BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015J22

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               323   1e-108   Solanum lycopersicum
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               323   3e-108   Solanum lycopersicum
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          322   9e-108   Solanum lycopersicum
ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               320   2e-107   Nicotiana tomentosiformis
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          320   2e-107   Nicotiana sylvestris
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               317   4e-106   Sesamum indicum [beniseed]
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          317   8e-106   Sesamum indicum [beniseed]
gb|EPS66678.1|  hypothetical protein M569_08101                         316   1e-105   Genlisea aurea
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                316   2e-105   Erythranthe guttata [common monkey flower]
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          315   3e-105   Citrus sinensis [apfelsine]
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                316   4e-105   Erythranthe guttata [common monkey flower]
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         314   8e-105   Petunia x hybrida [garden petunia]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          314   8e-105   Citrus sinensis [apfelsine]
ref|XP_002301250.1|  60S ribosomal protein L15                          314   9e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             314   9e-105   Prunus persica
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               313   1e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             314   1e-104   
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          313   1e-104   Sesamum indicum [beniseed]
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          313   1e-104   Nicotiana tomentosiformis
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    313   2e-104   Populus euphratica
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             316   2e-104   
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          313   2e-104   Sesamum indicum [beniseed]
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          313   2e-104   Nicotiana sylvestris
ref|XP_002304285.2|  60S ribosomal protein L15                          313   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          313   3e-104   Nicotiana sylvestris
gb|EPS59253.1|  hypothetical protein M569_15555                         312   3e-104   Genlisea aurea
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             312   5e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369001.1|  60S ribosomal protein L15                          311   6e-104   Populus trichocarpa [western balsam poplar]
emb|CDP10996.1|  unnamed protein product                                311   8e-104   Coffea canephora [robusta coffee]
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          311   8e-104   Nicotiana tomentosiformis
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          312   8e-104   Populus euphratica
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             311   1e-103   Elaeis guineensis
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             311   2e-103   
ref|XP_002510977.1|  ribosomal protein L15, putative                    310   2e-103   Ricinus communis
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         310   2e-103   Jatropha curcas
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             310   3e-103   Phaseolus vulgaris [French bean]
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             311   3e-103   Pyrus x bretschneideri [bai li]
gb|KHG00889.1|  60S ribosomal L15                                       309   5e-103   Gossypium arboreum [tree cotton]
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    309   5e-103   Elaeis guineensis
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       309   7e-103   Gossypium arboreum [tree cotton]
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          309   7e-103   Phoenix dactylifera
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          308   1e-102   Elaeis guineensis
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               308   1e-102   Phoenix dactylifera
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          308   1e-102   
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         308   1e-102   Jatropha curcas
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          308   2e-102   Populus euphratica
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    308   2e-102   Cucumis sativus [cucumbers]
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        307   3e-102   Elaeis guineensis
emb|CDP11952.1|  unnamed protein product                                306   3e-102   Coffea canephora [robusta coffee]
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          307   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    307   4e-102   Cucumis melo [Oriental melon]
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          307   4e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002530661.1|  ribosomal protein L15, putative                    307   4e-102   Ricinus communis
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    307   5e-102   
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             306   6e-102   Phoenix dactylifera
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             306   9e-102   Vitis vinifera
emb|CBI16601.3|  unnamed protein product                                306   1e-101   Vitis vinifera
emb|CAN68893.1|  hypothetical protein VITISV_004609                     305   2e-101   Vitis vinifera
ref|XP_010107162.1|  60S ribosomal protein L15                          305   2e-101   Morus notabilis
gb|AGL08210.1|  60S ribosomal protein L15                               305   2e-101   Arachis hypogaea [goober]
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    305   2e-101   
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             305   2e-101   Phaseolus vulgaris [French bean]
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               305   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             305   2e-101   Eucalyptus grandis [rose gum]
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             305   3e-101   Tarenaya hassleriana [spider flower]
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        305   3e-101   Cucumis melo [Oriental melon]
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             305   3e-101   Vitis vinifera
gb|ACV50439.1|  ribosomal protein L15                                   305   4e-101   Jatropha curcas
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        305   4e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        304   4e-101   Vitis vinifera
ref|XP_010104882.1|  60S ribosomal protein L15                          305   8e-101   
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        304   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    303   9e-101   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             303   1e-100   Eucalyptus grandis [rose gum]
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          303   1e-100   Amborella trichopoda
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             303   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          303   1e-100   Amborella trichopoda
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          303   1e-100   Oryza brachyantha
ref|NP_001050612.1|  Os03g0598800                                       303   1e-100   
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          303   1e-100   Prunus mume [ume]
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   302   1e-100   Citrus sinensis [apfelsine]
ref|NP_001235890.1|  uncharacterized protein LOC100305473               303   2e-100   Glycine max [soybeans]
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        303   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       302   3e-100   Gossypium arboreum [tree cotton]
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          303   3e-100   
gb|ACU24496.1|  unknown                                                 302   4e-100   Glycine max [soybeans]
gb|KHN44085.1|  60S ribosomal protein L15                               302   4e-100   Glycine soja [wild soybean]
gb|KJB51842.1|  hypothetical protein B456_008G234000                    302   4e-100   Gossypium raimondii
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    301   4e-100   Populus euphratica
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   5e-100   Tarenaya hassleriana [spider flower]
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   6e-100   Tarenaya hassleriana [spider flower]
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       301   7e-100   Gossypium arboreum [tree cotton]
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   7e-100   
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   7e-100   Tarenaya hassleriana [spider flower]
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   8e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             301   8e-100   Prunus persica
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        301   9e-100   Tarenaya hassleriana [spider flower]
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          302   1e-99    
gb|ACF88005.1|  unknown                                                 301   1e-99    Zea mays [maize]
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               300   1e-99    
gb|ADA67930.1|  putative 60S ribosomal protein L15                      300   2e-99    Wolffia arrhiza
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    300   2e-99    
ref|NP_001150716.1|  60S ribosomal protein L15                          300   2e-99    Zea mays [maize]
ref|NP_001236804.1|  uncharacterized protein LOC100306052               300   2e-99    
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    300   2e-99    Theobroma cacao [chocolate]
gb|EEE63068.1|  hypothetical protein OsJ_17876                          306   3e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          300   3e-99    Sorghum bicolor [broomcorn]
ref|NP_001148602.1|  60S ribosomal protein L15                          299   5e-99    Zea mays [maize]
gb|EEC78893.1|  hypothetical protein OsI_19264                          305   7e-99    Oryza sativa Indica Group [Indian rice]
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      299   7e-99    Picea mariana [black spruce]
ref|NP_001148378.1|  60S ribosomal protein L15                          298   8e-99    Zea mays [maize]
ref|NP_001150386.1|  60S ribosomal protein L15                          298   1e-98    Zea mays [maize]
gb|ACF87670.1|  unknown                                                 298   1e-98    Zea mays [maize]
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      298   1e-98    Picea mariana [black spruce]
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    298   1e-98    
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          298   1e-98    Sorghum bicolor [broomcorn]
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    296   1e-97    Cicer arietinum [garbanzo]
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-1             296   1e-97    Fragaria vesca subsp. vesca
gb|AFK49215.1|  unknown                                                 295   1e-97    Medicago truncatula
gb|ACJ84067.1|  unknown                                                 295   1e-97    Medicago truncatula
dbj|BAJ95856.1|  predicted protein                                      295   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK46983.1|  unknown                                                 295   2e-97    Lotus japonicus
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             295   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    294   2e-97    
ref|XP_003593619.1|  Ribosomal protein L15                              296   3e-97    Medicago truncatula
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    295   3e-97    
gb|AAT85124.1|  putative 60s ribosomal protein L15                      293   5e-97    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD22764.1|  ribosomal protein                                      294   6e-97    Bromus inermis [awnless brome grass]
emb|CBI25842.3|  unnamed protein product                                293   7e-97    Vitis vinifera
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    293   8e-97    Setaria italica
emb|CBI38664.3|  unnamed protein product                                293   8e-97    Vitis vinifera
ref|XP_001764493.1|  predicted protein                                  293   1e-96    
gb|AAK67641.1|  ribosomal protein L15                                   293   2e-96    Homo sapiens [man]
emb|CAB10520.1|  ribosomal protein                                      293   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        292   3e-96    Setaria italica
ref|NP_193470.1|  60S ribosomal protein L15-2                           291   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193405.1|  60S ribosomal protein L15-1                           291   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001753036.1|  predicted protein                                  291   5e-96    
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             291   5e-96    Capsella rubella
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    291   6e-96    Arabis alpina [alpine rockcress]
ref|XP_002868106.1|  60S ribosomal protein L15                          291   6e-96    
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_001771165.1|  predicted protein                                  291   7e-96    
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        291   8e-96    Brassica rapa
gb|AFK37409.1|  unknown                                                 291   9e-96    Lotus japonicus
gb|KJB39740.1|  hypothetical protein B456_007G028600                    290   9e-96    Gossypium raimondii
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              290   9e-96    
emb|CDX90499.1|  BnaA03g42820D                                          293   1e-95    
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             291   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             290   1e-95    Brassica rapa
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             290   1e-95    Brassica rapa
emb|CDY60707.1|  BnaC07g50070D                                          293   1e-95    Brassica napus [oilseed rape]
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        290   2e-95    Cicer arietinum [garbanzo]
emb|CDY53647.1|  BnaA08g30370D                                          291   2e-95    Brassica napus [oilseed rape]
emb|CDY54747.1|  BnaAnng13420D                                          291   3e-95    Brassica napus [oilseed rape]
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        289   4e-95    Brassica rapa
emb|CDY50842.1|  BnaC08g47880D                                          291   6e-95    Brassica napus [oilseed rape]
ref|XP_001757563.1|  predicted protein                                  288   7e-95    
ref|XP_002879569.1|  60S ribosomal protein L15                          288   8e-95    Arabidopsis lyrata subsp. lyrata
emb|CDY40505.1|  BnaC01g20070D                                          292   1e-94    Brassica napus [oilseed rape]
gb|AFK40278.1|  unknown                                                 288   2e-94    Lotus japonicus
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   286   4e-94    Citrus sinensis [apfelsine]
