRRAHALAKAVYENSGGGC  197



>ref|XP_004363668.1| hypothetical protein CAOG_03940 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93100.1| hypothetical protein CAOG_003940 [Capsaspora owczarzaki ATCC 
30864]
Length=250

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 95/165 (58%), Gaps = 14/165 (8%)
 Frame = -2

Query  720  TRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMS-----NFANRDI  556
            T + SLE  L +   +  +T+KE++RR+ + + LRS+ +Q+ S  N +       A+RD 
Sbjct  66   TSIASLEQALDRAGRQYTITDKELSRRQGLTSALRSRRDQLNSMFNKNMEPGQAEASRDT  125

Query  555  LL--------GPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIA  400
            LL        G    PV+    T GLDN+ +++ Q+QIM++QD GL+ L+  +   KHI 
Sbjct  126  LLYGAPGRAFGQGAAPVE-REDTQGLDNATLLSRQQQIMQDQDRGLDALQAAIARQKHIG  184

Query  399  LAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGG  265
            +A+ +E+  Q +L+DDL++ +D T  +L++    +  + ++ K G
Sbjct  185  VAIGDEVDSQNQLLDDLEDGMDHTHGKLRQETLHVMTITEKAKTG  229



>dbj|BAC57351.1| unknown protein [Oryza sativa Japonica Group]
Length=355

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 11/65 (17%)
 Frame = -2

Query  483  ALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQ  304
            A+  Q+ KEQDEGLEKLEETV+STKHIA           RLIDDLD+HVDVT+SRLQRVQ
Sbjct  302  AVDSQVTKEQDEGLEKLEETVLSTKHIA-----------RLIDDLDDHVDVTNSRLQRVQ  350

Query  303  KRLAI  289
            + L  
Sbjct  351  RGLPF  355



>ref|XP_006836710.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
 gb|ERM99563.1| hypothetical protein AMTR_s00088p00114030 [Amborella trichopoda]
Length=63

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  633  MLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQRQIMK  460
            M   LRSKA+QMASTLNMSNF NR+ LL  + KPV  ++RT GLDN G+V LQRQIM+
Sbjct  1    MFVNLRSKASQMASTLNMSNFGNRNNLLEQDSKPVAEINRTTGLDNYGLVGLQRQIMR  58



>ref|XP_009050690.1| hypothetical protein LOTGIDRAFT_205331 [Lottia gigantea]
 gb|ESO98633.1| hypothetical protein LOTGIDRAFT_205331 [Lottia gigantea]
Length=246

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 91/172 (53%), Gaps = 17/172 (10%)
 Frame = -2

Query  666  LTEKEINRRKDMLATLRSKANQM----------ASTLNMSNFANRDILLGPEI----KPV  529
            +T++E+ RR+ ++  L SK  Q+           S +      +R  LLG E      P 
Sbjct  71   ITQREVERRQMLVDNLTSKEKQLDQAFRNESGAGSYVRSPGKGDRSSLLGGETFGANDPW  130

Query  528  ---DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLI  358
               +   +  G+ NSG+ A Q+ +++EQD GL+ L   +   K +AL + +E+  Q  LI
Sbjct  131  GIGEEPDQFQGVTNSGLQAQQQSVIQEQDRGLDALSSVIARQKQMALDIGDEVDQQNILI  190

Query  357  DDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIY  202
            DD+ +HVD T  RL +  + + I++K++   C  + +++  I ++V++AV Y
Sbjct  191  DDITDHVDRTGERLIKETRHVNIVDKKSNTCCYWVIIVVLFITMIVIVAVPY  242



>ref|XP_002676758.1| predicted protein [Naegleria gruberi]
 gb|EFC44014.1| predicted protein [Naegleria gruberi]
Length=243

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 97/183 (53%), Gaps = 14/183 (8%)
 Frame = -2

Query  684  LPT-KQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRD-------ILLGPEIKPV  529
            LPT    +++KE  RRKD L TL  K        +    A  +       I++       
Sbjct  66   LPTIANEISKKEALRRKDELQTLIRKEQDFKKMFDNPATARNELFEDDVPIIVKKNYSRD  125

Query  528  DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDL  349
            +       L+   +++ Q+++M +QD+ L+ L   +  TK I L++++EL   TRL++D+
Sbjct  126  EEPESIRDLEGHQILSYQKKVMDDQDKSLDALSNALSRTKQIGLSIDDELDEHTRLLEDI  185

Query  348  DEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYMLFKFL*CRSL  169
             E+VD+T+S+++   K++  L K  K   +C  ++++VI  V++IA++ +LF      + 
Sbjct  186  HENVDITESKIKVQTKKMVNLAK--KNSFTCWGIIIAVILFVIIIALLIVLF----TTTK  239

Query  168  YFT  160
            YFT
Sbjct  240  YFT  242



>ref|XP_011418529.1| PREDICTED: syntaxin-8-like [Crassostrea gigas]
Length=239

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 90/180 (50%), Gaps = 9/180 (5%)
 Frame = -2

