BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015L19

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   3e-26   Citrus sinensis [apfelsine]
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             113   9e-26   Citrus clementina [clementine]
gb|KJB16228.1|  hypothetical protein B456_002G218400                    112   2e-25   Gossypium raimondii
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    111   2e-25   Theobroma cacao [chocolate]
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640          110   6e-25   Amborella trichopoda
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    108   2e-24   Vitis vinifera
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              108   3e-24   Gossypium arboreum [tree cotton]
gb|AFX73409.1|  constans-like protein 5                                 107   5e-24   Gossypium hirsutum [American cotton]
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     107   9e-24   Populus euphratica
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    106   1e-23   Nicotiana tomentosiformis
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    106   2e-23   Nicotiana sylvestris
ref|XP_002311458.2|  zinc finger family protein                         106   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   3e-23   Glycine max [soybeans]
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   3e-23   Nelumbo nucifera [Indian lotus]
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    105   3e-23   Glycine soja [wild soybean]
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   4e-23   Nicotiana tomentosiformis
emb|CDP00619.1|  unnamed protein product                                104   7e-23   Coffea canephora [robusta coffee]
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    104   8e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               104   9e-23   Morus notabilis
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   1e-22   Nicotiana sylvestris
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    101   2e-22   Glycine soja [wild soybean]
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    103   2e-22   
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       102   3e-22   Cucumis sativus [cucumbers]
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   3e-22   
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     102   3e-22   Lagerstroemia indica [crape-myrtle]
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   4e-22   
emb|CDO98435.1|  unnamed protein product                                102   4e-22   Coffea canephora [robusta coffee]
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          102   4e-22   Glycine max [soybeans]
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    102   4e-22   Cucumis melo [Oriental melon]
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   4e-22   Populus euphratica
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    102   5e-22   Solanum lycopersicum
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   6e-22   Solanum tuberosum [potatoes]
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   7e-22   Nicotiana sylvestris
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             101   9e-22   Phaseolus vulgaris [French bean]
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   9e-22   Nicotiana tomentosiformis
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   1e-21   Solanum lycopersicum
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    101   2e-21   Fragaria vesca subsp. vesca
ref|XP_002531628.1|  conserved hypothetical protein                     101   2e-21   Ricinus communis
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         100   3e-21   Jatropha curcas
ref|NP_001239992.1|  uncharacterized protein LOC100802113             99.4    3e-21   
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.4    4e-21   Solanum tuberosum [potatoes]
gb|AEF12203.1|  CONSTANS-like zinc finger protein                     99.8    4e-21   Glycine max [soybeans]
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   Tarenaya hassleriana [spider flower]
gb|AEF12205.1|  CONSTANS-like zinc finger protein                     98.6    1e-20   Glycine max [soybeans]
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.8    2e-20   Elaeis guineensis
gb|AHI45078.1|  COL domain class transcription factor                 97.8    2e-20   Boehmeria nivea [Chinese silk-plant]
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein        94.0    3e-20   
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    3e-20   Cicer arietinum [garbanzo]
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    3e-20   
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    3e-20   Populus euphratica
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  96.3    4e-20   Cucumis sativus [cucumbers]
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    4e-20   Solanum lycopersicum
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6              97.1    4e-20   
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg           95.5    9e-20   Citrus clementina [clementine]
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    1e-19   Cucumis melo [Oriental melon]
gb|KEH44219.1|  zinc finger constans-like protein                     95.5    1e-19   Medicago truncatula
gb|EEE59794.1|  hypothetical protein OsJ_12314                        92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  94.7    2e-19   Vitis vinifera
emb|CAN73757.1|  hypothetical protein VITISV_026326                   95.5    2e-19   Vitis vinifera
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.4    4e-19   Solanum tuberosum [potatoes]
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  94.0    4e-19   Phoenix dactylifera
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.4    4e-19   Pyrus x bretschneideri [bai li]
gb|AGM20692.1|  COL6-2                                                94.4    4e-19   Populus tomentosa [Chinese white poplar]
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg           94.0    5e-19   
emb|CDY07383.1|  BnaA07g24620D                                        92.0    5e-19   Brassica napus [oilseed rape]
emb|CDY04230.1|  BnaC06g25850D                                        92.0    5e-19   
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g           93.2    6e-19   Phaseolus vulgaris [French bean]
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg           93.6    7e-19   Prunus persica
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    7e-19   Citrus sinensis [apfelsine]
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g           93.2    9e-19   
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    1e-18   
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    1e-18   
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHI45077.1|  COL domain class transcription factor                 93.2    1e-18   Boehmeria nivea [Chinese silk-plant]
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    1e-18   Cicer arietinum [garbanzo]
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.8    1e-18   Prunus mume [ume]
gb|ADK63396.1|  B-box type zinc finger protein                        90.9    2e-18   Brassica rapa
ref|NP_001051053.1|  Os03g0711100                                     92.4    2e-18   
gb|ABF98510.1|  CCT motif family protein, expressed                   91.3    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                   91.7    2e-18   Lagerstroemia indica [crape-myrtle]
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    2e-18   Fragaria vesca subsp. vesca
emb|CDX77359.1|  BnaC08g04040D                                        89.0    2e-18   
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    2e-18   
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  92.4    2e-18   
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g           90.9    3e-18   Phaseolus vulgaris [French bean]
gb|EPS73837.1|  hypothetical protein M569_00919                       91.3    3e-18   Genlisea aurea
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.7    4e-18   Pyrus x bretschneideri [bai li]
gb|AFK49208.1|  unknown                                               89.0    4e-18   Medicago truncatula
gb|ACX42573.1|  CONSTANS-like zinc finger protein                     90.5    4e-18   Glycine max [soybeans]
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   90.9    5e-18   Brassica rapa
emb|CDY44890.1|  BnaA02g13920D                                        90.9    5e-18   Brassica napus [oilseed rape]
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    5e-18   
gb|KDP20116.1|  hypothetical protein JCGZ_05885                       91.3    5e-18   Jatropha curcas
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.3    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    5e-18   Camelina sativa [gold-of-pleasure]
emb|CDX81527.1|  BnaC02g18310D                                        90.9    5e-18   
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                  90.9    5e-18   Arabis alpina [alpine rockcress]
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg           90.5    6e-18   Eutrema salsugineum [saltwater cress]
ref|XP_002888669.1|  zinc finger (B-box type) family protein          90.5    6e-18   Arabidopsis lyrata subsp. lyrata
emb|CDY03851.1|  BnaC07g10760D                                        90.1    6e-18   
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    6e-18   
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...  90.5    7e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51133.1|  BnaA07g37160D                                        90.1    7e-18   Brassica napus [oilseed rape]
gb|AEF12200.1|  CONSTANS-like zinc finger protein                     90.1    7e-18   Glycine max [soybeans]
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                 90.5    7e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37106.1|  unknown                                               90.5    7e-18   Medicago truncatula
emb|CDY53119.1|  BnaCnng24470D                                        90.1    7e-18   Brassica napus [oilseed rape]
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg           90.5    7e-18   Capsella rubella
gb|ACL53155.1|  unknown                                               87.4    7e-18   Zea mays [maize]
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    9e-18   
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                90.1    9e-18   Medicago truncatula
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   90.9    9e-18   
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    9e-18   Populus euphratica
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    1e-17   Brassica rapa
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    1e-17   
gb|KJB23747.1|  hypothetical protein B456_004G113000                  90.1    1e-17   Gossypium raimondii
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF84125.1|  unknown                                               88.2    1e-17   Zea mays [maize]
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   90.1    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg           90.1    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    1e-17   Prunus mume [ume]
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g           89.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_002533412.1|  transcription factor, putative                   89.7    2e-17   Ricinus communis
gb|AAM61001.1|  putative B-box zinc finger protein                    89.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                  87.4    3e-17   Triticum urartu
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.8    3e-17   
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.4    3e-17   Eucalyptus grandis [rose gum]
gb|AGI62036.1|  CONSTANS-like 12                                      87.8    4e-17   Erycina pusilla
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg              89.0    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   88.6    4e-17   Malus domestica [apple tree]
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                 88.2    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EMT27110.1|  hypothetical protein F775_43077                       87.4    5e-17   
gb|EPS70097.1|  hypothetical protein M569_04667                       82.8    5e-17   Genlisea aurea
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg              87.8    6e-17   Erythranthe guttata [common monkey flower]
gb|EEC73943.1|  hypothetical protein OsI_08813                        86.7    8e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001048022.1|  Os02g0731700                                     86.7    8e-17   
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   85.9    8e-17   Triticum urartu
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                  87.8    9e-17   
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.8    9e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                87.4    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   87.0    9e-17   Sesamum indicum [beniseed]
gb|AAG50803.1|AC079281_5  zinc finger protein, putative               87.4    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13173.1|  unknown protein                                       87.4    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    9e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16             87.8    9e-17   Zea mays [maize]
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|NP_001140584.1|  uncharacterized protein LOC100272654             87.4    1e-16   Zea mays [maize]
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480        87.8    1e-16   Sorghum bicolor [broomcorn]
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
dbj|BAK01505.1|  predicted protein                                    87.4    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY67920.1|  BnaAnng25560D                                        86.3    1e-16   Brassica napus [oilseed rape]
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    1e-16   Camelina sativa [gold-of-pleasure]
emb|CDY65591.1|  BnaC05g50730D                                        85.9    2e-16   Brassica napus [oilseed rape]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420        86.7    2e-16   Sorghum bicolor [broomcorn]
gb|AFX97569.1|  K                                                     84.0    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFX97570.1|  K                                                     84.0    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_007036519.1|  Transcription factor, putative                   86.3    2e-16   
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    2e-16   
gb|KGN63817.1|  hypothetical protein Csa_1G023050                     85.5    3e-16   Cucumis sativus [cucumbers]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.3    3e-16   Brassica rapa
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   83.2    3e-16   Triticum urartu
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg           85.9    3e-16   Capsella rubella
gb|EAZ36554.1|  hypothetical protein OsJ_20892                        86.3    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.9    4e-16   Setaria italica
dbj|BAD15937.1|  zinc finger protein-like                             85.9    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829           85.9    4e-16   
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein            85.5    4e-16   Gossypium arboreum [tree cotton]
ref|NP_001057333.2|  Os06g0264200                                     86.3    4e-16   
gb|KJB34354.1|  hypothetical protein B456_006G061600                  85.1    5e-16   Gossypium raimondii
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    5e-16   Setaria italica
gb|KJB34352.1|  hypothetical protein B456_006G061600                  85.5    5e-16   Gossypium raimondii
gb|EMT01944.1|  hypothetical protein F775_21198                       84.3    5e-16   
gb|EAZ00428.1|  hypothetical protein OsI_22452                        85.5    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16             85.5    6e-16   Morus notabilis
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  85.1    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_002887511.1|  zinc finger (B-box type) family protein          84.7    7e-16   
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    7e-16   Oryza brachyantha
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   84.3    9e-16   Camelina sativa [gold-of-pleasure]
gb|AGI62031.1|  CONSTANS-like 7                                       83.6    9e-16   Erycina pusilla
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    1e-15   Elaeis guineensis
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg           83.6    2e-15   Capsella rubella
ref|XP_001752335.1|  predicted protein                                78.2    2e-15   
dbj|BAJ87752.1|  predicted protein                                    84.0    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  82.8    3e-15   Cucumis melo [Oriental melon]
ref|XP_001769011.1|  predicted protein                                84.0    3e-15   
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    3e-15   
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    3e-15   
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  82.4    3e-15   Phoenix dactylifera
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    4e-15   
dbj|BAK04456.1|  predicted protein                                    82.8    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.2    4e-15   
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000           83.2    4e-15   Selaginella moellendorffii
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834           82.8    5e-15   Selaginella moellendorffii
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                76.6    6e-15   
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920        82.8    6e-15   
ref|NP_001149548.1|  CCT motif family protein                         82.0    7e-15   Zea mays [maize]
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.0    1e-14   Zea mays [maize]
ref|XP_001771896.1|  predicted protein                                81.6    1e-14   
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    1e-14   
ref|XP_001769056.1|  predicted protein                                75.9    2e-14   
emb|CDY24402.1|  BnaCnng04690D                                        80.5    2e-14   Brassica napus [oilseed rape]
emb|CBI15893.3|  unnamed protein product                              75.9    3e-14   Vitis vinifera
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg              80.1    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_001754240.1|  predicted protein                                74.3    5e-14   
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           74.3    7e-14   
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            73.9    8e-14   
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   76.6    1e-13   Populus euphratica
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           76.3    2e-13   Selaginella moellendorffii
gb|KDP45740.1|  hypothetical protein JCGZ_17347                       75.9    2e-13   Jatropha curcas
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  77.8    2e-13   
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  75.5    3e-13   
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   75.1    4e-13   Vitis vinifera
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 76.3    4e-13   Citrus sinensis [apfelsine]
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.0    4e-13   
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           76.3    4e-13   Citrus clementina [clementine]
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  75.1    4e-13   Phoenix dactylifera
ref|XP_007016977.1|  CCT motif family protein isoform 2               74.7    5e-13   
ref|XP_004294775.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   74.7    5e-13   Fragaria vesca subsp. vesca
ref|XP_002298500.1|  CONSTANS-like family protein                     74.3    6e-13   
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.3    6e-13   Elaeis guineensis
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   75.9    7e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  74.3    7e-13   Populus euphratica
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   73.9    8e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  76.3    8e-13   
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           75.1    1e-12   Phaseolus vulgaris [French bean]
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           73.9    1e-12   Prunus persica
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    1e-12   Malus domestica [apple tree]