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             282   2e-92    Selaginella moellendorffii
gb|EMS52882.1|  60S ribosomal protein L15                               284   3e-92    Triticum urartu
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          281   7e-92    Prunus mume [ume]
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             281   8e-92    Selaginella moellendorffii
emb|CDX76573.1|  BnaA08g08270D                                          280   1e-91    
emb|CDY09632.1|  BnaC07g34290D                                          279   2e-91    Brassica napus [oilseed rape]
emb|CDY59531.1|  BnaCnng35130D                                          279   2e-91    Brassica napus [oilseed rape]
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    275   4e-89    
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    272   3e-88    Volvox carteri f. nagariensis
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        271   9e-88    
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              270   2e-87    Chlorella variabilis
ref|XP_005646118.1|  ribosomal protein L15e                             269   4e-87    Coccomyxa subellipsoidea C-169
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    269   5e-87    Chlamydomonas reinhardtii
gb|EMT29287.1|  60S ribosomal protein L15                               270   8e-87    
ref|XP_011401241.1|  60S ribosomal protein L15                          271   1e-84    Auxenochlorella protothecoides
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 256   4e-82    Ostreococcus tauri
ref|XP_003056552.1|  predicted protein                                  256   4e-82    Micromonas pusilla CCMP1545
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           256   6e-82    Syntrichia ruralis
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     253   3e-81    Eucalyptus grandis [rose gum]
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    253   5e-81    Ostreococcus lucimarinus CCE9901
gb|EMT18644.1|  60S ribosomal protein L15                               251   1e-80    
gb|KDD73446.1|  ribosomal L15                                           250   1e-79    Helicosporidium sp. ATCC 50920
ref|XP_004348091.1|  ribosomal protein L15                              248   1e-78    Capsaspora owczarzaki ATCC 30864
ref|XP_005717822.1|  60S ribosomal protein L15                          243   1e-76    Chondrus crispus [carageen]
gb|ACU45020.1|  60s ribosomal protein L15                               242   1e-76    Pfiesteria piscicida
ref|XP_503229.1|  60S ribosomal protein L15                             242   2e-76    Yarrowia lipolytica CLIB122
gb|EPE06282.1|  60s ribosomal protein l15                               241   4e-76    Ophiostoma piceae UAMH 11346
ref|XP_006690758.1|  ribosomal protein L15-like protein                 240   6e-76    Chaetomium thermophilum var. thermophilum DSM 1495
gb|ERS96332.1|  60S ribosomal protein L15                               239   2e-75    Sporothrix schenckii ATCC 58251
gb|EFX04788.1|  60S ribosomal protein l15                               238   3e-75    Grosmannia clavigera kw1407
gb|KIY95038.1|  60S ribosomal protein L15-1                             237   9e-75    Monoraphidium neglectum
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               237   9e-75    Galdieria sulphuraria
gb|KIV95599.1|  60S ribosomal protein L15                               237   1e-74    Exophiala mesophila
gb|KIN02516.1|  hypothetical protein OIDMADRAFT_18358                   237   1e-74    Oidiodendron maius Zn
gb|KEF63356.1|  60S ribosomal protein L15                               237   1e-74    Exophiala aquamarina CBS 119918
ref|XP_008713401.1|  60S ribosomal protein L15                          236   2e-74    Cyphellophora europaea CBS 101466
emb|CEJ94099.1|  Putative Ribosomal protein L15                         236   3e-74    Torrubiella hemipterigena
gb|KIX01331.1|  60S ribosomal protein L15                               236   3e-74    Rhinocladiella mackenziei CBS 650.93
ref|XP_957199.1|  60S ribosomal protein L15                             236   4e-74    Neurospora crassa OR74A
gb|EQL00837.1|  Ribosomal protein L15e                                  236   4e-74    Ophiocordyceps sinensis CO18
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    235   5e-74    Saccoglossus kowalevskii
gb|ESW97334.1|  60S ribosomal protein L15-B                             235   6e-74    Ogataea parapolymorpha DL-1
ref|XP_009159952.1|  60S ribosomal protein L15                          235   7e-74    Exophiala dermatitidis NIH/UT8656
ref|XP_001624083.1|  predicted protein                                  235   7e-74    Nematostella vectensis
ref|XP_008725811.1|  60S ribosomal protein L15                          235   8e-74    Cladophialophora carrionii CBS 160.54
ref|XP_001541513.1|  60S ribosomal protein L15                          234   1e-73    Histoplasma capsulatum NAm1
gb|KIE03942.1|  Ribosomal protein L15e                                  234   1e-73    Metarhizium majus ARSEF 297
ref|XP_003657786.1|  60S ribosomal protein L15                          234   1e-73    Thielavia terrestris NRRL 8126
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  234   2e-73    Neospora caninum Liverpool
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 234   2e-73    Thermothelomyces thermophila ATCC 42464
ref|XP_002366469.1|  ribosomal protein L15, putative                    234   2e-73    Toxoplasma gondii ME49
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               236   2e-73    Aureobasidium subglaciale EXF-2481
gb|KIW41910.1|  60S ribosomal protein L15                               236   2e-73    Exophiala oligosperma
gb|KEQ59346.1|  60S ribosomal protein L15                               234   2e-73    Aureobasidium melanogenum CBS 110374
ref|XP_007812013.1|  60S ribosomal protein L15                          234   2e-73    Metarhizium acridum CQMa 102
ref|XP_002545593.1|  60S ribosomal protein L15-B                        234   3e-73    Candida tropicalis MYA-3404
ref|XP_005534852.1|  60S ribosomal protein L15                          233   3e-73    Cyanidioschyzon merolae strain 10D
ref|XP_762879.1|  60S ribosomal protein L15                             233   3e-73    Theileria parva strain Muguga
ref|XP_001909718.1|  hypothetical protein                               233   3e-73    Podospora anserina S mat+
gb|KIX93106.1|  60S ribosomal protein L15                               233   3e-73    Fonsecaea multimorphosa CBS 102226
gb|KIW07591.1|  60S ribosomal protein L15                               233   3e-73    Verruconis gallopava
gb|KID77747.1|  Ribosomal protein L15e                                  233   3e-73    Metarhizium brunneum ARSEF 3297
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    233   3e-73    Blumeria graminis f. sp. tritici 96224
ref|XP_003233932.1|  60S ribosomal protein L15                          233   3e-73    Trichophyton rubrum CBS 118892
ref|XP_007511637.1|  60S ribosomal protein L15                          233   4e-73    Bathycoccus prasinos
gb|EEQ87750.1|  60S ribosomal protein L15                               233   4e-73    
ref|XP_001545571.1|  60S ribosomal protein L15                          233   4e-73    
ref|XP_009691154.1|  60S ribosomal protein L15                          233   4e-73    Theileria orientalis strain Shintoku
ref|XP_002623870.1|  60S ribosomal protein L15                          233   4e-73    Blastomyces gilchristii SLH14081
ref|XP_009226880.1|  60S ribosomal protein L15                          233   4e-73    Gaeumannomyces tritici R3-111a-1
gb|KIW20891.1|  60S ribosomal protein L15                               233   5e-73    Exophiala spinifera
ref|XP_007759046.1|  60S ribosomal protein L15                          233   5e-73    Cladophialophora yegresii CBS 114405
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         233   5e-73    
gb|ACR24948.1|  ribosomal protein L15                                   233   5e-73    Lepidochitona cinerea
ref|XP_007804051.1|  60S ribosomal protein L15                          233   5e-73    Endocarpon pusillum Z07020
ref|XP_003350788.1|  60S ribosomal protein L15                          233   6e-73    Sordaria macrospora k-hell
ref|XP_003382517.1|  PREDICTED: 60S ribosomal protein L15-like          233   6e-73    Amphimedon queenslandica
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              233   7e-73    Pseudocercospora fijiensis CIRAD86
gb|KHN95867.1|  Ribosomal protein L15e                                  233   7e-73    Metarhizium album ARSEF 1941
ref|XP_002797110.1|  60S ribosomal protein L15                          232   8e-73    Paracoccidioides lutzii Pb01
gb|ESZ93952.1|  60S ribosomal protein L15                               232   8e-73    Sclerotinia borealis F-4128
gb|ENH84342.1|  60s ribosomal protein l15                               232   9e-73    
gb|KGQ83010.1|  60S ribosomal protein L15-A                             232   9e-73    Candida albicans P37005
ref|XP_001525424.1|  60S ribosomal protein L15-B                        232   9e-73    Lodderomyces elongisporus NRRL YB-4239
ref|XP_001225510.1|  60S ribosomal protein L15                          232   9e-73    Chaetomium globosum CBS 148.51
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              232   1e-72    Spathaspora passalidarum NRRL Y-27907
gb|KJB51845.1|  hypothetical protein B456_008G234000                    230   1e-72    Gossypium raimondii
ref|XP_007737355.1|  60S ribosomal protein L15                          232   1e-72    Capronia epimyces CBS 606.96
gb|KEY67005.1|  hypothetical protein S7711_05126                        232   1e-72    Stachybotrys chartarum IBT 7711
gb|KIW77490.1|  60S ribosomal protein L15                               232   1e-72    Fonsecaea pedrosoi CBS 271.37
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                232   1e-72    
emb|CCF41498.1|  60S ribosomal protein L15                              232   1e-72    Colletotrichum higginsianum
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    231   1e-72    Trichoderma reesei QM6a
emb|CDK25606.1|  unnamed protein product                                231   2e-72    Kuraishia capsulata CBS 1993
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             231   2e-72    Baudoinia panamericana UAMH 10762
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              231   2e-72    Glarea lozoyensis ATCC 20868
ref|XP_003869213.1|  Rpl15a ribosomal protein                           231   2e-72    Candida orthopsilosis Co 90-125
ref|XP_007724541.1|  60S ribosomal protein L15                          231   2e-72    Capronia coronata CBS 617.96
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          231   2e-72    Hydra vulgaris
gb|EMS24660.1|  60S ribosomal protein l15                               231   2e-72    Rhodotorula toruloides NP11
gb|KCW90852.1|  hypothetical protein EUGRSUZ_A02903                     230   2e-72    Eucalyptus grandis [rose gum]
ref|XP_007835687.1|  60S ribosomal protein L15                          231   2e-72    Pestalotiopsis fici W106-1
ref|XP_001212942.1|  60S ribosomal protein L15                          231   3e-72    Aspergillus terreus NIH2624
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  231   3e-72    Trichoderma virens Gv29-8
ref|XP_007741637.1|  60S ribosomal protein L15                          231   3e-72    Cladophialophora psammophila CBS 110553
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      231   4e-72    Candida parapsilosis
ref|XP_008596519.1|  60S ribosomal protein L15                          231   4e-72    Beauveria bassiana ARSEF 2860
ref|XP_004198963.1|  Piso0_002360                                       231   4e-72    
gb|KFY50714.1|  hypothetical protein V496_09238                         231   4e-72    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    230   4e-72    Pyronema omphalodes CBS 100304
gb|KFA61144.1|  hypothetical protein S40285_02203                       230   4e-72    Stachybotrys chlorohalonata IBT 40285
ref|XP_007595397.1|  ribosomal L15                                      230   5e-72    
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  233   5e-72    Botrytis cinerea T4
gb|EFQ32205.1|  ribosomal L15                                           230   6e-72    Colletotrichum graminicola M1.001
tpg|DAA40843.1|  TPA: hypothetical protein ZEAMMB73_797426              229   6e-72    
gb|ELR05722.1|  60S ribosomal protein L15                               230   6e-72    Pseudogymnoascus destructans 20631-21
ref|XP_001245521.1|  60S ribosomal protein L15                          230   6e-72    Coccidioides immitis RS
ref|XP_003709740.1|  60S ribosomal protein L15                          230   6e-72    
gb|KHJ35835.1|  putative 60s ribosomal protein l15                      230   7e-72    
tpg|DAA40844.1|  TPA: hypothetical protein ZEAMMB73_797426              228   7e-72    
ref|XP_003856171.1|  60S ribosomal protein L15                          230   7e-72    
ref|XP_002583622.1|  60S ribosomal protein L15                          230   8e-72    
emb|CDM26463.1|  60S ribosomal protein L15                              230   8e-72    
gb|KFY89477.1|  hypothetical protein V500_05675                         229   1e-71    
ref|XP_001265199.1|  60S ribosomal protein L15                          229   1e-71    
gb|KIW51029.1|  60S ribosomal protein L15                               229   1e-71    
gb|EKG10086.1|  Ribosomal protein L15e                                  229   1e-71    
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         229   1e-71    
ref|XP_004221219.1|  60S ribosomal protein L15-1                        229   2e-71    
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                231   2e-71    
ref|XP_955444.1|  60S ribosomal protein l15                             229   2e-71    
emb|CEP61029.1|  LALA0S02e05138g1_1                                     229   2e-71    
ref|XP_455872.1|  60S ribosomal protein L15                             229   2e-71    
gb|EME46361.1|  hypothetical protein DOTSEDRAFT_70383                   229   2e-71    
gb|KIV77401.1|  60S ribosomal protein L15                               237   2e-71    
emb|CCF76104.1|  unnamed protein product                                228   2e-71    
ref|XP_001388776.1|  60S ribosomal protein L15                          228   3e-71    
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              228   3e-71    
ref|XP_007296945.1|  60S ribosomal protein L15                          228   3e-71    
ref|XP_002553867.1|  60S ribosomal protein L15                          228   3e-71    
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         228   3e-71    
emb|CDO96181.1|  unnamed protein product                                228   3e-71    
ref|XP_006670037.1|  60S ribosomal protein L15                          228   3e-71    
ref|XP_001615040.1|  60S ribosomal protein L15-1                        228   3e-71    
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      228   4e-71    
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  228   4e-71    
gb|EMF14509.1|  ribosomal protein L15e                                  228   4e-71    
dbj|GAM89956.1|  hypothetical protein ANO11243_079960                   228   4e-71    
gb|KIH94692.1|  large subunit ribosomal protein L15e                    228   4e-71    
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  228   5e-71    
gb|KFH46732.1|  60S ribosomal protein-like protein                      228   5e-71    
emb|CCQ18640.1|  60S ribosomal protein L15                              228   5e-71    
ref|XP_007872719.1|  ribosomal L15                                      228   5e-71    