Query  714  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIK  535
            L+ L+  L +  +   +T++E+ RR+ M+  L +K  Q+       N  +R  L+G    
Sbjct  55   LNKLKQSLIRASSSYHITQREVERRQMMMDNLITKEKQLDQAFKNENTESRSSLMGAGAS  114

Query  534  PV---------DAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  382
                       D      G DN  +   Q+ I++EQD+GL+ L + +   K +A+ +  E
Sbjct  115  GFGGRDPWGVRDEPEEFEGFDNQAIAQQQKTIIQEQDKGLDSLSKVISRQKQMAIDIGNE  174

Query  381  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIY  202
            +  Q  LIDD+ +H+D T  RL +  + + I+++++      + +++  + I+V++ V +
Sbjct  175  VDGQNDLIDDIGDHMDQTKERLVKETRHIRIVDRKSATCGYWVAIILIFVAIIVILIVPF  234



>ref|XP_011027754.1| PREDICTED: syntaxin-61 [Populus euphratica]
Length=246

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 98/187 (52%), Gaps = 16/187 (9%)
 Frame = -2

Query  714  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRS------KANQMASTLNMSNFAN----  565
            LD   S+ ++ P+   + E E+ +R+   +T R+      KA      LN+S  A+    
Sbjct  60   LDKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKKAVVAGKELNLSGTASVNGM  119

Query  564  -RDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKHIA  400
             R+++  P+ +  D  S     DN   +  +  RQ++  K+QDE L++L  +V     + 
Sbjct  120  RRELMRMPDTQQTDK-SNQYTQDNDDFIQSESDRQMLLIKQQDEELDELSASVERIGGVG  178

Query  399  LAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVV  220
            L ++EEL  Q R+IDDLD  +D T +RL  VQK++A++ K+       M +L  V+  ++
Sbjct  179  LTIHEELLAQERIIDDLDTEMDTTSNRLDFVQKKVAMVMKKASAKGQLMMILFLVVLFII  238

Query  219  LIAVIYM  199
            L  ++++
Sbjct  239  LFVLVFL  245



>ref|XP_011109213.1| hypothetical protein H072_3230 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42860.1| hypothetical protein H072_3230 [Dactylellina haptotyla CBS 200.50]
Length=364

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 82/163 (50%), Gaps = 26/163 (16%)
 Frame = -2

Query  693  LSKLPTKQPLTEKEINRRKDMLAT-------LRSKANQMASTLNMSNFANR-DILLGPEI  538
            L+K+P    L + EI RRKD+L++       L + AN   +  +  N  N  DI++  E 
Sbjct  202  LTKVPGNGGLGDGEIRRRKDLLSSGMKERDALDALANSALTRKSQGNSGNSPDIIVTSEA  261

Query  537  ------------------KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVIST  412
                               P     RT  LDN+GV+ LQ+QIMK QDE LE L +TV   
Sbjct  262  LKTAAGNIRGRSAGRILGVPAPETDRTRQLDNAGVLQLQQQIMKSQDEDLETLLKTVGRQ  321

Query  411  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILN  283
            KH+ + + +EL  Q  L++ L   VD  D +L+ V+KRL  +N
Sbjct  322  KHMGIEIGQELDDQNELLNSLGVDVDRVDDKLRVVKKRLKNIN  364



>ref|XP_010499380.1| PREDICTED: syntaxin-61 isoform X2 [Camelina sativa]
Length=206

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 103/191 (54%), Gaps = 19/191 (10%)
 Frame = -2

Query  723  GTRLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNM  580
            G ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    
Sbjct  15   GRKVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGH  74

Query  579  SNFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVIST  412
            ++   R+++  P     +   +  G D+ G V  +  RQ++  K+QDE L++L ++V   
Sbjct  75   ASEVRRELMRMPNANEANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRI  134

Query  411  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMS  238
              + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ 
Sbjct  135  GGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-  193

Query  237  VIGIVVLIAVI  205
            V+ I++ + V 
Sbjct  194  VLFIILFVLVF  204



>ref|XP_006304138.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 ref|XP_006304139.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37036.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37037.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
Length=245

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 102/190 (54%), Gaps = 19/190 (10%)
 Frame = -2

Query  720  TRLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNMS  577
             ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    +
Sbjct  55   WQVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHA  114

Query  576  NFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTK  409
            N   R+++  P     +   +  G D+ G V  +  RQ++  K+QDE L++L ++V    
Sbjct  115  NEVRRELMRMPNSNEANKYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIG  174

Query  408  HIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMSV  235
             + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ V
Sbjct  175  GVGLTIHDELIAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-V  233

Query  234  IGIVVLIAVI  205
            + I++ + V 
Sbjct  234  LFIILFVLVF  243



>ref|NP_001031102.2| syntaxin-61 [Arabidopsis thaliana]
 gb|AEE30983.1| syntaxin-61 [Arabidopsis thaliana]
Length=206