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       74.7    1e-12   Jatropha curcas
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.2    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           73.2    2e-12   Citrus clementina [clementine]
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.2    2e-12   Citrus sinensis [apfelsine]
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  72.8    2e-12   Arabis alpina [alpine rockcress]
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  73.9    2e-12   Vitis vinifera
emb|CBI17712.3|  unnamed protein product                              73.9    2e-12   Vitis vinifera
gb|ABF00989.1|  putative stress resistance-related protein            75.1    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  72.8    2e-12   Elaeis guineensis
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  73.9    2e-12   
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          73.9    3e-12   
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   73.6    3e-12   Cucumis melo [Oriental melon]
ref|XP_007031686.1|  CCT motif family protein, putative               73.9    3e-12   
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  73.6    3e-12   Populus euphratica
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.7    3e-12   Oryza brachyantha
emb|CDP09243.1|  unnamed protein product                              71.2    3e-12   Coffea canephora [robusta coffee]
gb|KJB56256.1|  hypothetical protein B456_009G113000                  72.4    3e-12   Gossypium raimondii
dbj|BAJ92256.1|  predicted protein                                    74.7    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           72.0    3e-12   Eutrema salsugineum [saltwater cress]
ref|NP_568852.2|  chloroplast import apparatus 2 protein              74.3    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        74.7    3e-12   Sorghum bicolor [broomcorn]
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  73.2    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_563778.1|  CCT motif family protein                            72.0    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892377.1|  predicted protein                                72.0    3e-12   
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.2    3e-12   
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   72.0    4e-12   Tarenaya hassleriana [spider flower]
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.6    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.6    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  72.0    4e-12   
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   72.0    4e-12   Prunus mume [ume]
emb|CAN75558.1|  hypothetical protein VITISV_028190                   72.8    4e-12   Vitis vinifera
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  73.2    5e-12   Glycine max [soybeans]
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.8    5e-12   Sesamum indicum [beniseed]
ref|XP_001765504.1|  predicted protein                                73.9    5e-12   
emb|CDY52734.1|  BnaC09g53340D                                        73.6    6e-12   Brassica napus [oilseed rape]
gb|KJB33888.1|  hypothetical protein B456_006G036400                  72.8    6e-12   Gossypium raimondii
gb|KJB33887.1|  hypothetical protein B456_006G036400                  72.8    6e-12   Gossypium raimondii
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           73.6    6e-12   Eutrema salsugineum [saltwater cress]
emb|CDP16632.1|  unnamed protein product                              73.2    6e-12   
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  73.6    7e-12   
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.4    7e-12   
emb|CDY66177.1|  BnaC08g46470D                                        70.9    7e-12   
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           71.2    7e-12   
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  70.9    7e-12   
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  71.6    7e-12   
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             72.8    7e-12   
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        70.9    8e-12   
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.2    8e-12   
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  72.4    9e-12   
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.2    9e-12   
emb|CDY47926.1|  BnaA02g08300D                                        72.8    9e-12   
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  73.2    9e-12   
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.0    9e-12   
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.2    9e-12   
emb|CDX91067.1|  BnaC02g05300D                                        72.0    1e-11   
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   70.9    1e-11   
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           73.2    1e-11   
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.8    1e-11   
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.8    1e-11   
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                70.9    1e-11   
emb|CDX85600.1|  BnaA02g02130D                                        72.0    1e-11   
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  72.0    1e-11   
emb|CDY06672.1|  BnaA10g04510D                                        70.5    1e-11   
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           72.8    1e-11   
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.5    1e-11   
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  70.9    1e-11   
emb|CDY38274.1|  BnaA10g11220D                                        72.8    1e-11   
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  72.0    1e-11   
emb|CDY42238.1|  BnaC02g11770D                                        72.4    1e-11   
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  71.6    1e-11   
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.5    1e-11   
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.8    1e-11   
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.8    1e-11   
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  71.6    1e-11   
emb|CDY10244.1|  BnaC05g04870D                                        70.1    2e-11   
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.4    2e-11   
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        72.4    2e-11   
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  70.1    2e-11   
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    2e-11   
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           71.6    2e-11   
ref|NP_001169082.1|  uncharacterized protein LOC100382924             72.4    2e-11   
emb|CDX70561.1|  BnaC03g06450D                                        69.3    2e-11   
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               72.4    2e-11   
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  71.6    2e-11   
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           71.2    2e-11   
ref|NP_001147813.1|  LOC100281423                                     72.4    2e-11   
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              71.6    2e-11   
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  71.2    2e-11   
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           71.2    2e-11   
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  71.2    2e-11   
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  70.9    3e-11   
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    3e-11   
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   70.9    3e-11   
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           70.9    3e-11   
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           71.6    3e-11   
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  71.2    3e-11   
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    3e-11   
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           71.6    3e-11   
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    3e-11   
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.2    3e-11   
gb|AAF69700.1|AC016041_5  F27J15.10                                   70.5    3e-11   
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   70.9    4e-11   
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   70.9    4e-11   
ref|XP_001776067.1|  predicted protein                                66.2    4e-11   
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    4e-11   
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   70.9    4e-11   
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 70.5    4e-11   
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              70.5    4e-11   
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           71.2    4e-11   
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    4e-11   
emb|CDX78575.1|  BnaA03g04870D                                        70.1    4e-11   
emb|CDY09849.1|  BnaC09g43120D                                        70.5    5e-11   
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           70.9    5e-11   
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    5e-11   
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           70.1    5e-11   
ref|XP_001769217.1|  predicted protein                                71.2    5e-11   
emb|CDX69586.1|  BnaA10g19350D                                        70.1    5e-11   
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       70.9    5e-11   
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           70.9    5e-11   
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    5e-11   
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  70.1    5e-11   
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    6e-11   
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    6e-11   
gb|AAM63153.1|  unknown                                               69.7    6e-11   
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           70.1    6e-11   
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  70.5    6e-11   
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.6    6e-11   
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.5    7e-11   
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                70.1    7e-11   
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.7    7e-11   
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           70.5    7e-11   
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.5    7e-11   
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.2    7e-11   
ref|NP_567737.1|  CIA2-like transcription factor                      70.1    7e-11   
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.5    7e-11   
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    7e-11   
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  69.3    7e-11   
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.7    8e-11   
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    8e-11   
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.7    8e-11   
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    9e-11   
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    9e-11   
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    9e-11   
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           70.5    9e-11   
ref|NP_568300.1|  CCT motif family protein                            69.7    9e-11   
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           69.3    9e-11   
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   69.7    1e-10   
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.1    1e-10   
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  69.7    1e-10   
emb|CAN72725.1|  hypothetical protein VITISV_015092                   69.7    1e-10   
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           69.3    1e-10   
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  69.7    1e-10   
emb|CBI40095.3|  unnamed protein product                              69.7    1e-10   
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  69.7    1e-10   
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  69.3    1e-10   
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     69.3    2e-10   
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  69.3    2e-10   
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              68.9    2e-10   
emb|CDP15779.1|  unnamed protein product                              69.3    2e-10   
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  67.8    2e-10   
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           68.9    2e-10   
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.2    2e-10   
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.9    2e-10   
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.6    3e-10   
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.9    3e-10   
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.6    3e-10   
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  68.2    4e-10   
ref|XP_007016976.1|  CCT motif family protein isoform 1               66.2    6e-10   
dbj|BAK01784.1|  predicted protein                                    66.6    8e-10   
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           65.1    1e-09   
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.7    1e-09   
emb|CDX94392.1|  BnaC01g17920D                                        66.6    1e-09   
emb|CDX89377.1|  BnaA01g15160D                                        66.2    2e-09   
dbj|BAJ85986.1|  predicted protein                                    65.1    2e-09   
ref|XP_001751672.1|  predicted protein                                66.2    2e-09   
gb|EMT29986.1|  hypothetical protein F775_13638                       65.1    2e-09   
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           65.5    3e-09   
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  65.5    3e-09   
ref|XP_001759088.1|  predicted protein                                65.9    3e-09   
ref|XP_011467357.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  65.5    3e-09   
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  65.5    3e-09   
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                62.8    4e-09   
gb|AFK31575.1|  Hd1                                                   65.1    4e-09   
ref|NP_001046074.2|  Os02g0178100                                     62.8    4e-09   
ref|XP_003560384.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.7    5e-09   
gb|ABG57263.1|  CONSTANS-like 1                                       64.3    5e-09   
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           63.5    5e-09   
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  64.7    5e-09   
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.3    7e-09   
gb|AFW86339.1|  constans1                                             60.8    7e-09   
gb|ACF81408.1|  unknown                                               61.2    8e-09   
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                62.8    8e-09   
gb|ACF79190.1|  unknown                                               60.8    8e-09   
ref|NP_851201.1|  chloroplast import apparatus 2 protein              64.3    8e-09   
gb|KJB53720.1|  hypothetical protein B456_009G002400                  63.9    9e-09   
gb|EEC84137.1|  hypothetical protein OsI_30489                        60.8    9e-09   
dbj|BAD36814.1|  zinc finger protein-like                             60.8    9e-09   
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                63.2    9e-09   
dbj|BAC92732.1|  Hd1-like protein                                     63.9    9e-09   
ref|NP_001140225.1|  uncharacterized protein LOC100272264             61.6    1e-08   
gb|EPS64862.1|  hypothetical protein M569_09916                       60.1    1e-08   
gb|AAX47173.1|  CONSTANS-LIKE b                                       63.2    1e-08   
gb|AAX20015.1|  CONSTANS-like b                                       63.2    1e-08   
gb|AIP90420.1|  HD1                                                   63.9    1e-08   
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          63.9    1e-08   
ref|XP_009418181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  63.5    1e-08   
dbj|BAI59731.1|  Heading date1                                        63.2    1e-08   
gb|AFK31608.1|  Hd1                                                   63.5    1e-08   
gb|AIP90442.1|  HD1                                                   63.5    1e-08   
gb|ADO61312.1|  CONSTANS-like 1                                       60.5    1e-08   
gb|AFK31561.1|  Hd1                                                   63.5    1e-08   
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   63.2    1e-08   
gb|AFK31537.1|  Hd1                                                   63.5    2e-08   
gb|AIP90432.1|  HD1                                                   63.5    2e-08   
gb|AEP02829.1|  heading day 1                                         63.5    2e-08   
gb|AFK31604.1|  Hd1                                                   63.5    2e-08   
dbj|BAJ53893.1|  Hd1 protein                                          63.2    2e-08   
gb|AIP90462.1|  HD1                                                   63.5    2e-08   
gb|AIP90439.1|  HD1                                                   63.5    2e-08   
gb|AIP90423.1|  HD1                                                   63.5    2e-08   
gb|AFK31624.1|  Hd1                                                   63.5    2e-08   
gb|AEP02828.1|  heading day 1                                         63.5    2e-08   
gb|AIP90429.1|  HD1                                                   63.5    2e-08   
gb|AIP90424.1|  HD1                                                   63.5    2e-08   
gb|AFK31610.1|  Hd1                                                   63.5    2e-08   
gb|AIP90449.1|  HD1                                                   63.2    2e-08   
gb|AEP02821.1|  heading day 1                                         63.5    2e-08   
gb|AIP90438.1|  HD1                                                   63.2    2e-08   
ref|XP_001758440.1|  predicted protein                                63.5    2e-08   
gb|AIP90425.1|  HD1                                                   63.2    2e-08   
gb|AFK31625.1|  Hd1                                                   63.2    2e-08   
gb|AEP02840.1|  heading day 1                                         63.2    2e-08   
gb|AEP02834.1|  heading day 1                                         63.2    2e-08   
gb|AEP02825.1|  heading day 1                                         63.2    2e-08   
gb|AEP02816.1|  heading day 1                                         63.2    2e-08   
gb|AEP02807.1|  heading day 1                                         63.2    2e-08   
gb|AEP02823.1|  heading day 1                                         63.2    2e-08   
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 63.2    2e-08   
gb|AEP02848.1|  heading day 1                                         63.2    2e-08   
gb|AEP02853.1|  heading day 1                                         63.2    2e-08   
gb|AIP90443.1|  HD1                                                   63.2    2e-08   
gb|AEP02811.1|  heading day 1                                         63.2    2e-08   
gb|AEP02841.1|  heading day 1                                         63.2    2e-08   
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              63.2    2e-08   
gb|AEP02820.1|  heading day 1                                         63.2    2e-08   
gb|EEE65515.1|  hypothetical protein OsJ_20956                        63.2    2e-08   
gb|ADO61318.1|  CONSTANS-like 1                                       60.5    2e-08   
gb|AFK31579.1|  Hd1                                                   63.2    2e-08   
gb|AFK31607.1|  Hd1                                                   63.2    2e-08   
gb|ADO61340.1|  CONSTANS-like 1                                       60.5    2e-08   
dbj|BAI59737.1|  Heading date1                                        63.2    2e-08   
gb|AFK31568.1|  Hd1                                                   63.2    2e-08   
dbj|BAJ08368.1|  Hd1                                                  63.5    2e-08   
ref|NP_001057378.1|  Os06g0275000                                     63.2    2e-08   
gb|AFK31566.1|  Hd1                                                   63.2    2e-08   
gb|ADO61300.1|  CONSTANS-like 1                                       60.5    2e-08   
gb|AEP02822.1|  heading day 1                                         63.2    2e-08   
gb|ADO61294.1|  CONSTANS-like 1                                       60.5    2e-08   
gb|AIP90436.1|  HD1                                                   63.2    2e-08   