gb|EPS27962.1|  hypothetical protein PDE_02907                          228   5e-71    
ref|XP_008816354.1|  ribosomal L15                                      228   5e-71    
ref|XP_461011.1|  60S ribosomal protein L15                             228   5e-71    
ref|XP_002616462.1|  conserved hypothetical protein                     228   5e-71    
ref|XP_001386507.1|  60S ribosomal protein L15                          228   6e-71    
ref|XP_011414691.1|  PREDICTED: 60S ribosomal protein L15-like          228   6e-71    
ref|XP_004339224.1|  ribosomal L15, putative                            227   6e-71    
gb|KIW64984.1|  60S ribosomal protein L15                               238   6e-71    
ref|XP_002808654.1|  60S ribosomal protein L15, putative                228   7e-71    
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                227   7e-71    
gb|EYE94488.1|  60S ribosomal protein L15                               227   7e-71    
ref|XP_003296271.1|  60S ribosomal protein L15                          228   7e-71    
ref|XP_002258209.1|  ribosomal protein l15                              227   7e-71    
ref|XP_003686547.1|  60S ribosomal protein L15                          227   8e-71    
gb|KEY77864.1|  60S ribosomal protein L15                               227   8e-71    
dbj|BAO40104.1|  60S ribosomal protein L15-B                            227   1e-70    
ref|XP_001484435.1|  60S ribosomal protein L15-A                        227   1e-70    
ref|XP_002561234.1|  Pc16g09160                                         227   1e-70    
ref|XP_004377436.1|  PREDICTED: 60S ribosomal protein L15 isoform 1     227   1e-70    
ref|XP_001820015.1|  60S ribosomal protein L15                          226   1e-70    
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     226   2e-70    
ref|XP_003054429.1|  60S ribosomal protein L15                          226   2e-70    
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             226   2e-70    
gb|ETW38445.1|  hypothetical protein PFTANZ_00876                       226   2e-70    
gb|EOA94531.1|  60S ribosomal protein L15                               226   2e-70    
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               226   2e-70    
gb|KGK38943.1|  hypothetical protein JL09_g1954                         226   2e-70    
gb|EMS53506.1|  60S ribosomal protein L15                               224   2e-70    
ref|XP_005029295.1|  PREDICTED: 60S ribosomal protein L15               226   3e-70    
gb|EQL32630.1|  hypothetical protein BDFG_05175                         236   3e-70    
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             226   3e-70    
gb|KFY33682.1|  hypothetical protein V495_08272                         234   3e-70    
ref|NP_985761.1|  60S ribosomal protein L15                             226   3e-70    
gb|KFX94172.1|  hypothetical protein O988_06437                         234   3e-70    
ref|XP_004199814.1|  Piso0_002360                                       226   3e-70    
gb|EWM27504.1|  Ribosomal protein L15e                                  226   4e-70    
ref|XP_009263009.1|  hypothetical protein FPSE_11617                    225   4e-70    
ref|NP_001080766.1|  ribosomal protein L15                              225   4e-70    
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               225   4e-70    
gb|EJT43462.1|  RPL15B-like protein                                     225   4e-70    
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    225   5e-70    
gb|EJT43834.1|  hypothetical protein SKUD_204406                        225   5e-70    
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    225   5e-70    
gb|KFY44566.1|  hypothetical protein V494_01413                         234   5e-70    
gb|KFH71724.1|  60S ribosomal protein L15                               225   5e-70    
gb|KIL94800.1|  60s ribosomal protein l15                               225   5e-70    
ref|XP_002484013.1|  60S ribosomal protein L15                          225   6e-70    
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    225   6e-70    
ref|XP_009502210.1|  PREDICTED: 60S ribosomal protein L15               225   6e-70    
gb|KDB17596.1|  60S ribosomal protein L15                               234   6e-70    
emb|CCE30070.1|  probable ribosomal protein L15.e.B, cytosolic          233   7e-70    
ref|XP_002150249.1|  60S ribosomal protein L15                          225   7e-70    
gb|KFO70740.1|  60S ribosomal protein L15                               225   7e-70    
ref|XP_002836891.1|  60S ribosomal protein L15                          225   7e-70    
gb|KFY08345.1|  hypothetical protein V492_06315                         233   7e-70    
gb|EMG48668.1|  Ribosomal protein L15                                   225   7e-70    
gb|EMT61608.1|  60S ribosomal protein L15                               224   7e-70    
ref|NP_001292094.1|  60S ribosomal protein L15                          224   8e-70    
gb|KFZ12787.1|  hypothetical protein V502_06922                         233   8e-70    
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      224   8e-70    
gb|AAS59857.1|  ribosomal protein L15                                   224   8e-70    
gb|AJS80338.1|  Rpl15bp                                                 224   8e-70    
sp|Q7T2N4.3|RL15_SILME  RecName: Full=60S ribosomal protein L15         224   8e-70    
emb|CEI91883.1|  Putative Ribosomal protein L15                         224   9e-70    
ref|NP_001003447.1|  60S ribosomal protein L15                          224   9e-70    
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         224   9e-70    
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        224   1e-69    
gb|EIE79210.1|  60S ribosomal protein L15                               224   1e-69    
ref|XP_003678734.1|  60S ribosomal protein L15                          224   1e-69    
ref|XP_007344080.1|  60S ribosomal protein L15                          224   1e-69    
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        224   1e-69    
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          224   1e-69    
dbj|GAM38142.1|  60S ribosomal protein                                  224   1e-69    
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               224   1e-69    
ref|NP_001266930.1|  60S ribosomal protein L15                          224   1e-69    
gb|KIW22669.1|  60S ribosomal protein L15                               233   1e-69    
ref|NP_079862.1|  60S ribosomal protein L15                             224   1e-69    
ref|XP_003025216.1|  hypothetical protein TRV_00621                     224   1e-69    
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               224   1e-69    
ref|XP_004832605.1|  60S ribosomal protein L15, putative                224   1e-69    
gb|ADO28804.1|  60S ribosomal protein l15                               224   1e-69    
gb|AAV38477.1|  ribosomal protein L15                                   224   1e-69    
emb|CAH91644.1|  hypothetical protein                                   224   1e-69    
emb|CAJ82575.1|  ribosomal protein L15                                  224   1e-69    
gb|EHN00844.1|  Rpl15bp                                                 224   1e-69    
gb|EUD70551.1|  ribosomal L15                                           224   2e-69    
ref|XP_009937095.1|  PREDICTED: 60S ribosomal protein L15               224   2e-69    
gb|EHN05368.1|  Rpl15bp                                                 224   2e-69    
gb|AAN52373.1|  ribosomal protein L15                                   224   2e-69    
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               224   2e-69    
gb|AAH30575.1|  Similar to RIKEN cDNA 2510008H07 gene                   224   2e-69    
dbj|GAA24916.1|  K7_Rpl15ap                                             224   2e-69    
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    224   2e-69    
gb|KFR14077.1|  60S ribosomal protein L15                               224   2e-69    
gb|EHN01315.1|  Rpl15bp                                                 223   2e-69    
gb|AJS78588.1|  Rpl15bp                                                 223   2e-69    
ref|XP_009657767.1|  60S ribosomal protein L15-B                        223   2e-69    
ref|XP_011227834.1|  PREDICTED: 60S ribosomal protein L15               223   2e-69    
gb|ETE59074.1|  60S ribosomal protein L15                               223   2e-69    
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  223   2e-69    
ref|XP_004991174.1|  ribosomal protein L15                              223   3e-69    
gb|EGA57755.1|  Rpl15ap                                                 223   3e-69    
gb|EXL86692.1|  60S ribosomal protein L15                               225   3e-69    
gb|EWG89405.1|  Rpl15bp                                                 223   3e-69    
ref|XP_002491583.1|  60S ribosomal protein L15                          223   3e-69    
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         223   3e-69    
ref|XP_007762548.1|  ribosomal protein L15e                             223   3e-69    
gb|EWG84044.1|  Rpl15bp                                                 223   3e-69    
ref|NP_001187212.1|  60S ribosomal protein L15                          223   3e-69    
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               223   3e-69    
gb|KFP76634.1|  60S ribosomal protein L15                               223   3e-69    
gb|AGH70163.1|  60S ribosomal protein L15                               223   4e-69    
ref|XP_005040971.1|  PREDICTED: 60S ribosomal protein L15               223   4e-69    
gb|EGA77362.1|  Rpl15bp                                                 223   4e-69    
ref|XP_009887238.1|  PREDICTED: 60S ribosomal protein L15               223   4e-69    
ref|XP_444915.1|  60S ribosomal protein L15                             223   4e-69    
gb|AAG44837.1|  60S ribosomal protein L15                               223   4e-69    
emb|CEP13977.1|  hypothetical protein                                   223   4e-69    
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               223   4e-69    
ref|XP_001269695.1|  60S ribosomal protein L15                          223   4e-69    
dbj|BAE31437.1|  unnamed protein product                                223   4e-69    
gb|KFO06064.1|  60S ribosomal protein L15                               223   4e-69    
gb|KFM13801.1|  60S ribosomal protein L15                               223   4e-69    
ref|XP_010136517.1|  PREDICTED: 60S ribosomal protein L15               223   4e-69    
gb|KGL96424.1|  60S ribosomal protein L15                               223   5e-69    
ref|XP_008936743.1|  PREDICTED: 60S ribosomal protein L15               223   5e-69    
gb|EGU81126.1|  hypothetical protein FOXB_08400                         224   5e-69    
ref|XP_006635829.1|  PREDICTED: 60S ribosomal protein L15-like          223   5e-69    
gb|AAH14837.1|  Ribosomal protein L15                                   223   5e-69    
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         223   5e-69    
gb|AAX36167.1|  ribosomal protein L15                                   223   5e-69    
emb|CEG70134.1|  Putative Ribosomal protein L15                         223   5e-69    
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               223   5e-69    
gb|EIF48674.1|  60s ribosomal protein l15-b                             223   5e-69    
gb|KIY71642.1|  ribosomal protein L15e                                  223   5e-69    
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         223   5e-69    
gb|EWZ51470.1|  60S ribosomal protein L15                               224   6e-69    
gb|AJS76851.1|  Rpl15bp                                                 223   6e-69    
gb|EXK95810.1|  60S ribosomal protein L15                               224   6e-69    
ref|XP_011104444.1|  rpl15ap                                            222   6e-69    
ref|XP_002108683.1|  expressed hypothetical protein                     222   6e-69    
gb|AJS94717.1|  Rpl15bp                                                 222   7e-69    
ref|XP_003455275.1|  PREDICTED: 60S ribosomal protein L15-like is...    222   7e-69    
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  222   8e-69    
dbj|BAB79461.1|  ribosomal protein L15                                  222   8e-69    
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    222   9e-69    
gb|AAX43023.1|  ribosomal protein L15                                   222   9e-69    
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    222   9e-69    
gb|AJS95152.1|  Rpl15bp                                                 222   1e-68    
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              222   1e-68    
gb|AJS62423.1|  Rpl15bp                                                 222   1e-68    
ref|XP_007378639.1|  60S ribosomal protein L15                          222   1e-68    
pdb|1S1I|L  Chain L, Structure Of The Ribosomal 80s-Eef2-Sordarin...    222   1e-68    
sp|P61369.2|RL15_SILAS  RecName: Full=60S ribosomal protein L15         222   1e-68    
gb|KIM66174.1|  hypothetical protein SCLCIDRAFT_1211398                 221   1e-68    
gb|AAX08723.1|  ribosomal protein L15                                   222   1e-68    
ref|NP_001011478.1|  ribosomal protein L15                              221   1e-68    
gb|AJS74671.1|  Rpl15bp                                                 221   1e-68    
emb|CAG00252.1|  unnamed protein product                                221   1e-68    
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         221   1e-68    
ref|XP_011115334.1|  hypothetical protein H072_9785                     221   1e-68    
dbj|BAB27107.1|  unnamed protein product                                221   1e-68    
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          221   1e-68    
ref|XP_004179266.1|  hypothetical protein TBLA_0B09300                  221   1e-68    
gb|AFJ91723.1|  60S ribosomal protein L15                               221   2e-68    
gb|AAN73345.1|  ribosomal protein L15                                   221   2e-68    
sp|P61367.2|RL15_EPICO  RecName: Full=60S ribosomal protein L15         221   2e-68    
ref|XP_008626096.1|  ribosomal L15                                      221   2e-68    
gb|EGA61325.1|  Rpl15ap                                                 221   2e-68    
ref|XP_002771940.1|  60S ribosomal protein L15, putative                221   2e-68    
gb|ETB56610.1|  hypothetical protein YYC_05449                          221   2e-68    
ref|XP_625397.1|  60S ribosomal protein L15                             221   2e-68    
ref|NP_001232361.1|  putative 60S ribosomal protein L10                 221   3e-68    
gb|EPB89957.1|  60S ribosomal protein L15                               221   3e-68    
gb|EKV11308.1|  hypothetical protein PDIG_51450                         230   3e-68    
gb|EPB90299.1|  60S ribosomal protein L15                               221   3e-68    
ref|XP_007695684.1|  hypothetical protein COCSADRAFT_133030             221   3e-68    
gb|KIK28524.1|  hypothetical protein PISMIDRAFT_673552                  221   3e-68    
ref|XP_008630208.1|  PREDICTED: 60S ribosomal protein L15               221   3e-68    
ref|XP_006005298.1|  PREDICTED: 60S ribosomal protein L15               221   3e-68    
pdb|3JYW|L  Chain L, Structure Of The 60s Proteins For Eukaryotic...    220   3e-68    
ref|XP_007713002.1|  hypothetical protein COCCADRAFT_97949              220   3e-68    
emb|CDR41295.1|  CYFA0S07e00386g1_1                                     221   3e-68    
gb|EDL26238.1|  mCG16398                                                221   3e-68    
gb|KIO08255.1|  hypothetical protein M404DRAFT_997181                   220   3e-68    