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 102/191 (53%), Gaps = 19/191 (10%)
 Frame = -2

Query  723  GTRLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNM  580
            G ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    
Sbjct  15   GRKVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGH  74

Query  579  SNFANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVIST  412
            ++   R+++  P         +  G D+ G V  +  RQ++  K+QDE L++L ++V   
Sbjct  75   ASEVRRELMRMPNSGEASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRI  134

Query  411  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMS  238
              + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ 
Sbjct  135  GGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-  193

Query  237  VIGIVVLIAVI  205
            V+ I++ + V 
Sbjct  194  VLFIILFVLVF  204



>ref|XP_003293989.1| hypothetical protein DICPUDRAFT_42819 [Dictyostelium purpureum]
 gb|EGC29480.1| hypothetical protein DICPUDRAFT_42819 [Dictyostelium purpureum]
Length=247

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 85/150 (57%), Gaps = 15/150 (10%)
 Frame = -2

Query  666  LTEKEINRRKDMLATLRSKANQMASTLN--MSNFANRDILL----------GPEIKPVDA  523
            +TE+E+ RRK+ +  L S  NQ+++TL+  ++N  +++ LL          G   KP + 
Sbjct  70   ITEQELLRRKNKVENLVSIKNQLSNTLDSAINNTNSKNALLGGNNNNGRAFGQFGKPRET  129

Query  522  MSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDE  343
              +T   DN+ +   Q++IMK+QDE L+ L  +++ TK+IA A+N EL     ++DD++ 
Sbjct  130  -DQTRQFDNTALYNNQKEIMKQQDESLDLLSNSIMRTKNIAYAMNNELEAHNEILDDIEI  188

Query  342  HVDVTDSRLQRVQKRLAILNKRTKGGCSCM  253
              + T  RL+    ++ ++  +   G +CM
Sbjct  189  GTERTTVRLKNTNSKMEVI--KQNAGSTCM  216



>emb|CEG64180.1| hypothetical protein RMATCC62417_01202 [Rhizopus microsporus]
Length=353

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 85/173 (49%), Gaps = 33/173 (19%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN-------  565
              +L +LES L+ L T   L+E E+ RR+DM+++L+ + + +    N S  A+       
Sbjct  180  SAKLSTLESGLNSLST--ILSEGELRRRQDMVSSLKDEKDALMQLANTSARADQQLEQQK  237

Query  564  -------RDILLGPEIKPV-DAMSR---------------TNGLDNSGVVALQRQIMKEQ  454
                   R  L   EIKP    M R               T GLDN G+V  Q Q+MKEQ
Sbjct  238  QQPVTQERKALFN-EIKPERKGMGRAFGAAYKKQLQETEVTRGLDNEGLVVYQDQLMKEQ  296

Query  453  DEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRL  295
            D+ +E+    +   K + + +  EL  Q +L+D+LD  VD T ++L+   K+L
Sbjct  297  DQQIEQFSSILARQKQLGITIGHELDTQNQLLDELDADVDRTQTKLKFANKKL  349



>ref|XP_002305773.2| Syntaxin 61 family protein [Populus trichocarpa]
 gb|EEE86284.2| Syntaxin 61 family protein [Populus trichocarpa]
Length=246

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 97/187 (52%), Gaps = 16/187 (9%)
 Frame = -2

Query  714  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRS------KANQMASTLNMSNFAN----  565
            LD   S+ ++ P+   + E E+ +R+   +T R+      KA      LN+S  A+    
Sbjct  60   LDKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKKAVVAGKELNLSGTASVNGM  119

Query  564  -RDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKHIA  400
             R+++  P+ +  D  S     DN   +  +  RQ++  K+QD+ L++L  +V     + 
Sbjct  120  RRELMRMPDAQQTDK-SNQYTQDNDDFIQSESDRQMLLIKQQDDELDELSASVERIGGVG  178

Query  399  LAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVV  220
            L ++EEL  Q R+I DLD  +D T +RL  VQK++A++ K+       M +L  V+  ++
Sbjct  179  LTIHEELLAQERIIGDLDTEMDTTSNRLDFVQKKVAMVMKKASAKGQLMMILFLVVLFII  238

Query  219  LIAVIYM  199
            L  ++++
Sbjct  239  LFVLVFL  245



>ref|XP_010499379.1| PREDICTED: syntaxin-61 isoform X1 [Camelina sativa]
 ref|XP_010460647.1| PREDICTED: syntaxin-61 [Camelina sativa]
Length=245

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 102/189 (54%), Gaps = 19/189 (10%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNMSN  574
            ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    ++
Sbjct  56   QVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHAS  115

Query  573  FANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKH  406
               R+++  P     +   +  G D+ G V  +  RQ++  K+QDE L++L ++V     
Sbjct  116  EVRRELMRMPNANEANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGG  175