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 68/96 (71%), Gaps = 9/96 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMG-----GDhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFS  470
            FDP+ CWPD MG     G  +  HPYG    +       D GREARVSRYREKRRTRLFS
Sbjct  360  FDPDECWPDCMGTCGTEGHKYLQHPYGDFSGIGAHPATVDGGREARVSRYREKRRTRLFS  419

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            KKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP
Sbjct  420  KKIRYEVRKLNAEKRPRMKGRFVKRASFAGGPPAFP  455



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 67/96 (70%), Gaps = 9/96 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMG-----GDhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFS  470
            FDP  CWPD MG     G  +  HPYG    +       D GREARVSRYREKRRTRLFS
Sbjct  360  FDPEECWPDCMGTCGTEGHKYLQHPYGDFSGIGAHPATVDGGREARVSRYREKRRTRLFS  419

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            KKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP
Sbjct  420  KKIRYEVRKLNAEKRPRMKGRFVKRASFAGGPPAFP  455



>gb|KJB16228.1| hypothetical protein B456_002G218400 [Gossypium raimondii]
Length=421

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGXAMMM-----RRSDEGREARVSRYREKRRTRLFSKKI  461
             DP+ CWPD MG G       Y   M M        D GREARVSRYREKRRTRLFSKKI
Sbjct  326  LDPDECWPDCMGNGGTEVQQSYSGLMGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKI  385

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RYEVRKLNAEKRPR+KGRFVKR+S F   P FP  LLN+
Sbjct  386  RYEVRKLNAEKRPRMKGRFVKRAS-FLTGPAFP--LLNK  421



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPY----GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
            FDP+ CWPD MG G    HH Y    G        D GREARVSRYREKRRTRLFSKKIR
Sbjct  346  FDPDECWPDCMGTGGTEVHHTYSDLIGMGAHQALGDGGREARVSRYREKRRTRLFSKKIR  405

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPP-PFPN  359
            YEVRKLNAEKRPR+KGRFVKR+S    P  PF N
Sbjct  406  YEVRKLNAEKRPRMKGRFVKRASFLAGPAFPFVN  439



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = -1

Query  622  FDPNHCWPD-FMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
            F+P+ CWPD F G        Y        SD GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  304  FNPDDCWPDPFTGNCVPEMSTYSEVGNATASDGGREARVSRYREKRRTRLFSKKIRYEVR  363

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            KLNAEKRPR+KGRFVKR+S   PP P+P
Sbjct  364  KLNAEKRPRMKGRFVKRTSF--PPTPYP  389



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGXAMMMRR-----SDEGREARVSRYREKRRTRLFSKKI  461
             DP+ CWPD +G      HHPYG    M        D GREARVSRYREKRRTRLFSKKI
Sbjct  337  LDPDDCWPDCLGTCGIQVHHPYGEFGGMGEQQAAMGDGGREARVSRYREKRRTRLFSKKI  396

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RYEVRKLNAEKRPR+KGRFVKR+S F  P  FP  LLN+
Sbjct  397  RYEVRKLNAEKRPRMKGRFVKRAS-FGGPAAFP--LLNK  432



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -1

Query  622  FDPNHCWPDFM--GGDhhhhHPYGXAMMMRR----SDEGREARVSRYREKRRTRLFSKKI  461
             DP+ CWPD M  GG        G   M  +     D GREARVSRYREKRRTRLFSKKI
Sbjct  322  LDPDECWPDCMRNGGTEVQQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKI  381

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RYEVRKLNAEKRPR+KGRFVKR+S F   P FP  LLN+
Sbjct  382  RYEVRKLNAEKRPRMKGRFVKRAS-FLAGPAFP--LLNK  417



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = -1

Query  622  FDPNHCWPDFM--GGDhhhhHPYGXAMMMRR----SDEGREARVSRYREKRRTRLFSKKI  461
             DP+ CWPD M  GG        G   M  +     D GREARVSRYREKRRTRLFSKKI
Sbjct  328  LDPDECWPDCMRNGGTEVQQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKI  387

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RYEVRKLNAEKRPR+KGRFVKR+S F   P FP  LLN+
Sbjct  388  RYEVRKLNAEKRPRMKGRFVKRAS-FLAGPAFP--LLNK  423



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 66/89 (74%), Gaps = 14/89 (16%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGX---------AMMMRRSDEGREARVSRYREKRRTRLF  473
            FDP+ CWPD MG      HHPYG          AMM    D GREARVSRYREKRRTRLF
Sbjct  353  FDPDECWPDCMGICGAQLHHPYGDMISGLGAHPAMM----DGGREARVSRYREKRRTRLF  408

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            SKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  409  SKKIRYEVRKLNAEKRPRMKGRFVKRTTL  437



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 65/92 (71%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAM-MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
             D N CWPD MG +    HPYG         D GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  360  LDSNDCWPDCMG-NCGTIHPYGIMNGHTTMIDRGREARVSRYREKRRTRLFSKKIRYEVR  418

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
            KLNAEKRPR+KGRFVKRS+L       PNY L
Sbjct  419  KLNAEKRPRMKGRFVKRSNL------VPNYPL  444



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 68/94 (72%), Gaps = 12/94 (13%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS---DEGREARVSRYREKRRTRLFSKKIRYE  452
             D N CWPD MG +    HPYG  +M   +   D GREARVSRYREKRRTRLFSKKIRYE
Sbjct  361  LDSNDCWPDCMG-NCGTIHPYG--IMNGHTTIIDRGREARVSRYREKRRTRLFSKKIRYE  417

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
            VRKLNAEKRPR+KGRFVKRS+L       PNY L
Sbjct  418  VRKLNAEKRPRMKGRFVKRSNL------VPNYPL  445



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 65/85 (76%), Gaps = 6/85 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGXAMMMRRS-----DEGREARVSRYREKRRTRLFSKKI  461
            FDP+ CWPD MG      HHPYG  +    +     D GREARVSRYREKRRTRLFSKKI
Sbjct  357  FDPDECWPDCMGICGAQLHHPYGDMISGLGAHPAMVDGGREARVSRYREKRRTRLFSKKI  416

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSL  386
            RYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  417  RYEVRKLNAEKRPRMKGRFVKRTTL  441



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 68/98 (69%), Gaps = 9/98 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
             DP+ CW   MG      HHPYG      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  325  LDPDECWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIR  384

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  385  YEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  418



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 8/90 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG----DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSK  467
            F+P+ CWPD MG     + HH+HPYG        +   D GREARVSRYREKRRTRLFSK
Sbjct  345  FNPDDCWPDCMGTCPMTEVHHYHPYGEMGGVGGHVTAGDGGREARVSRYREKRRTRLFSK  404

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
            KIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  405  KIRYEVRKLNAEKRPRMKGRFVKRASCTGP  434



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 68/98 (69%), Gaps = 9/98 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
             DP+ CW   MG      HHPYG      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  324  LDPDECWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIR  383

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  384  YEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  417



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMG---GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYE  452
            F+P+ CWPDF+    G+   H PYG   +      GRE RVSRYREKRRTRLFSKKIRY+
Sbjct  327  FNPDDCWPDFLETCIGEGGVHQPYGGGKVRGGD-GGREERVSRYREKRRTRLFSKKIRYQ  385

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            VRKLNAEKRPRLKGRFVKR++ F  PP FP YL+N+
Sbjct  386  VRKLNAEKRPRLKGRFVKRTTSFS-PPGFP-YLMNK  419



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRR---SDEGREARVSRYREKRRTRLFSKKIRYE  452
             D N CWPD +G     H+ YG   M       D GREARVSRYREKRRTRLF KKIRYE
Sbjct  353  LDSNDCWPDCLGTCGTIHNLYGEVGMFGHPAMMDGGREARVSRYREKRRTRLFCKKIRYE  412

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            VRKLNAEKRPR+KGRFVKR++       FP
Sbjct  413  VRKLNAEKRPRMKGRFVKRATFSAAAAAFP  442



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 70/95 (74%), Gaps = 8/95 (8%)
 Frame = -1

Query  622  FDPNH-CWPDFMGG---DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSK  467
            F+P+  CWPD MG    + +HHHPYG        +   + GREARVSRYREKRRTRLFSK
Sbjct  356  FNPDDDCWPDCMGTYPMEVYHHHPYGEMGGVGGHVTMGNGGREARVSRYREKRRTRLFSK  415

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            KIRYEVRKLNAEKRPR+KGRFVKR+SL     PFP
Sbjct  416  KIRYEVRKLNAEKRPRMKGRFVKRTSLMGVAAPFP  450



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 67/101 (66%), Gaps = 10/101 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMR--------RSDEGREARVSRYREKRRTRLFSK  467
            FDP+ CWPD MG  +     +   M +          +D GREARVSRYREKRRTRLFSK
Sbjct  366  FDPDACWPDCMGTYYPTQLHHHQYMDLSGVELNPAILADGGREARVSRYREKRRTRLFSK  425