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/185 (97%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  133  ILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D+AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  133  ILIDSAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   322 bits (824),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHA IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  133  ILVDQAHAGIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   317 bits (812),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   317 bits (811),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+YRVRVRRGGRK
Sbjct  12   KKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVIYRVRVRRGGRK  71

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  72   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  131

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  132  ILVDPAHAAIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  191

Query  184  KRNQT  170
            KRNQT
Sbjct  192  KRNQT  196



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  31   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  90

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFEV
Sbjct  91   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEV  150

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  151  ILIDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  210

Query  184  KRNQT  170
            KRNQT
Sbjct  211  KRNQT  215



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   315 bits (807),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/185 (95%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  48   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  107

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFEV
Sbjct  108  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEV  167

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  168  ILVDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  227

Query  184  KRNQT  170
            KRNQT
Sbjct  228  KRNQT  232



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   314 bits (804),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLH+KA PSRRA W
Sbjct  133  ILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHNKAPPSRRANW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   314 bits (804),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   314 bits (804),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   314 bits (804),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNTT  197



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF  RVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   RKQSDVMRFTQRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH AIRNDPR+NW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL+HKARPSRRATW
Sbjct  133  ILVDTAHNAIRNDPRVNWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  39   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  98

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  99   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  158

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  159  ILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  218

Query  184  KRNQT  170
            KRN T
Sbjct  219  KRNNT  223



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   313 bits (802),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRR TW
Sbjct  133  ILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRGTW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  15   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  74

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  75   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  134

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  135  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  194

Query  184  KRNQT  170
            KRN T
Sbjct  195  KRNNT  199



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  82   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  141

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  142  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  201

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  202  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  261

Query  184  KRNQT  170
            KRNQT
Sbjct  262  KRNQT  266



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH  IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHLHHK RPSRRATW
Sbjct  133  ILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   313 bits (801),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRR TW
Sbjct  133  ILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRGTW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+LR+RCWEYRQLP++VR+TRPTRPDKA RLGYKAKQGYV+YRVRVRRGGRK
Sbjct  12   KKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVIYRVRVRRGGRK  71

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EV
Sbjct  72   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEV  131

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AHA +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  132  ILIDPAHAVVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  191

Query  184  KRNQT  170
            KRNQT
Sbjct  192  KRNQT  196



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+LRVRCWEYRQLPSIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   RKQSDVMRFVLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH A+RN+PRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHL+HK RPSRRATW
Sbjct  133  ILVDTAHNAVRNNPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   311 bits (798),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 177/185 (96%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   311 bits (796),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            HAAIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRINWLCQPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  179



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   311 bits (797),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHLHHK RPSRRATW
Sbjct  133  ILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   312 bits (800),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 176/185 (95%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYR+RVRRGGRK
Sbjct  37   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRIRVRRGGRK  96

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  97   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  156

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW
Sbjct  157  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  216

Query  184  KRNQT  170
            KRNQT
Sbjct  217  KRNQT  221



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICNGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  45   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  104

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  105  RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEV  164

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATW
Sbjct  165  IMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATW  224

Query  184  KRNQT  170
            KRN T
Sbjct  225  KRNTT  229



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/185 (95%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLC+PVHKHRELRGLTSAGKKYRGLRGRGHLHHK RPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWLCDPVHKHRELRGLTSAGKKYRGLRGRGHLHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            +LVD AHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HKARPSRRATW
Sbjct  133  VLVDVAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  44   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  103

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  104  RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEV  163

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATW
Sbjct  164  IMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATW  223

Query  184  KRNQT  170
            KRN T
Sbjct  224  KRNTT  228



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
 gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii]
Length=204

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRA W
Sbjct  133  ILVDTAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii]
Length=204

 Score =   309 bits (791),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   309 bits (791),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAVRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YR+RVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   308 bits (789),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   308 bits (789),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/185 (95%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPV KHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVQKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDVAHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL R+RCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRIRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGI+YGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            HAAIRNDPRI+W+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HAAIRNDPRIHWICEPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARCLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNTT  197



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARR+GYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLC PVHKHRELRGLTS+GKKYRGLRG+GHLHHK RPSRR TW
Sbjct  133  ILVDVAHNAIRNDPRINWLCKPVHKHRELRGLTSSGKKYRGLRGKGHLHHKNRPSRRGTW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   307 bits (787),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  23   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  82

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  83   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  142

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  143  ILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  202

Query  184  KRNQT  170
            KRN T
Sbjct  203  KRNNT  207



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   306 bits (785),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLP+IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNTIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   306 bits (784),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  15   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  74

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+
Sbjct  75   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEI  134

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  135  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATW  194

Query  184  KRNQT  170
            KRN T
Sbjct  195  KRNNT  199



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDPAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRG+GHL+HK RPSRRATW
Sbjct  133  IMVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            +LVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATW
Sbjct  133  VLVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGL G+GHLHHKARPSRRA W
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IR DPRI+WLCNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDVAHTTIRRDPRISWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN +
Sbjct  193  KRNNS  197