Query  405  IALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMSVI  232
            + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ V+
Sbjct  176  VGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-VL  234

Query  231  GIVVLIAVI  205
             I++ + V 
Sbjct  235  FIILFVLVF  243



>gb|KFM68060.1| Syntaxin-8, partial [Stegodyphus mimosarum]
Length=234

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 88/174 (51%), Gaps = 9/174 (5%)
 Frame = -2

Query  711  DSLESLLSKL-PTKQPLTEKEINRRKDMLATLRSKANQMASTLNM-SNFANRDILLG---  547
            DS++SL   L  +K  +TE E  RR+ +L TL SK   +    N      +R+ LLG   
Sbjct  55   DSMKSLKQTLLASKSVITEAEFERRQRLLDTLSSKRLHIDDAFNCREEGGSRNALLGGNL  114

Query  546  ----PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEEL  379
                  +  ++    T  L    +   Q+  +KEQD+GL+ L + V+  K +A  + +EL
Sbjct  115  SGHSSNVWDIEESEATKDLTVDEIREQQKLAIKEQDKGLDTLYDVVVRQKQMAQNIGQEL  174

Query  378  GLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVL  217
             LQ  +I+D+ +H D T  RL    + + I+++++   C  + +++  I I V+
Sbjct  175  DLQNEIIEDIVDHADDTRKRLITETRHVTIVDRKSGTCCYWVIIMLLFIAIAVV  228



>ref|XP_010478222.1| PREDICTED: syntaxin-61-like [Camelina sativa]
 ref|XP_010478223.1| PREDICTED: syntaxin-61-like [Camelina sativa]
 ref|XP_010478224.1| PREDICTED: syntaxin-61-like [Camelina sativa]
Length=245

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 101/189 (53%), Gaps = 19/189 (10%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNMSN  574
            ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    ++
Sbjct  56   QVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVSAGKVSSGAGHAS  115

Query  573  FANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKH  406
               R+++  P     +      G D+ G V  +  RQ++  K+QDE L++L ++V     
Sbjct  116  EVRRELMRLPNANEANRYDHYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGG  175

Query  405  IALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMSVI  232
            + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ V+
Sbjct  176  VGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-VL  234

Query  231  GIVVLIAVI  205
             I++ + V 
Sbjct  235  FIILFVLVF  243



>ref|XP_001750756.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84461.1| predicted protein [Monosiga brevicollis MX1]
Length=232

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 10/164 (6%)
 Frame = -2

Query  714  LDSLESLLSKLPTKQPLTEKEINRRKDML-------ATLRSKANQMASTLNMSNFANRDI  556
            LD L+  L    +   +T KE +RR++ L        TL  +  Q  S   MS+  +R+ 
Sbjct  54   LDKLQKQLENDASSYAVTAKEADRRQNQLRQLNSRFKTLEGQFGQGNSNSAMSSDYHRNA  113

Query  555  LLGPEI--KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEE  382
            L G      PV+    T G D   ++  Q +IM EQD GL  +  +    K + +A+ +E
Sbjct  114  LYGSAGGRAPVED-EYTRGQDTQALLQEQDRIMDEQDRGLSTISASAQRLKQVGMAIGDE  172

Query  381  LGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMC  250
            L  Q  ++D+L + +D+TD RL+R  + +  ++++ K G    C
Sbjct  173  LDDQNEMLDELGQGMDITDRRLKRETEHVVYVSEKAKAGGMFCC  216



>gb|AAL59937.1| unknown protein [Arabidopsis thaliana]
Length=245

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 101/189 (53%), Gaps = 19/189 (10%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNMSN  574
            ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    ++
Sbjct  56   QVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHAS  115

Query  573  FANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKH  406
               R+++  P         +  G D+ G V  +  RQ++  K+QDE L++L ++V     
Sbjct  116  EVRRELMRMPNSGEASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGG  175

Query  405  IALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMSVI  232
            + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ V+
Sbjct  176  VGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-VL  234

Query  231  GIVVLIAVI  205
             I++ I V 
Sbjct  235  FIILFILVF  243



>emb|CEG84861.1| hypothetical protein RMATCC62417_18612 [Rhizopus microsporus]
Length=353

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 85/173 (49%), Gaps = 33/173 (19%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN-------  565
              +L +LES L+ L T   L+E E+ RR+DM+++L+ + + +    N S  A+       
Sbjct  180  SAKLSTLESGLNSLST--ILSEGELRRRQDMVSSLKDEKDALMQLANTSARADQQLEQQK  237

Query  564  -------RDILLGPEIKPV-DAMSR---------------TNGLDNSGVVALQRQIMKEQ  454
                   R  L   EIKP    M R               T GLDN G+V  Q Q+MKEQ
Sbjct  238  QQPVTQERKALFN-EIKPERKGMGRAFGAAYKKQLQETEVTRGLDNEGLVVYQDQLMKEQ  296