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            KIRYEVRKLNAEKRPR+KGRFV R+S     P FP  L+ +
Sbjct  426  KIRYEVRKLNAEKRPRMKGRFVNRASF--AGPTFPAMLITK  464



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 72/99 (73%), Gaps = 13/99 (13%)
 Frame = -1

Query  622  FDPNHCWPDFM------GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKI  461
            F+P+ CWPDF+      GG    H PYG   +      GREARVSRYREKRRTRLFSKKI
Sbjct  325  FNPDDCWPDFLETCIGEGG----HQPYGGGNVRGGD-GGREARVSRYREKRRTRLFSKKI  379

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RYEVRKLNAEKRPRLKGRFVKR++ F   P FP YL+N+
Sbjct  380  RYEVRKLNAEKRPRLKGRFVKRTTSFS-APGFP-YLMNK  416



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 69/98 (70%), Gaps = 9/98 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
             DP+ CW   MG  +  +HHP G      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  149  LDPDECWKQCMGSCETAYHHPCGEMGGFGIHPVIIDGGREARVSRYREKRRTRLFSKKIR  208

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  209  YEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  242



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 70/99 (71%), Gaps = 8/99 (8%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGXAMMMRRS----DEGREARVSRYREKRRTRLFSKKIR  458
            F P++CWPDFMG       + YG A +        D GREA+VSRYREKRRTRLFSKKIR
Sbjct  367  FSPDNCWPDFMGMSGLEFQNLYGEAGVHGGHVGMGDAGREAKVSRYREKRRTRLFSKKIR  426

Query  457  YEVRKLNAEKRPRLKGRFVKR-SSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR SS     P FP  LLN+
Sbjct  427  YEVRKLNAEKRPRMKGRFVKRASSASSSAPAFP--LLNK  463



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 61/87 (70%), Gaps = 6/87 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIR  458
             D   CWPD MG      H YG   MM        D GREARVSRYREKRRTRLFSKKIR
Sbjct  347  LDSAGCWPDCMG-TCGTVHVYGEMGMMIGHAVAVGDGGREARVSRYREKRRTRLFSKKIR  405

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQP  377
            YEVRKLNAEKRPR+KGRFVKR++L  P
Sbjct  406  YEVRKLNAEKRPRMKGRFVKRANLVAP  432



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG--DhhhhHPYGX--AMMMRRSDEG----REARVSRYREKRRTRLFSK  467
             D ++ WPD+MG      ++ PYG   + + R++  G    REARVSRYREKRRTRLF+K
Sbjct  306  LDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAK  365

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
            KIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  366  KIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  397



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG--DhhhhHPYGX--AMMMRRSDEG----REARVSRYREKRRTRLFSK  467
             D ++ WPD+MG      ++ PYG   + + R++  G    REARVSRYREKRRTRLF+K
Sbjct  306  LDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAK  365

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
            KIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  366  KIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  397



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            F+   CWPD +         YG   M+     GREARV RYREKRRTRLFSKKIRYEVRK
Sbjct  298  FNSADCWPDSLVSASGAMQAYGGMAMVSGDARGREARVMRYREKRRTRLFSKKIRYEVRK  357

Query  442  LNAEKRPRLKGRFVKRSSLFQP  377
            LNAEKRPR+KGRFVKR+ L  P
Sbjct  358  LNAEKRPRMKGRFVKRACLVAP  379



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG--DhhhhHPYGX--AMMMRRSDEG----REARVSRYREKRRTRLFSK  467
             D ++ WPD+MG      ++ PYG   + + R++  G    REARVSRYREKRRTRLF+K
Sbjct  278  LDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAK  337

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
            KIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  338  KIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  369



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEV  449
            F+   CWPDFMG   +  H    A   R S  DE REARV+RYREKRRTRLFSKKIRYEV
Sbjct  340  FNLGDCWPDFMGMSLNELHHPNGAGGGRVSSHDEEREARVTRYREKRRTRLFSKKIRYEV  399

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            RKLNAEKRPR+KGRFVKR+S   P  P+
Sbjct  400  RKLNAEKRPRMKGRFVKRTSFAGPSFPY  427



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 69/98 (70%), Gaps = 9/98 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
             DP+ CW   MG  +  +HHP G      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  326  LDPDECWKQCMGSCETAYHHPCGEMGGFGIHPVIIDGGREARVSRYREKRRTRLFSKKIR  385

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  386  YEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  419



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 68/92 (74%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGG--DhhhhHPYGX--AMMMRRSDEG----REARVSRYREKRRTRLFSK  467
             D ++ WPD+MG      ++ PYG   + + R +  G    REARVSRYREKRRTRLF+K
Sbjct  305  LDLDYYWPDYMGTYESDCYYQPYGEFGSGIGRHAVTGVEGEREARVSRYREKRRTRLFAK  364

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
            KIRYEVRKLNAEKRPR+KGRFVKRSS F PPP
Sbjct  365  KIRYEVRKLNAEKRPRMKGRFVKRSSCFAPPP  396



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYG-----XAMMMRRSDEGREARVSRYREKRRTRLFSKKI  461
            FD + CWPD MG      H PYG      A      D GREARVSRYREKRRTRLFSKKI
Sbjct  358  FDADECWPDCMGICGAQLHQPYGDVSGLAAHPAALVDGGREARVSRYREKRRTRLFSKKI  417

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSL  386
            RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  418  RYEVRKLNAEKRPRMKGRFVKRTTF  442



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 64/91 (70%), Gaps = 8/91 (9%)
 Frame = -1

Query  619  DPNHCWPDFMGGDhhhhHPYGXAMMMRRS-----DEGREARVSRYREKRRTRLFSKKIRY  455
            D N CWP  MG +    H YG   +M        DEGREARV RY+EKRRTRLFSKKIRY
Sbjct  337  DFNDCWPVCMG-NCGKIHSYGDIAIMNGHGGGVVDEGREARVLRYKEKRRTRLFSKKIRY  395

Query  454  EVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            EVRKLNAEKRPR+KGRFVKR++    P PFP
Sbjct  396  EVRKLNAEKRPRMKGRFVKRTNF--APTPFP  424



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 65/92 (71%), Gaps = 8/92 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS-----DEGREARVSRYREKRRTRLFSKKIR  458
             D N CWP  MG +    H YG   ++ R      DEGREARV RY+EKRRTRLFSKKIR
Sbjct  336  VDFNDCWPVCMG-NCGKIHSYGDIGIVNRHGGGGVDEGREARVLRYKEKRRTRLFSKKIR  394

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            YEVRKLNAEKRPR+KGRFVKR++    P PFP
Sbjct  395  YEVRKLNAEKRPRMKGRFVKRTNF--APTPFP  424



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 67/97 (69%), Gaps = 9/97 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS----DEGREARVSRYREKRRTRLFSKKIRY  455
             D N CWP  MG +    H YG   +M       DEGREARV RY+EKRRTRLFSKKIRY
Sbjct  314  VDSNDCWPVCMG-NCGQIHAYGDMEIMTGHGPMIDEGREARVLRYKEKRRTRLFSKKIRY  372

Query  454  EVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            EVRKLNAE RPR+KGRFVKR++    P PFP+  LNR
Sbjct  373  EVRKLNAEMRPRMKGRFVKRTNF--APTPFPS--LNR  405



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -1

Query  622  FDPNHCWPDFM----GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  455
            FDP+  W DF+    GG       Y  A  M   D GREARVSRYREKRRTRLFSKKIRY
Sbjct  318  FDPSDAWADFLVAEAGGGGEVQGMYQQAGHMAAVDGGREARVSRYREKRRTRLFSKKIRY  377

Query  454  EVRKLNAEKRPRLKGRFVKRSS  389
            EVRKLNAEKRPR+KGRFVK+++
Sbjct  378  EVRKLNAEKRPRMKGRFVKQAA  399



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 66/98 (67%), Gaps = 9/98 (9%)
 Frame = -1

Query  622  FDPNHCWPDFM-----GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
             DP+ CW   M     G D  +    G  +    +D GREARVSRYREKRRTRLFSKKIR
Sbjct  316  LDPDECWHHCMESCGTGMDDPYGEVGGFGIHPMINDGGREARVSRYREKRRTRLFSKKIR  375

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            YEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN 
Sbjct  376  YEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNH  409



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 67/101 (66%), Gaps = 17/101 (17%)
 Frame = -1

Query  622  FDPNHCWPDFMG--------GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSK  467
             D N CWP  MG        GD      +G  +     DEGREARV RY+EKRRTRLFSK
Sbjct  303  VDFNDCWPVCMGNCGKNHLYGDMGTMTGHGPTV-----DEGREARVLRYKEKRRTRLFSK  357

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            KIRYEVRKLNAEKRPR+KGRFVKR++    P PFP+  LNR
Sbjct  358  KIRYEVRKLNAEKRPRMKGRFVKRTNF--APTPFPS--LNR  394



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            F+P+  WPDF          YG    +R  D GREARVSRYREKR+ RLFSKKIRYEVRK
Sbjct  320  FNPDDYWPDFFS--ETSVGNYGG--HVRCGDGGREARVSRYREKRQNRLFSKKIRYEVRK  375

Query  442  LNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            LNAEKRPRLKGRF+KRSS     P F +Y++N+
Sbjct  376  LNAEKRPRLKGRFIKRSSSLFSVPGF-SYMMNK  407



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 63/90 (70%), Gaps = 8/90 (9%)
 Frame = -1

Query  607  CWPDFMG---GDhhhhHPYGX-----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYE  452
            C PDFMG   G    H+PYG       +    +D GREARVSRYREKRRTRLFSKKIRYE
Sbjct  357  CLPDFMGTASGAELLHYPYGDLNRVIGLHPTMTDGGREARVSRYREKRRTRLFSKKIRYE  416

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            VRKLNAEKRPR+KGRFVKR+S       FP
Sbjct  417  VRKLNAEKRPRMKGRFVKRASFAATGSTFP  446



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 64/97 (66%), Gaps = 10/97 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGXAMMMRR---------SDEGREARVSRYREKRRTRLF  473
             DP+ CW D MG      HHPYG    +           +  GREARVSRYREKRRTRLF
Sbjct  368  VDPDECWQDCMGTCGAEFHHPYGDTNGLGGVGGGGNPAMAGGGREARVSRYREKRRTRLF  427

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            SKKIRYEVRKLNAEKRPR+KGRFVKR++    P  FP
Sbjct  428  SKKIRYEVRKLNAEKRPRMKGRFVKRATFAGGPSAFP  464



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 64/93 (69%), Gaps = 7/93 (8%)
 Frame = -1

Query  622  FDPNHCWPDFMG--GDhhhhHPYGX-----AMMMRRSDEGREARVSRYREKRRTRLFSKK  464
             +P+ CW D MG  G    HH YG       +    +D GREARVSRYREKRRTRLFSKK
Sbjct  343  INPDDCWLDCMGIYGAEVLHHSYGDHNGGIGIQPAMTDGGREARVSRYREKRRTRLFSKK  402

Query  463  IRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            IRYEVRKLNAEKRPR+KGRFVKR++   P  P 
Sbjct  403  IRYEVRKLNAEKRPRMKGRFVKRANFAAPVFPL  435



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDh-hhhHPYGXAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            F+ + CW DF+G +  +    YG    +R  +D GREARVSRYREKRRTRLF+KKIRYEV
Sbjct  262  FNSDDCWLDFLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRTRLFAKKIRYEV  321

Query  448  RKLNAEKRPRLKGRFVKRS  392
            RKLNAEKRPR+KGRFVKR+
Sbjct  322  RKLNAEKRPRMKGRFVKRT  340



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            F+P+  WPDF      +   YG    +R  D GREARV RYREKRRTRLFSKKIRYEVRK
Sbjct  311  FNPDDYWPDFSETCGGNLGYYGG--HVRSGDGGREARVLRYREKRRTRLFSKKIRYEVRK  368