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH+AIRNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  133  ILVDTAHSAIRNDPRVNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRI W+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRIKWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE 
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFED  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH AIRNDPRINW+C PVHKHRELRGLT AGKKYRGLRGRGHLHHKARPSRRA W
Sbjct  133  ILVDTAHNAIRNDPRINWICKPVHKHRELRGLTFAGKKYRGLRGRGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   304 bits (779),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 173/185 (94%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPD+ARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  50   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDRARRLGYKAKQGYVIYRVRVRRGGRK  109

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW NEDSTYKYFEV
Sbjct  110  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWTNEDSTYKYFEV  169

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWL  PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  170  ILVDVAHNAIRNDPRINWLSKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  229

Query  184  KRNQT  170
            KRN T
Sbjct  230  KRNNT  234



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   304 bits (778),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN +
Sbjct  193  KRNNS  197



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+  PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWITKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYWVNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATW
Sbjct  133  ILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  133  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYR+RVRRGGRK
Sbjct  13   KKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGL G+GHL+HKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLGGKGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINWL NPVHKHRELRGLTSAGK  RGLRGRGHL+HKARPSRRATW
Sbjct  133  ILVDVAHAAIRNDPRINWLANPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D AH AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILIDPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  22   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  81

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  82   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  141

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  142  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  201

Query  184  KRNQT  170
            KRNQT
Sbjct  202  KRNQT  206



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATW
Sbjct  133  ILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATW
Sbjct  133  ILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=204

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSI+RV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIIRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   301 bits (771),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ PSIVRVT PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDVA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WKRN T
Sbjct  121  HNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRNNT  179



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GHL HK RPSRRATW
Sbjct  133  ILVDPAHKAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHLFHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   301 bits (772),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  133  ILVDPAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB39739.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=204

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATW
Sbjct  133  ILVDVAHTAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   301 bits (771),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQG+VVYR+RV+RGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFVVYRIRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  133  ILVDVAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN +
Sbjct  193  KRNNS  197



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   301 bits (771),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVRVTRPTRPD+ARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDRARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D +H+AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILLDPSHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   301 bits (771),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVRVTRPTRPDKAR LGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARLLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRS RSVAEERAGRKL GLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGLRG+GHL+HKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLRGKGHLYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNTT  197



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   301 bits (770),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            K+QSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQG VVYRVRVRRGGRK
Sbjct  6    KRQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGIVVYRVRVRRGGRK  65

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EV
Sbjct  66   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEV  125

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVDTAH+A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  126  ILVDTAHSAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  185

Query  184  KRNQT  170
            KRN T
Sbjct  186  KRNNT  190



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLPSIVR TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  42   KKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  101

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EV
Sbjct  102  RPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEV  161

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HK RPSRRATW
Sbjct  162  ILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATW  221

Query  184  KRNQT  170
            KRN T
Sbjct  222  KRNNT  226



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD+MRF+ RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTY YFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYXYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRND RIN LCNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARPSRRATW
Sbjct  133  ILVDVAHNAIRNDARINXLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRATW  192

Query  184  KRN  176
            KRN
Sbjct  193  KRN  195



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQ+P+IVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQMPAIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWVNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD A  AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  133  ILVDGALNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  15   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  74

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  75   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  134

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL+HK RPSRRATW
Sbjct  135  ILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRATW  194

Query  184  KRNQT  170
            KRN T
Sbjct  195  KRNNT  199



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL+HK RPSRRATW
Sbjct  133  ILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATW  192

Query  184  KRN  176
            KRN
Sbjct  193  KRN  195



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL+HK RPSRRATW
Sbjct  133  ILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  186  RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  245

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  246  RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  305

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  306  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  365

Query  184  KRNQT  170
            KRNQT
Sbjct  366  KRNQT  370



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   299 bits (766),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHKAIKTDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   305 bits (781),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  186  RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  245

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  246  RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  305

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  306  ILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATW  365

Query  184  KRNQT  170
            KRNQT
Sbjct  366  KRNQT  370



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   299 bits (765),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWE+RQLP IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIR DPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL+HKARPS+RATW
Sbjct  133  ILVDQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   298 bits (764),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ R+RCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRMRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIR DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTAIRKDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQLP IVR+T PTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            +LVD AH  IRNDPRINW+CN VHKHRELRGLTSAGKKYRGLRGRGHL+HKARPS+RATW
Sbjct  133  VLVDQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   298 bits (762),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDAA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+C  VHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQT
Sbjct  121  HNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT  179



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHTAIKTDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-1 [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVM F+ RVRCW+YRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMGFVQRVRCWDYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV
Sbjct  73   RPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+ I+ DPRINW+ NPVHKHRELRGLTSAGKKYRGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDVAHSVIKKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGKGHRYHKNRPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA W
Sbjct  133  ILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEV
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA W
Sbjct  133  ILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLCNPVHKHREL G TSAGK  RGL G+GH HHKARPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRINWLCNPVHKHRELTGKTSAGKHNRGLVGKGHRHHKARPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATW
Sbjct  133  ILVDVAHNAVRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGQRHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   294 bits (753),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ PSIVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDVA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  61   KKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  120

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEV
Sbjct  121  RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEV  180

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH +HKARPSRRA W
Sbjct  181  ILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRANW  240

Query  184  KRNQT  170
            KRN T
Sbjct  241  KRNNT  245



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ  SIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  25   KKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  84

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFEV
Sbjct  85   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFEV  144

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH +HK RPSRRATW
Sbjct  145  ILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRATW  204

Query  184  KRNQT  170
            KRN T
Sbjct  205  KRNNT  209



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   293 bits (751),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H+AIRNDPRINWLC PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRNQT
Sbjct  121  HSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNQT  179



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   293 bits (750),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILVDAA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H  IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATWKRN T
Sbjct  121  HNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRNNT  179



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AHAAIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATW
Sbjct  133  ILVDVAHAAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   293 bits (750),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ PSIV  TRPTRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILVDAA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT  179



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  HA IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATW
Sbjct  133  ILVDPQHAVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYV+YR+RVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NED TYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDFTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  133  ILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  25   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  84

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  85   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  144

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  145  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  204

Query  184  KRNQT  170
            K+N +
Sbjct  205  KKNNS  209



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINWLC  VHKHRELRGLTSAGKKYRGLRG+G  HHK RPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSAHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATW
Sbjct  133  ILVDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   291 bits (746),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D  H  IR DPRINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATW
Sbjct  133  ILIDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   291 bits (745),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   291 bits (744),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+
Sbjct  73   RPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILV  AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW
Sbjct  133  ILVGIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATW  192

Query  184  KRNQT  170
            +RN +
Sbjct  193  RRNNS  197



>gb|KJB39740.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=186

 Score =   290 bits (743),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRFL RVRCWEYRQ P+IVRV  PTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN T
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRNNT  179



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   290 bits (743),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATWKRNQT
Sbjct  121  HTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT  179



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  84   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  143

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  144  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  203

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  204  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATW  263

Query  184  KRNQT  170
            K+N +
Sbjct  264  KKNNS  268



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQGYVVYR+RVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYVVYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  73   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+G  HHK RPSRRATW
Sbjct  133  ILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGTRHHKNRPSRRATW  192

Query  184  KRNQT  170
            KRNQT
Sbjct  193  KRNQT  197



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  83   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  142

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  143  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  202

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  203  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATW  262

Query  184  KRNQT  170
            K+N +
Sbjct  263  KKNNS  267



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR L R RCWEYRQ  SIVRVTRPTRPDKARRLG+KAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRCLQRWRCWEYRQQSSIVRVTRPTRPDKARRLGFKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWMNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPR+NW+CNPVHKHRELRGLTSAGK+ RGL+G+GH +HKARPSRRATW
Sbjct  133  ILVDVAHTAIRNDPRVNWVCNPVHKHRELRGLTSAGKQNRGLQGKGHRYHKARPSRRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  46   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  105

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  106  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  165

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  166  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  225

Query  184  KRNQT  170
            K+N +
Sbjct  226  KKNNS  230



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  48   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  107

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  108  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  167

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  168  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  227

Query  184  KRNQT  170
            K+N +
Sbjct  228  KKNNS  232



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPD+ARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDRARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N +
Sbjct  193  KKNNS  197



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   291 bits (744),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  69   KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  128

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  129  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  188

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  189  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  248

Query  184  KRNQT  170
            K+N +
Sbjct  249  KKNNS  253



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   288 bits (738),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLP IVRVTRP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H  IR D RINW+ NPVHKHRELRGLTSAGKKYRGLRGRGHL+ KARPS RATW
Sbjct  133  ILVDPQHTVIRKDSRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR L RVRCW+YRQ PSIVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRHLQRVRCWDYRQQPSIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  133  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  192

Query  184  KRNQT  170
            K+N T
Sbjct  193  KKNNT  197



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  127  KKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRK  186

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+
Sbjct  187  RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEI  246

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATW
Sbjct  247  ILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATW  306

Query  184  KRNQT  170
            K+N +
Sbjct  307  KKNNS  311



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  721  KQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkr  542
            KQSDVMRFL RVRCWEYRQ PSIVR+TRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR
Sbjct  8    KQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR  67

Query  541  pvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  362
            PV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+I
Sbjct  68   PVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEII  127

Query  361  LVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            LVD AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW
Sbjct  128  LVDIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATW  186



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 171/185 (92%), Gaps = 9/185 (5%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+         DSTYKYFEV
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK---------DSTYKYFEV  123

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRG+GHLHHKARPSRRATW
Sbjct  124  ILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATW  183

Query  184  KRNQT  170
            KRNQT
Sbjct  184  KRNQT  188



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH +HK RPS RATW
Sbjct  133  ILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRATW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 160/202 (79%), Gaps = 17/202 (8%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPD+ARRLG+KAKQ   +      +  R 
Sbjct  60   RKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQILFLCDSYTLKYVRI  119

Query  544  rpvpkG-----------------IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  416
                                   IVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRV
Sbjct  120  YAGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRV  179

Query  415  LNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR  236
            LNSYW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLR
Sbjct  180  LNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLR  239

Query  235  GRGHLHHKARPSRRATWKRNQT  170
            G+GH HHK RPSRRATWKRNQT
Sbjct  240  GKGHRHHKNRPSRRATWKRNQT  261



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   281 bits (719),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR L R+R +EYR  PSIVRVT PT PDKA RLGYKAKQGYVVYRVRV+RGGRK
Sbjct  13   KKQSDVMRALQRLRAFEYRHQPSIVRVTHPTCPDKAHRLGYKAKQGYVVYRVRVKRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKPTNQGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW+NEDSTYKYFEV
Sbjct  73   RPVAKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYWVNEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHKARPSRRA W
Sbjct  133  ILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLCGKGHLHHKARPSRRANW  192

Query  184  KRNQT  170
            K N T
Sbjct  193  KSNNT  197



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL+RVRCWEYRQLP IVR+ RPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            IL+D  H AIR DPRINW+C PVHKHRELRG+TSAG+K+RGLRG+GH +HK RPS R TW
Sbjct  133  ILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRGTW  192