Query  453  DEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRL  295
            D+ +E+    +   K + + +  EL  Q +++D+LD  VD T ++L+   K+L
Sbjct  297  DQQIEQFSSILARQKQLGITIGHELDTQNQILDELDADVDRTQTKLKFANKKL  349



>ref|XP_001762590.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
 gb|EDQ72713.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
Length=241

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 79/156 (51%), Gaps = 12/156 (8%)
 Frame = -2

Query  714  LDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIK  535
            LD   S+  K P +  L   EI RRK   ++ R++ + +   L   +  N      P  +
Sbjct  59   LDKATSVAEKDPARFKLDAVEIKRRKSWTSSTRNQVHSITEKLQSKSLTNAGGADAPTSR  118

Query  534  P----VD-----AMSRTNGLDNSGVVALQRQ--IMKEQDEGLEKLEETVISTKHIALAVN  388
            P    +D     A +R+N  D+       RQ  +++EQDEGL+ L  ++    H+ ++++
Sbjct  119  PGFLRIDDQFQQAPTRSN-YDSHIANESDRQELLLREQDEGLDDLSASLTHVGHVGVSIH  177

Query  387  EELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNK  280
            EEL LQ +L++   E  D T SRL  VQK+LA + K
Sbjct  178  EELSLQGQLMEKFSEDTDGTASRLDVVQKKLATVMK  213



>ref|NP_564310.1| syntaxin-61 [Arabidopsis thaliana]
 ref|XP_002890778.1| hypothetical protein ARALYDRAFT_473066 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q946Y7.1|SYP61_ARATH RecName: Full=Syntaxin-61; Short=AtSYP61; AltName: Full=Osmotic 
stress-sensitive mutant 1 [Arabidopsis thaliana]
 gb|AAK40222.2|AF355754_1 syntaxin of plants 61 [Arabidopsis thaliana]
 gb|AAN12965.1| unknown protein [Arabidopsis thaliana]
 gb|EFH67037.1| hypothetical protein ARALYDRAFT_473066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30982.1| syntaxin-61 [Arabidopsis thaliana]
Length=245

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 101/189 (53%), Gaps = 19/189 (10%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSK---------ANQMASTLNMSN  574
            ++D LE   ++ +K P+   + E E+ +R+   +  R++         A +++S    ++
Sbjct  56   QVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHAS  115

Query  573  FANRDILLGPEIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKH  406
               R+++  P         +  G D+ G V  +  RQ++  K+QDE L++L ++V     
Sbjct  116  EVRRELMRMPNSGEASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGG  175

Query  405  IALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR--TKGGCSCMCMLMSVI  232
            + L +++EL  Q R+ID+LD  +D T +RL+ VQK++ ++ K+   KG    +C L+ V+
Sbjct  176  VGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMMICFLL-VL  234

Query  231  GIVVLIAVI  205
             I++ + V 
Sbjct  235  FIILFVLVF  243



>ref|XP_007841269.1| hypothetical protein PFICI_14497 [Pestalotiopsis fici W106-1]
 gb|ETS73551.1| hypothetical protein PFICI_14497 [Pestalotiopsis fici W106-1]
Length=366

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 79/153 (52%), Gaps = 28/153 (18%)
 Frame = -2

Query  666  LTEKEINRRKDMLATL---RSKANQMASTLN----------MSNFANRDILLGPEIK---  535
            L + EI RRKD+L+     R   +++A+T+           M + A++  LLG   +   
Sbjct  218  LGDGEIRRRKDLLSAAKVDREDLDKLANTIAASAKAGAGKGMPSAADKAALLGHAPRHGG  277

Query  534  -----PVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQ  370
                 P+    RT  LDN GVV LQ+Q+MKEQDE +E L + +   K +AL +N E+  Q
Sbjct  278  RVLGAPLPETERTRELDNQGVVQLQQQMMKEQDEDVESLAKIIRRQKEMALEINREVEEQ  337

Query  369  TRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTK  271
            T ++D+L+   D       R+Q +  I  KR K
Sbjct  338  TSMLDNLNSDAD-------RLQTKADIAKKRIK  363



>gb|ELQ69118.1| v-SNARE [Magnaporthe oryzae P131]
Length=375

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 30/174 (17%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDML--------------ATLRSKANQMASTL  586
            G  L +L+  L++L     L + E+ RR+DM+              ATL   A     T 
Sbjct  205  GRMLSALDDDLARLKKDGGLGKGEVRRREDMVKEAREDHRWLTQLSATLSGGAPTSGGTG  264

Query  585  NMSNFANRDILLG---PEI------KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKL  433
             +++ A+R  L+G   P         P+    RT  LDN+GV+ LQRQ  +EQDE LE L
Sbjct  265  GVASAADRAALVGKGKPRQGGRVLGAPLQETERTRELDNAGVLQLQRQTREEQDEDLEVL  324