Query  442  LNAEKRPRLKGRFVKRSSLFQ-PPPPFPNYLLNR  344
            LNAEKRPRLKGRF+KR+S      P FP Y++N+
Sbjct  369  LNAEKRPRLKGRFIKRNSSSSFSVPGFP-YMMNK  401



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDh-hhhHPYGXAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            F+ + CW DF+G +  +    YG    +R  +D GREARVSRYREKRRTRLF+KKIRYEV
Sbjct  339  FNSDDCWLDFLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRTRLFAKKIRYEV  398

Query  448  RKLNAEKRPRLKGRFVKRS  392
            RKLNAEKRPR+KGRFVKR+
Sbjct  399  RKLNAEKRPRMKGRFVKRT  417



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -1

Query  613  NHCWPDFMG---GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            N  WP  MG   G  +     G  + M   D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  335  NDSWPISMGEVNGGQYGSGICGVGLTMAMGDVGREARVSRYREKRRTRLFSKKIRYEVRK  394

Query  442  LNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            LNAEKRPR+KGRFVKR+SL       P
Sbjct  395  LNAEKRPRMKGRFVKRASLSALASSIP  421



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
            F+ + CW D           YG    +R  +D GREARVSRYREKRRTRLF+KKIRYEVR
Sbjct  335  FNSDDCWLDLGSNGGGVQCYYGEVRSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVR  394

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            KLNAEKRPR+KGRFVK   L +P     NY
Sbjct  395  KLNAEKRPRMKGRFVKSVPLLEPLLCQLNY  424



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMR-----RSDEGREARVSRYREKRRTRLFSKKIR  458
             D   CWPD   G     H YG    M       +D GREARVSRYREKRRTRLFSKKIR
Sbjct  361  LDSCDCWPDHCLGTSGAMHVYGEMGRMSGHAAAMADGGREARVSRYREKRRTRLFSKKIR  420

Query  457  YEVRKLNAEKRPRLKGRFVKRSSL  386
            YEVRKLNAEKRPR+KGRFVKRS+ 
Sbjct  421  YEVRKLNAEKRPRMKGRFVKRSNF  444



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 60/85 (71%), Gaps = 6/85 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhh------hhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKI  461
            F+P+ CWPDF G             P    + M   D GREA+V+RYREKRRTRLFSKKI
Sbjct  328  FNPDDCWPDFTGMMWGGAGGGREVAPVYGELGMVAGDGGREAKVTRYREKRRTRLFSKKI  387

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSL  386
            RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  388  RYEVRKLNAEKRPRMKGRFVKRAAF  412



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 61/88 (69%), Gaps = 9/88 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMR---------RSDEGREARVSRYREKRRTRLFS  470
            FDP+ CWP+ MG      H +   M +           +D GREARVSRYREKRR RLFS
Sbjct  367  FDPDTCWPNCMGTFDTQLHHHHHYMDLSGLVGGNPAALADGGREARVSRYREKRRNRLFS  426

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            KKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  427  KKIRYEVRKLNAEKRPRMKGRFVKRASF  454



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhH-------PYGXAMMMRRSDEGREARVSRYREKRRTRLFSKK  464
             D +  WPD MG      H        YG   +M   D GREARVSRYREKRRTRLFSKK
Sbjct  74   LDADENWPDCMGTFGTEVHYAYGEFGGYGCHPVM--VDGGREARVSRYREKRRTRLFSKK  131

Query  463  IRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            IRYEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  132  IRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  164



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 60/91 (66%), Gaps = 5/91 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGXAMMMR----RSDEGREARVSRYREKRRTRLFSKKIR  458
             D +  WPD  G       +PYG           +D GREARVSRYREKRRTRLFSKKIR
Sbjct  353  LDADETWPDCTGSCGTEVLYPYGELGGYECHPVMADGGREARVSRYREKRRTRLFSKKIR  412

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            YEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  413  YEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  443



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEV  449
             D N  WPD MG        Y   M    +  D GREARV+RYREKRRTRLFSKKIRYEV
Sbjct  339  LDSNESWPDCMGN-------YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYEV  391

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPP  368
            RKLNAEKRPR+KGRFVKR++      P
Sbjct  392  RKLNAEKRPRMKGRFVKRANFVTTSTP  418



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = -1

Query  622  FDPNHCWPD--FMG-GDhhhhHPYG-----XAMMMRRSDEGREARVSRYREKRRTRLFSK  467
            FD + CWPD   MG      H PYG      A      D GREARVSRYREKRRTRLFSK
Sbjct  358  FDADECWPDPDCMGICGAQLHQPYGDVSGLAAHPAALVDGGREARVSRYREKRRTRLFSK  417

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            KIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  418  KIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 65/98 (66%), Gaps = 10/98 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMG------GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKI  461
            FDP+  WP+ M       G     + +  A +    D GREARVSRYREKRRTRLFSKKI
Sbjct  241  FDPDQPWPNSMDLCEVRYGQRCGEYGFRTAAI---GDGGREARVSRYREKRRTRLFSKKI  297

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            RYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  298  RYEVRKLNAEKRPRMKGRFVKRTP-FAPQPTLPIITIN  334



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEV  449
             D N  WPD MG        Y   M    +  D GREARV+RYREKRRTRLFSKKIRYEV
Sbjct  352  LDSNESWPDCMGN-------YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYEV  404

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPP  368
            RKLNAEKRPR+KGRFVKR++      P
Sbjct  405  RKLNAEKRPRMKGRFVKRANFVTTSTP  431



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 62/87 (71%), Gaps = 8/87 (9%)
 Frame = -1

Query  622  FDPNHCWPD--FMG-GDhhhhHPYGX-----AMMMRRSDEGREARVSRYREKRRTRLFSK  467
            FD + CWPD   MG      HHPYG      A      D GREARVSRYREKRRTRLFSK
Sbjct  358  FDADECWPDADCMGICGAQLHHPYGDVSGLGAHPAALVDGGREARVSRYREKRRTRLFSK  417

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            KIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  418  KIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMG---GDhhhhHPYGXAMM---MRRSDEGREARVSRYREKRRTRLFSKKI  461
             + NHCWP   G    D HHH   G A++      +  GREARVSRYREKRRTRLFSKKI
Sbjct  308  INLNHCWPHCTGLCCKDVHHHTCGGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKI  367

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLF  383
            RYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  368  RYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 64/98 (65%), Gaps = 10/98 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMG------GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKI  461
            FDP+  WP+ M       G     H    A M    D GREARVSRYREKRRTRLFSKKI
Sbjct  242  FDPDQPWPNSMEVCEVRYGQRCGEHGLRTAAM---GDGGREARVSRYREKRRTRLFSKKI  298

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            RYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  299  RYEVRKLNAEKRPRMKGRFVKRTP-FPPQPTLPFITIN  335



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhH-------PYGXAMMMRRSDEGREARVSRYREKRRTRLFSKK  464
             D +  WPD MG      H        YG   +M   D GREARVSRYREKRRTRLFSKK
Sbjct  344  LDADENWPDCMGTFGTEVHYAYGEFGGYGCHPVM--VDGGREARVSRYREKRRTRLFSKK  401

Query  463  IRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            IRYEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  402  IRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  434



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            FDP+  WPDF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  55   FDPSESWPDFPAGSRGG---LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  110

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  111  LNAEKRPRMKGRFVKR  126



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-----DhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
            FDPN  WPD+MG              G        D GREARV RYREKRRTRLFSKKIR
Sbjct  315  FDPNDYWPDYMGACPTNVHGPCGDVGGVGGNFGGRDGGREARVLRYREKRRTRLFSKKIR  374

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            YEVRKLNAEKRPR+KGRFVKR+S F   P FP  +LN
Sbjct  375  YEVRKLNAEKRPRMKGRFVKRAS-FAAGPCFP--ILN  408



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-----DhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
            FDPN  WPD+MG              G        D GREARV RYREKRRTRLFSKKIR
Sbjct  380  FDPNDYWPDYMGACPTNVHGPCGDVGGVGGNFGGRDGGREARVLRYREKRRTRLFSKKIR  439

Query  457  YEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            YEVRKLNAEKRPR+KGRFVKR+S F   P FP  +LN
Sbjct  440  YEVRKLNAEKRPRMKGRFVKRAS-FAAGPCFP--ILN  473



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 57/87 (66%), Gaps = 9/87 (10%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEV  449
             D N  WP  MG        Y   M    +  D GREARV+RYREKRRTRLFSKKIRYEV
Sbjct  362  LDSNDSWPHCMGN-------YMGIMNENVTIVDRGREARVTRYREKRRTRLFSKKIRYEV  414

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPP  368
            RKLNAEKRPR+KGRFVKR++      P
Sbjct  415  RKLNAEKRPRMKGRFVKRTNFVTTTTP  441



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (66%), Gaps = 14/96 (15%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhh---------hhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFS  470
            F+P+ CWPDF G                P    + M   + GREA+V+RYREKRRTRLFS
Sbjct  329  FNPDDCWPDFAGMMWGGAGGGGGGGEVAPVYGEVGMVAGNGGREAKVTRYREKRRTRLFS  388

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            KKIRYEVRKLNAEKRPR+KGRFVKR++      PFP
Sbjct  389  KKIRYEVRKLNAEKRPRMKGRFVKRAA-----APFP  419



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 62/84 (74%), Gaps = 6/84 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
            FD + C PD+MG      H+PYG      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  361  FD-SECLPDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIR  419

Query  457  YEVRKLNAEKRPRLKGRFVKRSSL  386
            YEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  420  YEVRKLNAEKRPRMKGRFVKRSSF  443



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 61/87 (70%), Gaps = 8/87 (9%)
 Frame = -1

Query  622  FDPNHCWPD--FMG-GDhhhhHPYGXAMMMRRS-----DEGREARVSRYREKRRTRLFSK  467
            FD + CWPD   MG      HHPYG    +        D  REARVSRYREKRRTRLFSK
Sbjct  358  FDADECWPDADCMGICGAQLHHPYGDVSGLGADPAALVDGAREARVSRYREKRRTRLFSK  417

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            K+RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  418  KLRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 56/78 (72%), Gaps = 14/78 (18%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             +P+  W D MGG              R  D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  370  LNPDDGWLDCMGG--------------RGDDRGREARVSRYREKRRTRLFSKKIRYEVRK  415

Query  442  LNAEKRPRLKGRFVKRSS  389
            LNAEKRPR+KGRFVKR+S
Sbjct  416  LNAEKRPRMKGRFVKRTS  433



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = -1

Query  559  GXAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+ 
Sbjct  168  GLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIV  227



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = -1

Query  589  GGDhhhhHPY-GXAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  416
            GG+ HHH+ + G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  157  GGEAHHHNHFRGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  216

Query  415  KGRFVKRSSL  386
            KGRFVKRSS+
Sbjct  217  KGRFVKRSSI  226



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 55/64 (86%), Gaps = 3/64 (5%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR SL   PP FP  
Sbjct  319  ADGGREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSL-ATPPIFP--  375

Query  355  LLNR  344
            LLN+
Sbjct  376  LLNK  379



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 60/81 (74%), Gaps = 5/81 (6%)
 Frame = -1

Query  613  NHCWPDFMG-GDhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            + C PD MG      H+PYG      +    +D GREARVSRYREKRRTRLFSKKIRYEV
Sbjct  357  SECLPDCMGVCGTELHYPYGDLNGLGVHPAMADGGREARVSRYREKRRTRLFSKKIRYEV  416

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAEKRPR+KGRFVKR+S 
Sbjct  417  RKLNAEKRPRMKGRFVKRASF  437



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (74%), Gaps = 6/84 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIR  458
            FD + C PD+MG      H+PYG      +     D GREARVSRYREKRRTRLFSKKIR
Sbjct  362  FD-SECLPDYMGACGAELHYPYGEMNGLGVHPAMVDGGREARVSRYREKRRTRLFSKKIR  420