Query  184  KRNQT  170
            KRN T
Sbjct  193  KRNNT  197



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKNNS  179



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  706  MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkrpvpkG  527
            MRF+ RVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQG+VVYRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNS  179



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 176/219 (80%), Gaps = 34/219 (16%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+IVR+TRPTRPDKARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINE---------  392
            RPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NE         
Sbjct  73   RPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEVCWILWRNF  132

Query  391  -------------------------DSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKH  287
                                     DSTYKYFE+ILVD AHAAIRNDPRINWLC  VHKH
Sbjct  133  LLEGSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHKH  192

Query  286  RELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            RELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRNQT
Sbjct  193  RELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRNQT  231



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLPSIVR+TRP+RPDKARRLGYKAKQG+VVYRVRVRRG RK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPSIVRLTRPSRPDKARRLGYKAKQGFVVYRVRVRRGNRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLK  R+ RSVAEER GRK GGLRVLNSYW+N+DS YKYFEV
Sbjct  73   RPVHKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYWVNQDSCYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IRND RINWLCNPVHKHRELRGLTSAGK YRGLR +GH   K RPS+RA+W
Sbjct  133  ILVDPAHTTIRNDARINWLCNPVHKHRELRGLTSAGKHYRGLRAKGHKASKTRPSKRASW  192

Query  184  KRNQT  170
            KR  +
Sbjct  193  KRRNS  197



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   271 bits (692),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 170/193 (88%), Gaps = 8/193 (4%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR L RVRCW YRQ PSIVR+TRPTRPD+ARRLG+KAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRHLQRVRCWNYRQQPSIVRLTRPTRPDEARRLGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRS +EERAGRKLGGLR LNSYWINEDSTYKY+E+
Sbjct  73   RPVPKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYWINEDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKH--------RELRGLTSAGKKYRGLRGRGHLHHKA  209
            ILVD AH A+ NDPRINW+CNPVHKH        RELRGLTS GKK +GLRG+GH ++K 
Sbjct  133  ILVDLAHNAVSNDPRINWICNPVHKHQLRSSSHNRELRGLTSEGKKNKGLRGKGHNNNKN  192

Query  208  RPSRRATWKRNQT  170
            RPSRRATWK N T
Sbjct  193  RPSRRATWKNNNT  205



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE+RQLP IVR+TRP+RPDKARR+G+KAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEFRQLPGIVRLTRPSRPDKARRMGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KGIVYGKP +QGVTQLK  R+ +++AEER GRK GGLRVLNSYW+N+D+ YKYFEV
Sbjct  73   KPVSKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYWVNQDAVYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH AIR D R+NW+CNPVHKHRE RGLTSAGKKYRGL G+GHLHHKARPSRRA W
Sbjct  133  ILVDPAHKAIRKDARVNWICNPVHKHREQRGLTSAGKKYRGLVGKGHLHHKARPSRRAVW  192

Query  184  KRNQT  170
            ++N +
Sbjct  193  RKNNS  197



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWEYRQLP IVR+T P+RPDKARRLGYKAKQG+VVYRVRVRRGGRK
Sbjct  13   RKQSDVLRFLLRVRCWEYRQLPGIVRLTGPSRPDKARRLGYKAKQGFVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KGIVYGKP NQG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW+N+DSTYKYFE+
Sbjct  73   KPVHKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYWVNQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  +R DPR+NW+ +PVHKHRELRGLTSAGKK+RGLR +GH  +K RPSRRATW
Sbjct  133  ILVDIAHKVVREDPRVNWIVDPVHKHRELRGLTSAGKKFRGLRHKGHATNKLRPSRRATW  192

Query  184  KRN  176
            KRN
Sbjct  193  KRN  195



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   269 bits (687),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQ+PS VR+TRP+RPDKARRLGYKAKQGYVVYRVRVRRG RK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQMPSCVRLTRPSRPDKARRLGYKAKQGYVVYRVRVRRGNRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW+N+DS YKYFEV
Sbjct  73   RPVHKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYWVNQDSCYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD AH AIRND RINWLCNPVHKHRELRGLT+AGK YRGLR +GH   K RPS+RA+W
Sbjct  133  IMVDPAHNAIRNDARINWLCNPVHKHRELRGLTAAGKNYRGLRAKGHKASKTRPSKRASW  192

Query  184  KRNQT  170
            KR  +
Sbjct  193  KRRNS  197



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYR  P+IVR+TRP RPD+ARRLG+KAKQGYVVYR+RVRRGGRK
Sbjct  70   RKQSDVMRFVQRVRCWEYRLQPAIVRITRPPRPDRARRLGFKAKQGYVVYRIRVRRGGRK  129

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  130  RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  189

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  190  ILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATW  249

Query  184  KRNQT  170
            KRNQT
Sbjct  250  KRNQT  254



>ref|XP_011401241.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
 gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQLPSIVR+T PTRPDKARR+GYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQLPSIVRLTGPTRPDKARRMGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PVPKGIVYGKP NQG+TQLK  R+  ++AEER GRK GGLRVLNSYW+N+D+ YKYFEV
Sbjct  73   KPVPKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYWVNQDAVYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIRND RINW+ NPVHKHRELRGLTSAGKKYRGL G+GHLH K RPSRRA W
Sbjct  133  ILVDPFHKAIRNDARINWIANPVHKHRELRGLTSAGKKYRGLTGKGHLHTKNRPSRRAVW  192

Query  184  KRNQ  173
            K+N 
Sbjct  193  KKNN  196



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V+YR RVRRGGRK
Sbjct  13   KKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFVIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YKY+EV
Sbjct  73   RPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD  H  IRNDPRINW+CNP HKHRE+RGLTSAG+KYRGLRG+GH + K+RPS+RATW
Sbjct  133  IMVDPMHKCIRNDPRINWICNPTHKHREMRGLTSAGRKYRGLRGKGHNYTKSRPSKRATW  192

Query  184  KRNQ  173
            + N 
Sbjct  193  RNNN  196



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFL RVR WEYRQLPS+ RVTRPTRPDKARRLGYKAKQG+ VYR RVRRGGRK
Sbjct  13   KKQSDVLRFLQRVRVWEYRQLPSVCRVTRPTRPDKARRLGYKAKQGFCVYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGI YGKP +QGV +LKF R+ RSVAEER  R+ G LRVLNSYW+NEDS YKY+EV
Sbjct  73   RPVSKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYWLNEDSVYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD  H  IR DPRINW+C PVHKHRELRGLTSAG+KYRGL+G+GH ++K+RPS+R TW
Sbjct  133  IMVDPMHKVIRGDPRINWICAPVHKHRELRGLTSAGRKYRGLQGKGHNYNKSRPSKRGTW  192

Query  184  KRNQ  173
            KRNQ
Sbjct  193  KRNQ  196



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWE+RQLP IVRVT    PDKARRLGY+  +              +
Sbjct  13   RKQSDVLRFLLRVRCWEFRQLPGIVRVT-AQPPDKARRLGYRPSRVTWCTVCVCAVEAGR  71

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
               P+ +   KP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+
Sbjct  72   GRWPRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEI  131

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H  IR DPRINW+ NPVHKHR++RGLTSAGKKYRGLRGRGHL+ KARPS RATW
Sbjct  132  ILVDPQHKVIRKDPRINWIVNPVHKHRDVRGLTSAGKKYRGLRGRGHLYTKARPSIRATW  191

Query  184  KRNQT  170
            KRN T
Sbjct  192  KRNNT  196



>gb|KCW90850.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=183

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 147/185 (79%), Gaps = 21/185 (11%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ PSI  V    R  +                      GRK
Sbjct  13   KKQSDVMRFLQRVRCWEYRQHPSIGYVVYRVRVRRG---------------------GRK  51

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFEV
Sbjct  52   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFEV  111

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GH HHKARPSRRATW
Sbjct  112  ILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRATW  171

Query  184  KRNQT  170
            KRN +
Sbjct  172  KRNNS  176



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+ +YR RVRRGGRK
Sbjct  13   KKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFCIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YKY+EV
Sbjct  73   RPVAKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD  H  +RNDPRINW+CNP HKHRE+RGLTSAG+KYRGL G+GH   K+RPS+RATW
Sbjct  133  IMVDPMHKCVRNDPRINWICNPTHKHREMRGLTSAGRKYRGLHGKGHNFTKSRPSKRATW  192

Query  184  KRNQ  173
            + N 
Sbjct  193  RNNN  196



>gb|EMT18644.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=183

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 148/185 (80%), Gaps = 21/185 (11%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRF+ RVRCWEYRQ P+I  V    R    RR G K                  
Sbjct  13   RKQSDVMRFVQRVRCWEYRQQPAIGYVVYRIR---VRRGGRK------------------  51

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEV
Sbjct  52   RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEV  111

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHK RPSRRATW
Sbjct  112  ILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATW  171

Query  184  KRNQT  170
            KRNQT
Sbjct  172  KRNQT  176



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE+RQLP IVR+T P+RPDKARR+GYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWEFRQLPRIVRLTGPSRPDKARRMGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KGIVYGKP NQG+TQLK +R+ ++++E R GR   GLRVLNSYW+N+D+++KY+EV
Sbjct  73   KPVAKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYWVNQDASHKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD AH  IRNDP INW+CNPVHKHRE  GLTSAGKK+RGL G+GH H  ARPSRRATW
Sbjct  133  IMVDPAHTVIRNDPHINWICNPVHKHREGHGLTSAGKKHRGLGGKGHGHVHARPSRRATW  192

Query  184  KRNQ  173
            +RNQ
Sbjct  193  RRNQ  196



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93479.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 165/186 (89%), Gaps = 2/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFL+R+RCW+YRQLP+I R +RPTRPDKARRLGYKAKQGYV+YR+R+RRGGRK
Sbjct  13   KKQSDVLRFLVRLRCWQYRQLPAIHRASRPTRPDKARRLGYKAKQGYVIYRIRLRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYWI +DST+KY+EV
Sbjct  73   RPVFKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYWICQDSTFKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHK-ARPSRRAT  188
            I+VDTAH AIR DPRINW+C  VHKHRELRGLT+AG+K+RG+ G+GHLH+K A  SRRA 
Sbjct  133  IMVDTAHKAIRRDPRINWICENVHKHRELRGLTAAGRKHRGV-GKGHLHNKTAGSSRRAN  191

Query  187  WKRNQT  170
            WKR  T
Sbjct  192  WKRRNT  197



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -3

Query  721  KQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrkr  542
            KQSDVMRF+LRVR WEYRQLPSI R +RPTRP+KARRLGYK+KQG+VVYRVRVRRGGRKR
Sbjct  26   KQSDVMRFMLRVRAWEYRQLPSIHRASRPTRPEKARRLGYKSKQGFVVYRVRVRRGGRKR  85