Query  432  EETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTK  271
               +   K + LA+ EE+  QT ++D ++E VD       RV  ++ +   RT+
Sbjct  325  TRVIRRQKEMGLAIEEEVKQQTEMLDRMNEDVD-------RVGGKIKVAKDRTR  371



>ref|XP_007510233.1| conserved hypothetical protein [Bathycoccus prasinos]
 emb|CCO18578.1| conserved hypothetical protein [Bathycoccus prasinos]
Length=288

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -2

Query  489  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  310
            ++  Q Q+++EQDE L  L   V  TKHIA+AV EEL L TRL+DD D+ V+ T   L+R
Sbjct  179  LLQFQHQLLREQDEELTDLSNHVTRTKHIAIAVGEELDLHTRLLDDFDDDVEHTAGNLKR  238

Query  309  VQKRLAILNKRT-KGGCSCMCMLMS-VIGIVVLIAV  208
            +      L +R  K   S  C L + V  ++VLIA+
Sbjct  239  IASSARRLFERIGKSNFSLGCCLAALVFMLIVLIAL  274



>ref|NP_001045485.1| Os01g0963300 [Oryza sativa Japonica Group]
 dbj|BAD87234.1| putative syntaxin 6 [Oryza sativa Japonica Group]
 dbj|BAF07399.1| Os01g0963300 [Oryza sativa Japonica Group]
 dbj|BAG90468.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72217.1| hypothetical protein OsI_05319 [Oryza sativa Indica Group]
 gb|EEE56055.1| hypothetical protein OsJ_04863 [Oryza sativa Japonica Group]
Length=234

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 97/188 (52%), Gaps = 25/188 (13%)
 Frame = -2

Query  717  RLDSLESLL---SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLG  547
            ++D LE  +   S+ P    L E E++RR++ + + R   NQ+A+         R +  G
Sbjct  56   QVDELEKTILVASRDPAYYGLDEVELSRRRNWIGSAR---NQVAA-------VRRSVEKG  105

Query  546  PEIKPVDAM-----SRTNGL---DNSGVVALQ--RQI--MKEQDEGLEKLEETVISTKHI  403
                   A      SR+N     DN   +A +  RQ+  M++QDE L++L E+V     +
Sbjct  106  KSNSTFSAHQDMGTSRSNHYTAQDNDDFIASESDRQLLLMRQQDEELDELSESVQRIGGV  165

Query  402  ALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIV  223
             L ++EEL  Q R+++DL   ++ T +RL  VQKR+A++ K+       M +L  V+  +
Sbjct  166  GLTIHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIMLILFLVVLFI  225

Query  222  VLIAVIYM  199
            +L  ++++
Sbjct  226  ILFVLVFL  233



>ref|XP_011273343.1| Vacuolar morphogenesis protein 7 [Wickerhamomyces ciferrii]
 emb|CCH44795.1| Vacuolar morphogenesis protein 7 [Wickerhamomyces ciferrii]
Length=341

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 83/159 (52%), Gaps = 14/159 (9%)
 Frame = -2

Query  717  RLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLN-------------MS  577
            R D L   L  +  K  + E EI RR+++L +++ +   +   L+              S
Sbjct  183  RFDGLSKGLDDVAAKGSIGEGEIQRRRELLHSIKREHGDLEQLLSNVTSNPEALESSKTS  242

Query  576  NFANRDILL-GPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIA  400
               ++++L  G  +       RT G++N  ++ +Q+  +++QD+ LE+L   +   K + 
Sbjct  243  LGKSKNLLFKGRVLGQPQETERTRGIENQQLLQMQKNDIQDQDQELERLSAVINRQKELG  302

Query  399  LAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILN  283
            +A+NEEL LQ  L+D+LD  VD T ++L+  QK++  +N
Sbjct  303  IAINEELALQNELLDELDTEVDRTSAKLKYAQKKVGKIN  341



>gb|EMG46432.1| t-SNARE syntaxin protein, vesicular/late Golgi fusion, putative 
(T-snare protein, putative) [Candida maltosa Xu316]
Length=225

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 84/156 (54%), Gaps = 9/156 (6%)
 Frame = -2

Query  681  PTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGPEIKPVDAMSRTNGL  502
            P+K  L++ +I+ RK +L+ L +K +Q+ +T N   +  RD+         D     N  
Sbjct  64   PSKFNLSDIDISNRKSILSDLNNKISQLGNTWNAKQY--RDVTTMSNRISQDGNEEENPF  121

Query  501  -DNSGVVALQRQ-IMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVT  328
             D++ + + Q+Q +++EQD  L+ +  T+++    A+ + +EL  Q  ++D+LD  +D  
Sbjct  122  GDDAALTSYQQQELIQEQDTQLDDIHRTMMNLNQQAVIMGDELEEQGFMLDELDYELDNV  181