Query  457  YEVRKLNAEKRPRLKGRFVKRSSL  386
            YEVRKLNA+KRPR+KGRFVKR+S 
Sbjct  421  YEVRKLNAQKRPRMKGRFVKRASF  444



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMG--GDhhhhHPYGXAMMMRR----SDEGREARVSRYREKRRTRLFSKKI  461
             + NHCWP   G      HHH  G   ++R     +  GREARVSRYREKRRTRLFSKKI
Sbjct  308  INLNHCWPYCTGLCCKGVHHHTCGGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKI  367

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSLF  383
            RYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  368  RYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = -1

Query  622  FDPNHCWPDFMGG-DhhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEV  449
             +P+  W D MG      ++PYG      R  +G REARV RY+EKRRTRLFSKKIRYEV
Sbjct  338  LNPDDSWTDSMGACPKDVNNPYGGLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEV  397

Query  448  RKLNAEKRPRLKGRFVKRSSLF  383
            RKLNAEKRPR+KGRFVKR+SL 
Sbjct  398  RKLNAEKRPRMKGRFVKRTSLM  419



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = -1

Query  559  GXAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+ 
Sbjct  340  GLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSIV  399



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXA--MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            F+P+ C P F G         G A  + M     GREARV+RYREKRRTRLFSKKIRYEV
Sbjct  331  FNPDDCCPIFTGMMWSGGVGEGDAGEVGMMAGGGGREARVARYREKRRTRLFSKKIRYEV  390

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYL  353
            RKLNAEKRPR+KGRFVKR++     P    ++
Sbjct  391  RKLNAEKRPRMKGRFVKRTAFSAAGPAASPFI  422



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 5/79 (6%)
 Frame = -1

Query  613  NHCWPDFM-----GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            ++CWPD+M      G       +G  + +   D  REARV+RYREKRRTRLFSKKIRYEV
Sbjct  325  DNCWPDYMDMWTGSGMETERACHGGEIGVYLGDGKREARVTRYREKRRTRLFSKKIRYEV  384

Query  448  RKLNAEKRPRLKGRFVKRS  392
            RKLNAEKRPR+KGRFVKR+
Sbjct  385  RKLNAEKRPRMKGRFVKRT  403



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 60/97 (62%), Gaps = 17/97 (18%)
 Frame = -1

Query  616  PNHCWPDFM----------GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSK  467
            P H WPD M           GD       G      R D GREARVSRYREKRRTRLFSK
Sbjct  345  PEHGWPDCMDMCHPDFSQINGDWRGLVGSG------RRDGGREARVSRYREKRRTRLFSK  398

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFPN  359
            KIRYEVRKLNAEKRPR+KGRFVKR+S        FPN
Sbjct  399  KIRYEVRKLNAEKRPRMKGRFVKRTSFMGINNSTFPN  435



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 55/76 (72%), Gaps = 3/76 (4%)
 Frame = -1

Query  613  NHCWPDFMG---GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            + CW +F+G    D       G  +     D GREARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  313  DDCWQNFLGPSGVDEEVRSLRGQLIGNINGDGGREARVSRYREKRRTRLFAKKIRYEVRK  372

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  373  LNAEKRPRMKGRFVKR  388



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 59/81 (73%), Gaps = 5/81 (6%)
 Frame = -1

Query  613  NHCWPDFMG-GDhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            + C PD MG      H PYG    +      +D GREARVSRYREKRRTRLFSKKIRYEV
Sbjct  361  SECLPDCMGVCGTELHFPYGDLNGLWVHPAIADGGREARVSRYREKRRTRLFSKKIRYEV  420

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAEKRPR+KGRFVKR+S 
Sbjct  421  RKLNAEKRPRMKGRFVKRASF  441



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  607  CWPDFM--GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  434
            C  D M   G   HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  186  CPTDSMVESGGEAHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNA  245

Query  433  EKRPRLKGRFVKRSSL  386
            EKRPR+KGRFVKRSS+
Sbjct  246  EKRPRMKGRFVKRSSI  261



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            FDP+  WPDF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  309  FDPSESWPDFPAGSRGG---LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  364

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  365  LNAEKRPRMKGRFVKR  380



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            FDP+  WPDF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  233  FDPSESWPDFPAGSRGG---LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  288

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  289  LNAEKRPRMKGRFVKR  304



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ F      P  L+N
Sbjct  317  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSTTF-SGSSLPYQLIN  375

Query  346  R  344
            +
Sbjct  376  K  376



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 70/117 (60%), Gaps = 23/117 (20%)
 Frame = -1

Query  622  FDPNHCWPDFMG--GDhhhhHPYGXA--------MMMRRSDE---GREARVSRYREKRRT  482
             +P+  WPD MG  G +   +  G          M MR   E   GREARVSRYREKRRT
Sbjct  340  LNPDDGWPDCMGVWGTNQIMNLQGHGDSSAAAHRMGMRGDTEQRPGREARVSRYREKRRT  399

Query  481  RLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ---------PPPPFPNYLLNRHL  338
            RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S FQ              P+Y   +HL
Sbjct  400  RLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS-FQTGMGTSSTTTASNAPHYQQQQHL  455



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  99   DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  147



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -1

Query  613  NHCWPDFMGG-DhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            + C PD+M       H+PYG    +      +D  REARVSRYREKRRTRLFSKKIRYEV
Sbjct  364  SECLPDYMSACGAELHYPYGDXNGLGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEV  423

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            RKLNAEKRPR+KGRFVK++S      P P
Sbjct  424  RKLNAEKRPRMKGRFVKKASFAGSAFPVP  452



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -1

Query  613  NHCWPDFMGG-DhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            + C PD+M       H+PYG    +      +D  REARVSRYREKRRTRLFSKKIRYEV
Sbjct  364  SECLPDYMSACGAELHYPYGDXNGLGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEV  423

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            RKLNAEKRPR+KGRFVK++S      P P
Sbjct  424  RKLNAEKRPRMKGRFVKKASFAGSAFPVP  452



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  311  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGVNAFPAY  368



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 51/70 (73%), Gaps = 5/70 (7%)
 Frame = -1

Query  604  WPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  425
            WPDF G        +         D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  332  WPDFFGTTAARGDVWAAG-----GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  386

Query  424  PRLKGRFVKR  395
            PR+KGRFVKR
Sbjct  387  PRMKGRFVKR  396



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGX---AMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  455
             +P+  W D MG        P+G     +  R  D GREARVSRYREKRRTRLFSKKIRY
Sbjct  341  LNPDDGWLDCMGMWPTEIPQPHGDTAGCVSGRGDDRGREARVSRYREKRRTRLFSKKIRY  400

Query  454  EVRKLNAEKRPRLKGRFVKRSS  389
            EVRKLNAEKRPR+KGRFVKR++
Sbjct  401  EVRKLNAEKRPRMKGRFVKRTT  422



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  550  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  130  LMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  185



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  308  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  365



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  356  MGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  409



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  607  CWPDFM--GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  434
            C  D M   G   HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  322  CPTDSMVESGGEAHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNA  381

Query  433  EKRPRLKGRFVKRSSL  386
            EKRPR+KGRFVKRSS+
Sbjct  382  EKRPRMKGRFVKRSSI  397



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  607  CWPDFM--GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  434
            C  D M   G   HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  322  CPTDSMVESGGEAHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNA  381

Query  433  EKRPRLKGRFVKRSSL  386
            EKRPR+KGRFVKRSS+
Sbjct  382  EKRPRMKGRFVKRSSI  397



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  307  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  364



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             +P+ CWPD +G      H +         + GREARV RY+EKRRTRLFSKKIRYEVRK
Sbjct  347  LNPDDCWPDCLGTCPKDGHHHPYRGHNGGGNGGREARVLRYKEKRRTRLFSKKIRYEVRK  406

Query  442  LNAEKRPRLKGRFVKRSSLFQPPPP  368
            LNAEKRPRL+GRFVKR+S      P
Sbjct  407  LNAEKRPRLQGRFVKRTSFMGATFP  431



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  370  MGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  423



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  358  MGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  411



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  607  CWPDFM--GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNA  434
            C  D M   G   HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNA
Sbjct  322  CPTDSMVESGGEAHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNA  381

Query  433  EKRPRLKGRFVKRSSL  386
            EKRPR+KGRFVKRSS+
Sbjct  382  EKRPRMKGRFVKRSSI  397



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 59/84 (70%), Gaps = 5/84 (6%)
 Frame = -1

Query  622  FDPNHCWPDF-MG--GDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIR  458
             D  + WP   MG  G   H  P+    +      D GREARVSRYREKRRTRLFSKKIR
Sbjct  311  IDIINTWPSVSMGENGGESHQKPFVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIR  370

Query  457  YEVRKLNAEKRPRLKGRFVKRSSL  386
            YEVRKLNAEKRPR+KGRFVKRSSL
Sbjct  371  YEVRKLNAEKRPRMKGRFVKRSSL  394



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  347  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  395



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  355  MGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  408



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  311  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  359



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  313  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  353  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  401



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  316  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  364



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  313  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  354  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  402



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = -1

Query  550  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PP  374
            +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F    
Sbjct  349  LMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGA  408

Query  373  PPFP-NY  356
              FP NY
Sbjct  409  TSFPTNY  415



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  315  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  363



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+ 
Sbjct  349  GLRMGEAHGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSVV  407



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  99   DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  146



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 58/77 (75%), Gaps = 5/77 (6%)
 Frame = -1

Query  601  PDFMG-GDhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLN  437
            PD+MG      H+PYG      +     D GREARVSRYREKRRTRLFSKKIRYEVRKLN
Sbjct  367  PDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLN  426

Query  436  AEKRPRLKGRFVKRSSL  386
            AEKRPR+KGRFVKRSS 
Sbjct  427  AEKRPRMKGRFVKRSSF  443



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 2/67 (3%)
 Frame = -1

Query  550  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PP  374
            +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F    
Sbjct  349  LMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGA  408

Query  373  PPFP-NY  356
              FP NY
Sbjct  409  TSFPTNY  415



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 58/77 (75%), Gaps = 5/77 (6%)
 Frame = -1

Query  601  PDFMG-GDhhhhHPYGX----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLN  437
            PD+MG      H+PYG      +     D GREARVSRYREKRRTRLFSKKIRYEVRKLN
Sbjct  367  PDYMGVCGPGLHYPYGDLNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLN  426

Query  436  AEKRPRLKGRFVKRSSL  386
            AEKRPR+KGRFVKRSS 
Sbjct  427  AEKRPRMKGRFVKRSSF  443



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = -1

Query  622  FDPNHCWPDFMGGD-hhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEV  449
             + +  W D MG      ++PYG      R  +G REARV RY+EKRRTRLFSKKIRYEV
Sbjct  339  LNADDSWTDSMGTSPKDVNNPYGGLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEV  398

Query  448  RKLNAEKRPRLKGRFVKRSSLF  383
            RKLNAEKRPR+KGRFVKR+SL 
Sbjct  399  RKLNAEKRPRMKGRFVKRTSLM  420



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  347  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  395



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            G  +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S+  
Sbjct  374  GLGLQAAMMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASIAS  433

Query  379  PPPPFP  362
                 P
Sbjct  434  ITSSLP  439



>gb|KJB23747.1| hypothetical protein B456_004G113000 [Gossypium raimondii]
Length=418

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S       FP
Sbjct  358  TDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFVGLGTAFP  415



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = -1

Query  613  NHCWPDFMG----GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
            + CW D  G    G       +G       +D GR+ARV+RYREKRRTRLF+KKIRYEVR
Sbjct  339  DSCWHDCTGMWVEGADALGVGHGSDTGGGYADVGRQARVTRYREKRRTRLFAKKIRYEVR  398

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPFPN  359
            KLNAEKRPR+KGRFVKR+    P P F +
Sbjct  399  KLNAEKRPRMKGRFVKRA----PGPAFAH  423



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  168  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  215



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             D +  W DF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  321  LDSSDSWLDFPAGSGRGFG-LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  378

Query  442  LNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            LNAEKRPR+KGRFVKR++L    PP P
Sbjct  379  LNAEKRPRMKGRFVKRAAL----PPLP  401



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/49 (94%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  372  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  420