Query  541  pvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  362
            PV KGI YGKP +QG+T+LKF+R+KR+VAEERAGR+ G LRVLNSYW+NED+ YKYFE+I
Sbjct  86   PVKKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLRVLNSYWVNEDAAYKYFEII  145

Query  361  LVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  182
            LVD +H AIRNDPR+NWL  PV KHRELRGLT+AG+K RGL  RGH  +  RPS RA WK
Sbjct  146  LVDPSHNAIRNDPRLNWLARPVMKHRELRGLTAAGRKGRGLHVRGHRANSTRPSVRAVWK  205

Query  181  RNQT  170
            ++ T
Sbjct  206  KHNT  209



>gb|ACU45020.1| 60s ribosomal protein L15 [Pfiesteria piscicida]
Length=204

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLR+RCWE R LP + R TRPTRPDKARRLGYKAKQGYV+YR RVRRGGRK
Sbjct  13   RKQSDVLRFLLRIRCWELRHLPRVHRATRPTRPDKARRLGYKAKQGYVIYRSRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            + V KG   GKP +QGV  LKFQRSK SVAEER GR  G LRVLNSYW+N+DST+KY+EV
Sbjct  73   KRVAKGNTDGKPKHQGVNHLKFQRSKASVAEERVGRVCGNLRVLNSYWVNQDSTFKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I VD +H AIRNDPRINW+  PVHKHRELRGLTSAGKK RGL GRG  + K RPSRRA W
Sbjct  133  ICVDPSHNAIRNDPRINWITKPVHKHRELRGLTSAGKKNRGLVGRGRRYQKNRPSRRAVW  192

Query  184  KRNQT  170
            K+N T
Sbjct  193  KKNNT  197



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRG RK
Sbjct  13   KKQSDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGNRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP  KG  YGKPTNQG+ QLK QRS R+VAEER GR+ G LRVLNSYW+N+DSTYKYFEV
Sbjct  73   RPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYWVNQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD +H  IRNDPRINW+CNPVHKHRE RGLT+AGKK RG+  +GH +H     RR TW
Sbjct  133  ILVDPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGI-NKGHKYHNTSAGRRHTW  191

Query  184  KRNQT  170
            K   T
Sbjct  192  KLQNT  196



>gb|EPE06282.1| 60s ribosomal protein l15 [Ophiostoma piceae UAMH 11346]
Length=203

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   RKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KG  YGKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW+N+DSTYKYFEV
Sbjct  73   KPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYWVNQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TW
Sbjct  133  ILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYWVNQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+CNPVHKHRE RGLTS GKK RGL  +GH  +K R  RR TW
Sbjct  133  ILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGL-NKGHRFNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|ERS96332.1| 60S ribosomal protein L15 [Sporothrix schenckii ATCC 58251]
Length=203

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   RKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   KPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TW
Sbjct  133  ILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRK
Sbjct  13   RKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KG  +GKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW+N+DSTYKY+EV
Sbjct  73   KPVAKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYWVNQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH  +K R  RR TW
Sbjct  133  ILVDPNHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIY95038.1| 60S ribosomal protein L15-1 [Monoraphidium neglectum]
Length=198

 Score =   237 bits (605),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 159/185 (86%), Gaps = 6/185 (3%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDV+RFLLRVRCWE+RQLP IVR+ RP+RPDKARR+G+KAKQGYVVYRVRVRRGGRK
Sbjct  13   RKQSDVLRFLLRVRCWEFRQLPGIVRLNRPSRPDKARRMGFKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGR+LGGLRVLNSYW+NEDS YKYFEV
Sbjct  73   RPVSKGIVYGKPVNQGITQLKASRNLRNVAEERAGRRLGGLRVLNSYWVNEDSAYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIRND RINW+       RELRGLTSAGKKYRGL G+G  ++K  PS+RATW
Sbjct  133  ILVDPNHNAIRNDARINWI------RRELRGLTSAGKKYRGLHGKGSRYNKNAPSKRATW  186

Query  184  KRNQT  170
             ++ +
Sbjct  187  LKHNS  191



>ref|XP_005703122.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 ref|XP_005703123.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
 gb|EME26602.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 gb|EME26603.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
Length=204

 Score =   237 bits (605),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVR WEYR LPS+ R +RPTRPDKAR LGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRAWEYRHLPSVHRASRPTRPDKARMLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKGI YGKP NQG+TQLKF+R+KRSVAEERAGR+ G LRVLNSYWIN+D  YKYFEV
Sbjct  73   RPVPKGIQYGKPKNQGITQLKFKRNKRSVAEERAGRRCGNLRVLNSYWINQDGIYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRI+W+C P  KHRE RGLTSAG+ +RGLR +G    K RPS RA W
Sbjct  133  ILVDPNHKAIRRDPRIHWICKPTMKHRERRGLTSAGRAHRGLRRKGLGVAKVRPSVRANW  192

Query  184  KRNQT  170
            KR  T
Sbjct  193  KRRNT  197



>gb|KIV95599.1| 60S ribosomal protein L15 [Exophiala mesophila]
Length=203

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIN02516.1| hypothetical protein OIDMADRAFT_18358 [Oidiodendron maius Zn]
Length=203

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHSYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KEF63356.1| 60S ribosomal protein L15 [Exophiala aquamarina CBS 119918]
Length=203

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_008713401.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
 gb|ETN44328.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
Length=203

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R TRP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRATRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHGYNKTSAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>emb|CEJ94099.1| Putative Ribosomal protein L15 [Torrubiella hemipterigena]
Length=203

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +P  KG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   KPARKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTSTGKRSRGL-NKGHRYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIX01331.1| 60S ribosomal protein L15 [Rhinocladiella mackenziei CBS 650.93]
Length=203

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH+ +K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHVFNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   KPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTSTGKRSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|EQL00837.1| Ribosomal protein L15e [Ophiocordyceps sinensis CO18]
Length=203

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVRKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD MRFLLRVRCW+YRQL +I R  RPTRPDKARRLGY+AKQGYV+YR+R+RRGGRK
Sbjct  13   KKQSDAMRFLLRVRCWQYRQLTAIHRAPRPTRPDKARRLGYRAKQGYVIYRIRLRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW+ +DSTYK+FEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYWVGQDSTYKFFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRAT  188
            I+VD  H AIR +P   W+CNPVHKHRELRGLTSAGKK RG+ G+GHLH +    SRRA 
Sbjct  133  IMVDPFHKAIRRNPDTQWICNPVHKHRELRGLTSAGKKNRGI-GKGHLHTQTIGGSRRAA  191

Query  187  WKRNQT  170
            WKR  T
Sbjct  192  WKRRNT  197



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLR+RCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V++R+RVRRGGRK
Sbjct  13   KKQSDVMRFLLRIRCWEYRQKTVIHRASRPSRPDKARRLGYKAKQGFVIFRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+Q++ RS AEER GRK   LRVLNSYW+NEDSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYWVNEDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I VD  H AIR DPR NW+CNPVHKHRE RGLT+ GKK RG+  +GHL +K R  RR TW
Sbjct  133  ICVDPQHKAIRRDPRYNWICNPVHKHREARGLTATGKKSRGI-AKGHLFNKTRKGRRHTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KQHNT  196



>ref|XP_009159952.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59491.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
Length=203

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHREARGLTATGKKSRGL-GKGHGFNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_001624083.1| predicted protein [Nematostella vectensis]
 gb|EDO31983.1| predicted protein [Nematostella vectensis]
Length=204

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD++RFLLRVRCW+YRQL +I R TRPTRPDKARRLGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   KKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKP NQGV +LKFQRS RSVAEERAGR  GGLRVLNSYW+ +DS YKYFEV
Sbjct  73   RPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYWVGQDSIYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRAT  188
            I+VD  H AIR D RINW+C P HKHRELRGLT+AG K RG+R +GH ++K    SRRA 
Sbjct  133  IMVDPFHKAIRRDARINWICKPTHKHRELRGLTAAGTKNRGMR-KGHNYNKVIGSSRRAN  191

Query  187  WKRNQT  170
            WKR+ T
Sbjct  192  WKRHNT  197



>ref|XP_008725811.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
 gb|ETI26466.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
Length=203

 Score =   235 bits (599),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++     RR TW
Sbjct  133  ILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNNTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRQNT  196



>ref|XP_001541513.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EDN07080.1| 60S ribosomal protein L15 [Histoplasma capsulatum NAm1]
 gb|EEH11352.1| 60S ribosomal protein L15 [Histoplasma capsulatum G186AR]
 gb|EER43402.1| 60S ribosomal protein L15 [Histoplasma capsulatum H143]
 gb|EGC46336.1| 60S ribosomal protein [Histoplasma capsulatum H88]
Length=203

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            R  PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEV
Sbjct  73   RQAPKGATYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVKPVHKHRESRGLTAAGKKSRGL-GRGHSYNKTSAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>gb|KIE03942.1| Ribosomal protein L15e, partial [Metarhizium majus ARSEF 297]
Length=203

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYVVYRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVVYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTW  191

Query  184  KRNQT  170
             R+ T
Sbjct  192  LRHNT  196



>ref|XP_003657786.1| 60S ribosomal protein L15 [Thielavia terrestris NRRL 8126]
 gb|AEO71450.1| hypothetical protein THITE_2083064 [Thielavia terrestris NRRL 
8126]
Length=203

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_003884098.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
 emb|CBZ54067.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
Length=205

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVR WEYRQLP++ R T+ TRPDKARRLGYK KQG+V+YRVRVRRG RK
Sbjct  13   KKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFVIYRVRVRRGDRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSYWINEDSTYKYFE  368
            + V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSYW+ +D+ YKY+E
Sbjct  73   KQVHKGIVYGKPKNQGVRKQKSSRNLRAVAEEKVGRKICGGLRVLNSYWVGQDAVYKYYE  132

Query  367  VILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  188
            VILVD AH AIRNDPRINWLC PV KHRE RGLTSAGKKYRGLR +G    + RPSRRA 
Sbjct  133  VILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGSGAARLRPSRRAC  192

Query  187  WKRNQT  170
            WK+ Q 
Sbjct  193  WKKRQA  198



>ref|XP_003666937.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61692.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
Length=203

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTNQG+ QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPAPKGATYGKPTNQGINQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_002366469.1| ribosomal protein L15, putative [Toxoplasma gondii ME49]
 ref|XP_008882193.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|EPR62406.1| ribosomal protein RPL15 [Toxoplasma gondii GT1]
 gb|EPT27335.1| ribosomal protein RPL15 [Toxoplasma gondii ME49]
 gb|ESS32798.1| ribosomal protein RPL15 [Toxoplasma gondii VEG]
 gb|KEP67758.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|KFG42256.1| ribosomal protein RPL15 [Toxoplasma gondii p89]
 gb|KFG44929.1| ribosomal protein RPL15 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52242.1| ribosomal protein RPL15 [Toxoplasma gondii FOU]
 gb|KFG65712.1| ribosomal protein RPL15 [Toxoplasma gondii RUB]
 gb|KFH10025.1| ribosomal protein RPL15 [Toxoplasma gondii MAS]
 gb|KFH12821.1| ribosomal protein RPL15 [Toxoplasma gondii VAND]
Length=205