Query  327  DSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVV  220
            D++LQR  KR+ I  +R K   S  C     IGI+ 
Sbjct  182  DNKLQRGMKRINIFLERNKETASNWC-----IGILA  212



>ref|XP_007778861.1| hypothetical protein W97_02772 [Coniosporium apollinis CBS 100218]
 gb|EON63544.1| hypothetical protein W97_02772 [Coniosporium apollinis CBS 100218]
Length=373

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 41/163 (25%)
 Frame = -2

Query  672  QPLTEKEINRRKDMLATLRSKANQMASTLNMSNFAN------------------------  565
            + L + EI RR+DM+ + + + + + S L+  +  N                        
Sbjct  216  EKLGDGEIRRRRDMIGSAKKERDGLESVLSAMSVKNAASTSSSLSGTTAIASEGDKQGLF  275

Query  564  -------RDILLGPEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKH  406
                   R  +LG    P     RT  LDN GV+ LQRQIM+EQDE ++ L + V   + 
Sbjct  276  KGGAPGGRGRVLGA---PAKETERTRELDNEGVLQLQRQIMQEQDEDVQDLTKVVRRMRE  332

Query  405  IALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKR  277
            + +A+NEEL LQ +++D LD  VD       RVQ ++ +  KR
Sbjct  333  MGVAINEELVLQNQMLDLLDNDVD-------RVQGKIDVARKR  368



>ref|XP_010097811.1| hypothetical protein L484_000959 [Morus notabilis]
 gb|EXB72069.1| hypothetical protein L484_000959 [Morus notabilis]
Length=247

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 90/179 (50%), Gaps = 14/179 (8%)
 Frame = -2

Query  723  GTRLDSLESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTLNMSNFANRDILLGP  544
            G  L+      S   T+    +K + R K+   T  + AN M          +R+++  P
Sbjct  78   GIELEKRRRWTSNARTQVSTVKKAVKRGKEANGTGTTSANAM----------HRELMRLP  127

Query  543  EIKPVDAMSRTNGLDNSGVVALQ--RQIM--KEQDEGLEKLEETVISTKHIALAVNEELG  376
             +   D  +  +  DN   +A +  RQ++  K+QDE L++L  +V     + L ++EEL 
Sbjct  128  NLHETDRSNPYSAHDNDDFIASESDRQLLLIKQQDEELDELSASVQRIGGVGLTIHEELL  187

Query  375  LQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIYM  199
             Q ++ID+LD  +D T +RL  VQK+++++ K+       M +L  V+  ++L  ++++
Sbjct  188  AQEKIIDELDMEMDSTSNRLDFVQKKVSMVMKKAGAKGQIMMILFLVVLFIILFVLVFL  246



>ref|XP_006645352.1| PREDICTED: syntaxin-61-like [Oryza brachyantha]
Length=234

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 98/191 (51%), Gaps = 31/191 (16%)
 Frame = -2

Query  717  RLDSLESLL---SKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL--------NMSNF  571
            ++D LE  +   S+ P    L E E++RR++ + + R   NQ+A+          N +  
Sbjct  56   QVDELEKTILVASRDPAYYGLDEVELSRRRNWIGSAR---NQVAAVRRGVEKGKSNSAFS  112

Query  570  ANRDILLGPEIKPVDAMSRTNGL---DNSGVVA----LQRQIMKEQDEGLEKLEETVIST  412
            A++D+            SR+N     DN   +      Q+ +M++QDE L++L E+V   
Sbjct  113  AHQDM----------GTSRSNHYTTQDNDDFITSESDRQQLLMRQQDEELDELSESVQRI  162

Query  411  KHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVI  232
              + L ++EEL  Q R+++DL   ++ T +RL  VQKR+A++ K+       M +L  V+
Sbjct  163  GGVGLTIHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIMLILFLVV  222

Query  231  GIVVLIAVIYM  199
              +VL  ++++
Sbjct  223  LFIVLFVLVFL  233



>gb|AGT16573.1| hypothetical protein SHCRBa_250_M20_R_30 [Saccharum hybrid cultivar 
R570]
Length=231

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 96/186 (52%), Gaps = 25/186 (13%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL--NMSNFANRDIL  553
            ++D LE   S+ S+ P    L E E++RR++   + R +   +   +    SN A     
Sbjct  56   QVDELEKTISVASRDPAYYGLDEVELSRRRNWTGSARKQVGTVKRAIEKGKSNAAT----  111

Query  552  LGPEIKPVDAMSRTNGL---DNSGVVALQ--RQI--MKEQDEGLEKLEETVISTKHIALA  394
                       SRTN     DN   ++ +  RQ+  M++QDE L++L E+V     + L 
Sbjct  112  -----SKYQDTSRTNHYSAQDNDDFISSESDRQLLLMRQQDEELDELSESVQRIGGVGLT  166