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 59/84 (70%), Gaps = 7/84 (8%)
 Frame = -1

Query  622  FDPNHCWPDFMG--GDhhhhHPYGX-----AMMMRRSDEGREARVSRYREKRRTRLFSKK  464
             +P+  W D MG  G    H  +G       +  R  D GREARVSRYREKRRTRLFSKK
Sbjct  370  LNPDDGWLDCMGMWGSDQIHQSHGHGESAGCVGGRGDDRGREARVSRYREKRRTRLFSKK  429

Query  463  IRYEVRKLNAEKRPRLKGRFVKRS  392
            IRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  430  IRYEVRKLNAEKRPRMKGRFVKRT  453



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = -1

Query  622  FDPNHCWPDFMGGD-hhhhHPYGXAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEV  449
            F+ +   P F+G +       YG    +R  +D GREARV RYREKRRTRLF+KKIRYEV
Sbjct  318  FNSDDFLPGFLGSNGEDVLCCYGEMRSLRGHADGGREARVLRYREKRRTRLFAKKIRYEV  377

Query  448  RKLNAEKRPRLKGRFVKRSSLFQPP--PP  368
            RKLNAEKRPR+KGRFVKR+S       PP
Sbjct  378  RKLNAEKRPRMKGRFVKRTSFLGATVLPP  406



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = -1

Query  622  FDPNHCWPDFMGG--DhhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYE  452
             + + CWPD M       HHHPYG      R   G REARV RY+EKRRTRLFSKKIRYE
Sbjct  339  LNSDDCWPDCMDICLKDGHHHPYGGMGGHTRGGNGAREARVLRYKEKRRTRLFSKKIRYE  398

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPN  359
            VRKLNAEKRPR+KGRFVKR+S      P+ N
Sbjct  399  VRKLNAEKRPRMKGRFVKRTSFMGNGFPYMN  429



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKRSS+
Sbjct  353  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGRFVKRSSI  401



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  217  RMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  266



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  544  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            ++  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  276  LQGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 60/88 (68%), Gaps = 8/88 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhH----PYGXAMMMRR----SDEGREARVSRYREKRRTRLFSK  467
            F+ +  WP+   G   H      P+  AM +R      D GREARVSRYREKRRTR+FSK
Sbjct  374  FELDEGWPNSNMGTASHSLKYHLPFAEAMGLRAHVGAEDGGREARVSRYREKRRTRMFSK  433

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            KIRY+VRKLNAEKRPR+KGRFVKR S  
Sbjct  434  KIRYQVRKLNAEKRPRMKGRFVKRMSFI  461



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            +++  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ +F 
Sbjct  283  IIQFMDLGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTDVFS  338



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 59/98 (60%), Gaps = 20/98 (20%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYG-------------------XAMMMRRSDEGREARVSRY  500
             D + CWPD   G     H YG                      ++   D GR+ARVSRY
Sbjct  354  LDSDECWPD-CSGTCGKMHVYGNHHHDMGMMMMMMGGGGTHSGAVVASVDGGRQARVSRY  412

Query  499  REKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            REKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  413  REKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANF  450



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMG-GDhhhhHPYGXAMMM----RRSDEGREARVSRYREKRRTRLFSKKIR  458
             + +  W D MG      H P+G +       +  D GREARVSRYREKRRTRLFSKKIR
Sbjct  335  LNADEGWLDCMGMWPTEIHQPHGDSAGCVSRGKGDDPGREARVSRYREKRRTRLFSKKIR  394

Query  457  YEVRKLNAEKRPRLKGRFVKRSS  389
            YEVRKLNAEKRPR+KGRFVKR++
Sbjct  395  YEVRKLNAEKRPRMKGRFVKRTT  417



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = -1

Query  613  NHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEV  449
            N C P  +GG        G     +  D G     REARV RY+EKRRTRLFSKKIRYEV
Sbjct  310  NTCLPHVVGGYEKLMSSDGSVTRQQGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEV  369

Query  448  RKLNAEKRPRLKGRFVKRSSLF  383
            RKLNAE+RPR+KGRFVKR+SL 
Sbjct  370  RKLNAEQRPRIKGRFVKRTSLL  391



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  278  RMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  327



>gb|EPS70097.1| hypothetical protein M569_04667, partial [Genlisea aurea]
Length=74

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR  
Sbjct  26   ADGGREARVSRYREKRRMRLFSKKIRYEVRKLNAEKRPRIKGRFVKRQQ  74



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 55/82 (67%), Gaps = 6/82 (7%)
 Frame = -1

Query  604  WPDF------MGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP+F      MG +                D GREARVSRYREKRR RLFSKKIRYEVRK
Sbjct  314  WPEFSGACGTMGVNGETGKINENIPAAATGDGGREARVSRYREKRRKRLFSKKIRYEVRK  373

Query  442  LNAEKRPRLKGRFVKRSSLFQP  377
            LNAEKRPR+KGRFVKR++L  P
Sbjct  374  LNAEKRPRMKGRFVKRANLEAP  395



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  270  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  320



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  269  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  319



>gb|EMS51379.1| Zinc finger protein CONSTANS-LIKE 6 [Triticum urartu]
Length=254

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+DE REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  193  RTDEWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  241



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  398  DVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  445



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = -1

Query  622  FDPNHCWPDFMG--GDhhhhHPYGXAMMMRRSDEG------REARVSRYREKRRTRLFSK  467
             + + CWP  M   G    H  +G   M             REARVSRYREKRRTRLFSK
Sbjct  334  INSDDCWPHCMATCGLEGRHPIFGDHQMGGMGGNRGIGDGGREARVSRYREKRRTRLFSK  393

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            KIRYEVRKLNAEKRPR+KGRFVKRSS       F
Sbjct  394  KIRYEVRKLNAEKRPRMKGRFVKRSSFTAATTAF  427



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDFM----GGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP F     GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPAFSMVENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            +D  REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ F      P Y
Sbjct  332  NDAEREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN-FSGSSSLP-Y  389

Query  355  LLNR  344
            L+N+
Sbjct  390  LINK  393



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDFM----GGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP F     GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  327  WPAFSMVENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  386

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  387  LNAEKRPRMKGRFVKR  402



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDFM----GGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP F     GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPAFSMVENGGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 53/76 (70%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDF----MGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP       GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPPVSMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  398  DVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  445



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 53/76 (70%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDF----MGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP       GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPPVSMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 53/76 (70%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDF----MGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP       GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPPVSMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  394  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  441



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  415  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  462



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 53/76 (70%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDF----MGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP       GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  336  WPPVSMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  395

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  396  LNAEKRPRMKGRFVKR  411



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  367  RMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  416



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  287  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 53/76 (70%), Gaps = 6/76 (8%)
 Frame = -1

Query  604  WPDF----MGGDhhhhHPYGXAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            WP       GGD  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  328  WPPVSMGEFGGDQSHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  387

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  388  LNAEKRPRMKGRFVKR  403



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  287  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             DP   W DF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  308  LDPYELWSDFPAGSRGL---LGGAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  363

Query  442  LNAEKRPRLKGRFVKRSS  389
            +NAEKRPR+KGRFVKR++
Sbjct  364  VNAEKRPRMKGRFVKRTT  381



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  126  RTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  174



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  126  RTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTG  175



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 57/82 (70%), Gaps = 4/82 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMG----GDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  455
             +P+  W D MG      H  H      +  R  D  REARVSRYREKRRTRLFSKKIRY
Sbjct  335  LNPDEGWLDCMGMWPTEIHQAHGDSAGCVSGRGDDPRREARVSRYREKRRTRLFSKKIRY  394

Query  454  EVRKLNAEKRPRLKGRFVKRSS  389
            EVRKLNAEKRPR+KGRFVKR++
Sbjct  395  EVRKLNAEKRPRMKGRFVKRTT  416



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPN  359
            +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S       + N
Sbjct  373  TDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFVGTAFTYIN  431



>ref|XP_004138344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=273

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  224  SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  272



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  311  SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  359



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>gb|EMS59726.1| Zinc finger protein CONSTANS-LIKE 6 [Triticum urartu]
Length=168

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  98   REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  142



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  362  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  407



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  388  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  387  DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  398  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  448



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  357  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 5/81 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVR  446
            F+P+    DFMG + +       +   R   +G REARVSRYREKRRTRLFSKKIRY+VR
Sbjct  330  FNPD----DFMGSNPNEGIGGICSQGKRNITDGEREARVSRYREKRRTRLFSKKIRYQVR  385

Query  445  KLNAEKRPRLKGRFVKRSSLF  383
            KLNAEKRPR+KGRFVKR+S  
Sbjct  386  KLNAEKRPRIKGRFVKRASFV  406



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  421  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  466



>gb|KJB34354.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=404

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVR  446
            F+P+    DFMG +         +   R   +G REARVSRYREKRRTRLFSKKIRY+VR
Sbjct  318  FNPD----DFMGSNPKEGIGGICSQGKRNITDGEREARVSRYREKRRTRLFSKKIRYQVR  373

Query  445  KLNAEKRPRLKGRFVKRSSLF  383
            KLNAEKRPR+KGRFVKR+S  
Sbjct  374  KLNAEKRPRIKGRFVKRASFV  394



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             DP+  W DF  G        G  +      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  293  LDPHESWSDFPAGSRGL---LGGTVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  348

Query  442  LNAEKRPRLKGRFVK  398
            LNAEKRPR+KGRFVK
Sbjct  349  LNAEKRPRMKGRFVK  363



>gb|KJB34352.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=414

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = -1

Query  622  FDPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVR  446
            F+P+    DFMG +         +   R   +G REARVSRYREKRRTRLFSKKIRY+VR
Sbjct  328  FNPD----DFMGSNPKEGIGGICSQGKRNITDGEREARVSRYREKRRTRLFSKKIRYQVR  383

Query  445  KLNAEKRPRLKGRFVKRSSLF  383
            KLNAEKRPR+KGRFVKR+S  
Sbjct  384  KLNAEKRPRIKGRFVKRASFV  404



>gb|EMT01944.1| hypothetical protein F775_21198 [Aegilops tauschii]
Length=340

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+DE REARVSRYR+KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  280  RTDEWREARVSRYRKKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  328



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/46 (96%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -1

Query  622  FDPNHCWPDFM-----------GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRL  476
            F+P+  WPD +            GD          +     D GREARVSRYREKRRTRL
Sbjct  334  FNPDDGWPDCLDVCHTDHVGPANGDSSRGGLGLGGVGGSVGDGGREARVSRYREKRRTRL  393

Query  475  FSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            FSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  394  FSKKIRYEVRKLNAEKRPRMKGRFVKRT  421



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 56/82 (68%), Gaps = 7/82 (9%)
 Frame = -1

Query  613  NHCWPD-------FMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  455
            + CWP         MGG    H          + D GR+ARVSRYREKRRTRLFSKKIRY
Sbjct  345  DGCWPHDYSMSVWMMGGVLVGHGTEELRTPRTKMDGGRDARVSRYREKRRTRLFSKKIRY  404

Query  454  EVRKLNAEKRPRLKGRFVKRSS  389
            EVRKLNAEKRPR+KGRFVKR++
Sbjct  405  EVRKLNAEKRPRMKGRFVKRAN  426



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -1

Query  613  NHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEV  449
            N C    +GG        G     +  D G     REARV RY+EKRRTRLFSKKIRYEV
Sbjct  309  NTCPSHAVGGFDELVSTVGSVTRQQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEV  368

Query  448  RKLNAEKRPRLKGRFVKRSSLF  383
            RKLNAE+RPR+KGRFVKR+SL 
Sbjct  369  RKLNAEQRPRIKGRFVKRTSLL  390



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  277  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  320



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = -1

Query  613  NHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEV  449
            N C    MGG        G     +  D G     REAR+ RYREKRRTRLF+KKIRYEV
Sbjct  316  NTCPSHVMGGFEELASAVGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEV  375

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAE+RPR+KGRFVKR+SL
Sbjct  376  RKLNAEQRPRIKGRFVKRTSL  396



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = -1

Query  613  NHCWPDFMGGDhhhhHPYGXAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEV  449
            N C    MGG        G     +  D G     REARV RYR+KRRTRLF+KKIRYEV
Sbjct  317  NTCPSHVMGGFDELESAVGSVTRQQGRDGGGSDVEREARVLRYRDKRRTRLFAKKIRYEV  376

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAE+RPR+KGRFVKR+SL
Sbjct  377  RKLNAEQRPRIKGRFVKRTSL  397



>gb|AGI62031.1| CONSTANS-like 7 [Erycina pusilla]
Length=314

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -1

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            E REARV+RYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++L
Sbjct  256  EEREARVTRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTTL  303



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            RE++V+RYREKRRTRLF+KKIRYEVR+LNAEKRPR+KGRFVKR+S+  P P F   +L+
Sbjct  310  RESKVTRYREKRRTRLFAKKIRYEVRRLNAEKRPRMKGRFVKRASM-APTPAFAGPVLD  367



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            SD  REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVKR+SL
Sbjct  349  SDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKRTSL  398



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            SD  REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVKR+SL
Sbjct  356  SDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKRTSL  405



>ref|XP_001752335.1| predicted protein [Physcomitrella patens]
 gb|EDQ83068.1| predicted protein [Physcomitrella patens]
Length=62

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            R+ARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR++L
Sbjct  15   RDARVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTAL  60



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  442  RTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  490



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  369  DVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA  415



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            S+  REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  318  SNGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  366



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            D GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR++
Sbjct  445  DRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTT  492



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = -1

Query  589  GGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  410
            GG       YG  + M   + GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  346  GGGWKVAPVYGE-VGMAAGNGGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  404

Query  409  RFVK  398
            RFVK
Sbjct  405  RFVK  408



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  380  GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -1

Query  622  FDPNHC-WPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
            F+ N C WP    GD       G         +GREA+V+RYREKRRTR+F+KKIRYEVR
Sbjct  296  FNLNVCRWP----GDMGMWVGEGGEEDKGGGRQGREAKVTRYREKRRTRMFAKKIRYEVR  351

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            +LNAE+RPR+KGRFVKR +   P P F
Sbjct  352  RLNAEQRPRMKGRFVKR-AFVTPTPAF  377



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  379  GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  339  REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  383



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  404  GREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  447



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRFVKR++
Sbjct  398  GREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRFVKRTN  443



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRFVKR++
Sbjct  398  GREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRFVKRTN  443



>ref|XP_002520096.1| hypothetical protein RCOM_1709850 [Ricinus communis]
 gb|EEF42285.1| hypothetical protein RCOM_1709850 [Ricinus communis]
Length=58

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            G  ++M      REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRF+KRSS
Sbjct  2    GEVLVMEEERIRREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFIKRSS  58



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  427  GREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  470



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  327  REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  371



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  399  GREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  562  YGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            Y     +   D+GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK++
Sbjct  415  YAQGATLAAGDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQT  471



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +   P
Sbjct  395  REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAGAAP  443



>ref|XP_001769056.1| predicted protein [Physcomitrella patens]
 gb|EDQ66134.1| predicted protein [Physcomitrella patens]
Length=62

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            +S  GR+A+V RY+EKR TRLFSKKIRYEVRK+NAE+RPR+KGRFVKR+S
Sbjct  10   QSGGGRDAKVLRYKEKRATRLFSKKIRYEVRKVNAERRPRMKGRFVKRTS  59



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREARVSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+SL
Sbjct  308  DGGREARVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRASL  356



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -1

Query  619  DPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKL  440
            D    W D       +    G   +M      REA V RY+EKR+TRLFSKKIRY+VRKL
Sbjct  19   DRGSLWADDCSLSFKNTSYMGEVPVMEEEKTRREASVLRYKEKRQTRLFSKKIRYQVRKL  78

Query  439  NAEKRPRLKGRFVKR  395
            NA+KRPRLKGRFVKR
Sbjct  79   NADKRPRLKGRFVKR  93



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            D  REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPR+KGRFVKR + F
Sbjct  331  DAEREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRFVKRPTAF  380



>ref|XP_001754240.1| predicted protein [Physcomitrella patens]
 gb|EDQ81141.1| predicted protein [Physcomitrella patens]
Length=62

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            R+ARV RY+EKR TRLFSKKIRYEVRK+NAE+RPR+KGRFVKR+S
Sbjct  15   RDARVLRYKEKRATRLFSKKIRYEVRKVNAERRPRMKGRFVKRTS  59



>ref|XP_002993117.1| hypothetical protein SELMODRAFT_136568 [Selaginella moellendorffii]
 gb|EFJ05757.1| hypothetical protein SELMODRAFT_136568 [Selaginella moellendorffii]
Length=77

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAE+RPRLK RF
Sbjct  9    GREARVSRYREKRRTRLFSKKIRYEVRKLNAERRPRLKVRF  49



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 62/96 (65%), Gaps = 10/96 (10%)
 Frame = -1

Query  622  FDPNHCWPDF---MGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYE  452
            FDPN  WPD     GG       +    +   +DEGREARVSRYREKRR RLFSKKIRYE
Sbjct  331  FDPNDSWPDVPAMAGGAAAMKEMHYQQEVAHAADEGREARVSRYREKRRRRLFSKKIRYE  390

Query  451  VRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            VRKLNAEKRPR+KGRFVKR       P FP  L  R
Sbjct  391  VRKLNAEKRPRMKGRFVKR-------PAFPAALACR  419



>ref|XP_002964550.1| hypothetical protein SELMODRAFT_38981, partial [Selaginella moellendorffii]
 gb|EFJ34883.1| hypothetical protein SELMODRAFT_38981, partial [Selaginella moellendorffii]
Length=66

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/41 (95%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAE+RPRLK RF
Sbjct  26   GREARVSRYREKRRTRLFSKKIRYEVRKLNAERRPRLKVRF  66



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RYREKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  163  REASVLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>ref|XP_002962768.1| hypothetical protein SELMODRAFT_141010 [Selaginella moellendorffii]
 gb|EFJ36231.1| hypothetical protein SELMODRAFT_141010 [Selaginella moellendorffii]
Length=287

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            R D+ REARV+RYREKRRTR+FSKKIRYEVRK+ AE RPRLKGRFV+R++  +
Sbjct  222  RLDKEREARVNRYREKRRTRMFSKKIRYEVRKIYAENRPRLKGRFVRRTNEIE  274



>gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            G   +M      REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  182  GEVPVMEEEKTRREASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>ref|XP_008799492.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2-like [Phoenix dactylifera]
Length=411

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFVKR SL Q
Sbjct  356  REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVKRPSLLQ  403



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -1

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  410
            M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  358  MGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  179  GEVPVMEEEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -1

Query  619  DPNHCWPDFMGGDhhhhHPYGXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKL  440
            D    W D       +    G   +M      REA V RY+EKR+TRLFSKKIRY+VRKL
Sbjct  136  DRGSLWADDCSLSFKNTSYMGEVPVMEEEKTRREASVLRYKEKRQTRLFSKKIRYQVRKL  195

Query  439  NAEKRPRLKGRFVKR  395
            NA+KRPRLKGRFVKR
Sbjct  196  NADKRPRLKGRFVKR  210



>gb|KDO45660.1| hypothetical protein CISIN_1g017778mg [Citrus sinensis]
Length=335

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            S E REA V RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  285  SKEHREASVMRYKEKRQNRLFSKRIRYEVRKLNAEKRPRMKGRFVKRNS  333



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            D GREA VSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+ L
Sbjct  334  DGGREASVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRTPL  382



>ref|XP_006447220.1| hypothetical protein CICLE_v10015864mg [Citrus clementina]
 ref|XP_006469936.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Citrus sinensis]
 gb|ESR60460.1| hypothetical protein CICLE_v10015864mg [Citrus clementina]
Length=335

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            S E REA V RY+EKR+ RLFSK+IRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  285  SKEHREASVMRYKEKRQNRLFSKRIRYEVRKLNAEKRPRMKGRFVKRNS  333



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPRLKGRFVKR  +
Sbjct  186  REARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  196  REASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>ref|XP_004294775.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  192  REASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_002298500.1| CONSTANS-like family protein [Populus trichocarpa]
 gb|EEE83305.1| CONSTANS-like family protein [Populus trichocarpa]
Length=207

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR +
Sbjct  163  REASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVT  207



>ref|XP_010927244.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Elaeis guineensis]
Length=416

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            REA V RY+EKRR+RLFSKKIRY+VRK+NA++RPR+KGRFVKR SL Q
Sbjct  361  REASVLRYKEKRRSRLFSKKIRYQVRKVNADQRPRMKGRFVKRPSLLQ  408



>ref|XP_010248760.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Nelumbo nucifera]
Length=364

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            REARV RYREKR++RLFSKKIRYEVRKLNAE RPRLKGRFVKR+
Sbjct  321  REARVLRYREKRQSRLFSKKIRYEVRKLNAEIRPRLKGRFVKRN  364



>ref|XP_011024893.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=225

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR +
Sbjct  181  REASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVT  225



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            RE  V RY+EKRR+RLFSKKIRYEVRKLNA+KRPRLKGRFVKR S
Sbjct  178  RETSVLRYKEKRRSRLFSKKIRYEVRKLNADKRPRLKGRFVKRIS  222



>ref|XP_010929359.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2 [Elaeis guineensis]
Length=425

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            REA + RY+EKRRTRLFSKKIRY+VRKLNA++RPR+KGRFV+ SSL Q
Sbjct  358  REASMLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRSSSLLQ  405



>ref|XP_007140857.1| hypothetical protein PHAVU_008G147400g [Phaseolus vulgaris]
 gb|ESW12851.1| hypothetical protein PHAVU_008G147400g [Phaseolus vulgaris]
Length=331

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            REA V RY+EKR++RLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  288  REASVQRYKEKRQSRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  330



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  184  GEVPIMEEDRTRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  238



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  179  GEVPVMEEDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  179  GEVPVMEEDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>gb|KDP46366.1| hypothetical protein JCGZ_10206 [Jatropha curcas]
Length=339

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            REA V RY+EKR++RLF+KKIRYEVRKLNAEKRPRLKGRFVKR+
Sbjct  294  REASVLRYKEKRQSRLFAKKIRYEVRKLNAEKRPRLKGRFVKRN  337



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR KGRFVKR
Sbjct  179  GEVPVMEDEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR  233



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  189  GEVPVMEEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  243



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  559  GXAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G   +M      REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  191  GEVPVMEEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  245



>gb|KFK43009.1| hypothetical protein AALP_AA1G067400 [Arabis alpina]
Length=193

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            REA V RY+EKRR+RLF+KKIRY+VRKLNA+KRPR KGRFVKR +
Sbjct  149  REASVLRYKEKRRSRLFTKKIRYQVRKLNADKRPRFKGRFVKRDT  193



>ref|XP_002268929.1| PREDICTED: uncharacterized protein LOC100254358 [Vitis vinifera]
Length=310

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+A V RY+EKR++RLFSK+IRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  267  RQASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  310



>emb|CBI17712.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            R+A V RY+EKR++RLFSK+IRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  275  RQASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  318



>gb|ABF00989.1| putative stress resistance-related protein [Oryza sativa Japonica 
Group]
Length=482

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
            REA V RY+EKRRTRLFSKKIRY+VRK+NA+ RPR+KGRFV+  SL Q
Sbjct  428  REASVMRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPSLLQ  475



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            REARV RY+EKRR+RLFSK+IRYEVRKLNAEKRPR KGRFV+R
Sbjct  187  REARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRR  229



>ref|XP_004142772.1| PREDICTED: uncharacterized protein LOC101217596 [Cucumis sativus]
Length=322

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            REA V RY+EKR++RLFSK+IRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  279  REASVLRYKEKRQSRLFSKRIRYEVRKLNAEKRPRMKGRFVKRS  322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950