Query  393  VNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLI  214
            ++EEL  Q R+++DL   ++ T +RL  VQKR+A++ K  K G     ML++   +VVL 
Sbjct  167  IHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMK--KAGIKGQIMLIAF--LVVLF  222

Query  213  AVIYML  196
             ++++L
Sbjct  223  IILFVL  228



>gb|ELQ35584.1| v-SNARE [Magnaporthe oryzae Y34]
Length=336

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 75/155 (48%), Gaps = 30/155 (19%)
 Frame = -2

Query  666  LTEKEINRRKDML--------------ATLRSKANQMASTLNMSNFANRDILLG---PEI  538
            L + E+ RR+DM+              ATL   A     T  +++ A+R  L+G   P  
Sbjct  185  LGKGEVRRREDMVKEAREDHRWLTQLSATLSGGAPTSGGTGGVASAADRAALVGKGKPRQ  244

Query  537  ------KPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELG  376
                   P+    RT  LDN+GV+ LQRQ  +EQDE LE L   +   K + LA+ EE+ 
Sbjct  245  GGRVLGAPLQETERTRELDNAGVLQLQRQTREEQDEDLEVLTRVIRRQKEMGLAIEEEVK  304

Query  375  LQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTK  271
             QT ++D ++E VD       RV  ++ +   RT+
Sbjct  305  QQTEMLDRMNEDVD-------RVGGKIKVAKDRTR  332



>gb|KIL62800.1| hypothetical protein M378DRAFT_12590 [Amanita muscaria Koide 
BX008]
Length=238

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  489  VVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQTRLIDDLDEHVDVTDSRLQR  310
            ++ +QRQ++ EQDE L++L  ++    HI+L +N+ELG+ T L+++LD  VD+T SRL  
Sbjct  142  ILQVQRQLLGEQDEHLDQLSRSINRQHHISLQINDELGVHTGLLEELDTEVDMTGSRLSS  201

Query  309  VQKRLAILNKRTKGGCSCMCM  247
             ++RL  L K  +   S + +
Sbjct  202  ARRRLDKLAKGARENSSTVTI  222



>emb|CEI88428.1| hypothetical protein RMCBS344292_02818 [Rhizopus microsporus]
Length=222

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 101/175 (58%), Gaps = 14/175 (8%)
 Frame = -2

Query  705  LESLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL-NMSNFANRDILLG------  547
            LE  LS+   +Q  T K+    +D L  L+ K +++ + L N ++ A RD+LLG      
Sbjct  54   LEQQLSE--EEQTDTTKDTKADEDKLIQLQLKVDKLEALLGNQTDPAARDLLLGNNHKKS  111

Query  546  PEIKPVDAMSRTNGLDNSGVVALQRQIMKEQDEGLEKLEETVISTKHIALAVNEELGLQT  367
            P   P+D    T+ ++NS ++ LQ++I+ +QD+ L+ L E +   + + L + +EL    
Sbjct  112  PRFTPID----TSQMENSQILQLQQRIIDDQDQDLDHLSEAIRRQRELGLMIGDELETHA  167

Query  366  RLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLIAVIY  202
             LID+ +E VD TD RL+R +K+L  + ++ K   S +C+++++I I  ++  ++
Sbjct  168  ILIDETEEMVDRTDERLRRAKKKLDYVGRKVKDNKS-ICIVIALILIFFILVALF  221



>ref|NP_001141746.1| uncharacterized protein LOC100273880 [Zea mays]
 gb|ACF86976.1| unknown [Zea mays]
 tpg|DAA55729.1| TPA: hypothetical protein ZEAMMB73_314997 [Zea mays]
Length=232

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 96/186 (52%), Gaps = 25/186 (13%)
 Frame = -2

Query  717  RLDSLE---SLLSKLPTKQPLTEKEINRRKDMLATLRSKANQMASTL--NMSNFANRDIL  553
            ++D LE   S+ S+ P+   L E E++RR++   +   +   +   +    SN A     
Sbjct  56   QVDELEKTISVASRDPSYYGLDEVELSRRRNWTGSAHKQVGTVKRAIEKGKSNVAT----  111

Query  552  LGPEIKPVDAMSRTNGL---DNSGVVALQ--RQI--MKEQDEGLEKLEETVISTKHIALA  394
                       SRTN     DN   ++ +  RQ+  M++QDE L++L E+V     + L 
Sbjct  112  -----SKYQDTSRTNHYSAQDNDDFISSESDRQLLLMRQQDEELDELSESVQRIGGVGLT  166

Query  393  VNEELGLQTRLIDDLDEHVDVTDSRLQRVQKRLAILNKRTKGGCSCMCMLMSVIGIVVLI  214
            ++EEL  Q R+++DL   ++ T +RL  VQKR+A++ K  K G     ML  ++ +VVL 
Sbjct  167  IHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMK--KAGIKGQIML--IVFLVVLF  222

Query  213  AVIYML  196
             ++++L
Sbjct  223  IILFVL  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440