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVR WEYRQLP++ R T+ TRPDKARRLGYK KQG+V+YRVRVRRG RK
Sbjct  13   KKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFVIYRVRVRRGDRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSYWINEDSTYKYFE  368
            + V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSYW+ +D+ YKY+E
Sbjct  73   KQVHKGIVYGKPKNQGVRKQKSTRNLRAVAEEKVGRKICGGLRVLNSYWVGQDAVYKYYE  132

Query  367  VILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  188
            VILVD AH AIRNDPRINWLC PV KHRE RGLTSAGKKYRGLR +G    + RPSRRA 
Sbjct  133  VILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGSGAARLRPSRRAC  192

Query  187  WKRNQT  170
            WK+ Q 
Sbjct  193  WKKRQA  198



>gb|KEQ99844.1| hypothetical protein AUEXF2481DRAFT_25720 [Aureobasidium subglaciale 
EXF-2481]
Length=253

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  63   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  122

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYWIN+DSTYKYFE+
Sbjct  123  RPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYWINQDSTYKYFEI  182

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH ++     RR TW
Sbjct  183  ILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHRYNNTSAGRRKTW  241

Query  184  KRNQT  170
            KR  T
Sbjct  242  KRQNT  246



>gb|KIW41910.1| 60S ribosomal protein L15 [Exophiala oligosperma]
Length=264

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  74   KKQSDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  133

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  134  RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  193

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH + K    RR TW
Sbjct  194  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYSKTTAGRRKTW  252

Query  184  KRNQT  170
            KR+ T
Sbjct  253  KRHNT  257



>gb|KEQ59346.1| 60S ribosomal protein L15 [Aureobasidium melanogenum CBS 110374]
 gb|KEQ71724.1| 60S ribosomal protein L15 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ81902.1| 60S ribosomal protein L15 [Aureobasidium pullulans EXF-150]
Length=203

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH ++     RR TW
Sbjct  133  ILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHRYNNTSAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRQNT  196



>ref|XP_007812013.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 ref|XP_007818066.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EFY88332.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 gb|EFZ02295.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EXV05475.1| ribosomal protein L15 [Metarhizium robertsii]
 gb|KFG82830.1| 60S ribosomal protein L15 [Metarhizium anisopliae]
 gb|KID67254.1| Ribosomal protein L15e, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID88474.1| Ribosomal protein L15e [Metarhizium guizhouense ARSEF 977]
Length=203

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTW  191

Query  184  KRNQT  170
             R+ T
Sbjct  192  LRHNT  196



>ref|XP_002545593.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
 gb|EER35635.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
Length=204

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW+N+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYWVNQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL +K +  RR TW
Sbjct  133  ILVDPSHKAIRRDARYNWIANPVHKHRESRGLTSAGKKSRGI-NKGHLFNKTKAGRRHTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KKHNT  196



>ref|XP_005534852.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80245.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
Length=205

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQS+ +RFL RVR WEYRQ P++ R TRP+RPDKARRLGY+AKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSEALRFLQRVRAWEYRQRPTVHRATRPSRPDKARRLGYRAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSYWINEDSTYKYFE  368
            RPVPKGI YGKP +QG+TQLKFQR+KRSVAEER GRK+   LRVLNSYWINED+ YKY+E
Sbjct  73   RPVPKGIQYGKPKHQGITQLKFQRNKRSVAEERVGRKICANLRVLNSYWINEDALYKYYE  132

Query  367  VILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  188
            VIL+D  H AIR DPRINW+C P  KHRELRGLTSAG+K RGL  +GHL +KARPS R+ 
Sbjct  133  VILIDPNHNAIRRDPRINWICRPTMKHRELRGLTSAGRKGRGLHRKGHLVNKARPSVRSV  192

Query  187  WKRNQT  170
            WKR+ T
Sbjct  193  WKRHNT  198



>ref|XP_762879.1| 60S ribosomal protein L15 [Theileria parva strain Muguga]
 gb|EAN30596.1| 60S ribosomal protein L15, putative [Theileria parva]
Length=204

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR LLR+R WEYRQLP++ RV+RPTRPDKARRLGYKAKQG+V+YRVRVRRG RK
Sbjct  13   KKQSDVMRTLLRIRTWEYRQLPALHRVSRPTRPDKARRLGYKAKQGFVIYRVRVRRGDRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            + V  GIVYGKP +QG+ + K +R+ RSVAEER GR  GGLRVLNSYW+ +D  YK++EV
Sbjct  73   KNVANGIVYGKPKHQGIRKQKSKRNLRSVAEERVGRHCGGLRVLNSYWVGQDEVYKFYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            +LVD AH A+RN+PR+N+LC PVHKHRE+RGLTSAGKKYRGLR +G    K+RPS RA W
Sbjct  133  VLVDPAHNAVRNNPRLNYLCKPVHKHREMRGLTSAGKKYRGLRVKGPRASKSRPSVRANW  192

Query  184  KRNQ  173
            +R Q
Sbjct  193  RRRQ  196



>ref|XP_001909718.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70851.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP27445.1| Putative cytosolic 60S ribosomal protein Rpl15 [Podospora anserina 
S mat+]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   KPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTKAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIX93106.1| 60S ribosomal protein L15 [Fonsecaea multimorphosa CBS 102226]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH + K    RR TW
Sbjct  133  ILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYTKTTSGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIW07591.1| 60S ribosomal protein L15 [Verruconis gallopava]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            +KQSDVMRFLLRVRCWEYRQ   I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRK
Sbjct  13   RKQSDVMRFLLRVRCWEYRQRHVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPAPKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH ++K R  RR  W
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRGGRRKAW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KID77747.1| Ribosomal protein L15e, partial [Metarhizium brunneum ARSEF 3297]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTW  191

Query  184  KRNQT  170
             R+ T
Sbjct  192  LRHNT  196



>gb|EPQ66314.1| Protein component of the large (60S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU77282.1| 60S ribosomal protein L15 [Blumeria graminis f. sp. hordei DH14]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRECRGLTATGKRSRGL-GKGHGYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_003233932.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD89563.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 118892]
 gb|EGD98634.1| 60S ribosomal protein L15 [Trichophyton tonsurans CBS 112818]
 gb|EGE06831.1| ribosomal protein L15 [Trichophyton equinum CBS 127.97]
 gb|EZF24323.1| 60S ribosomal protein L15 [Trichophyton rubrum MR850]
 gb|EZF35746.1| 60S ribosomal protein L15 [Trichophyton interdigitale H6]
 gb|EZF43284.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 100081]
 gb|EZF53926.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 288.86]
 gb|EZF64574.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 289.86]
 gb|EZF75156.1| 60S ribosomal protein L15 [Trichophyton soudanense CBS 452.61]
 gb|EZF85853.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1448]
 gb|EZF96634.1| 60S ribosomal protein L15 [Trichophyton rubrum MR1459]
 gb|EZG07762.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 735.88]
 gb|EZG18074.1| 60S ribosomal protein L15 [Trichophyton rubrum CBS 202.88]
 gb|KDB26559.1| 60S ribosomal protein L15 [Trichophyton interdigitale MR816]
 gb|KDB35118.1| 60S ribosomal protein L15 [Trichophyton rubrum D6]
Length=203

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            R   KG  YGKPTNQGV QLK+QRS RS AEER G++   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RTARKGATYGKPTNQGVNQLKYQRSLRSTAEERVGKRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHGYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>ref|XP_007511637.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
 emb|CCO17758.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
Length=204

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFL R+R WEYRQLPSI RVTRPTRPDKARRLGYKAKQG+V+YR RVRRGGRK
Sbjct  13   KKQSDVLRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFVIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KGIV GKP + G+T+LKF R+ +SVAEERA R+ G LRVLNSYW+N+DS YKY+EV
Sbjct  73   RPVRKGIVNGKPVHCGITKLKFARNLKSVAEERAARRCGALRVLNSYWLNQDSVYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            I+VD  H AIR+DPRINW+C P HK R +RGLTSAG+K+RGL G+GH + K R S+ A W
Sbjct  133  IMVDPMHKAIRSDPRINWICAPTHKGRAMRGLTSAGRKHRGLHGKGHNYTKNRSSKHAQW  192

Query  184  KRNQ  173
            K N 
Sbjct  193  KNNN  196



>gb|EEQ87750.1| 60S ribosomal protein L15 [Blastomyces dermatitidis ER-3]
Length=203

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            R  PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEV
Sbjct  73   RQAPKGTTYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH + K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVKPVHKHRENRGLTAAGKKSRGL-GRGHSYTKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>ref|XP_001545571.1| 60S ribosomal protein L15 [Botrytis cinerea B05.10]
 ref|XP_001588964.1| 60S ribosomal protein L15 [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDN94638.1| hypothetical protein SS1G_10512 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=203

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGFNKTTAGRRKTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KKHNT  196



>ref|XP_009691154.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
 dbj|BAM40853.1| 60S ribosomal protein L15 [Theileria orientalis strain Shintoku]
Length=204

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMR LLRVR WEYRQLP++ RVT+PTRPDKARRLGYKAKQG+V++RVRVRRG RK
Sbjct  13   KKQSDVMRTLLRVRTWEYRQLPALHRVTKPTRPDKARRLGYKAKQGFVIFRVRVRRGDRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            + V  GIVYGKP +QG+ + K +R+ RSVAEER GR+ GGLRVLNSYW+ +D  YK++EV
Sbjct  73   KNVANGIVYGKPKHQGIRKQKSKRNLRSVAEERVGRRCGGLRVLNSYWVGQDEVYKFYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD AH A+RN+PR+N+LC PVHKHRE+RGLTSAG+K RGLR +G    K+RPS RA W
Sbjct  133  ILVDPAHNAVRNNPRLNYLCKPVHKHREMRGLTSAGRKARGLRVKGPKASKSRPSVRANW  192

Query  184  KRNQ  173
            KR Q
Sbjct  193  KRRQ  196



>ref|XP_002623870.1| 60S ribosomal protein L15 [Blastomyces dermatitidis SLH14081]
 gb|EEQ70385.1| 60S ribosomal protein L15 [Blastomyces dermatitidis SLH14081]
 gb|EGE77651.1| 60S ribosomal protein L15 [Blastomyces dermatitidis ATCC 18188]
Length=203

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            R  PKG  YGKPTN GV QLK+QRS R  AEER GR+   LRVLNSYWINEDSTYKYFEV
Sbjct  73   RQAPKGATYGKPTNHGVNQLKYQRSLRCTAEERVGRRCANLRVLNSYWINEDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+  PVHKHRE RGLT+AGKK RGL GRGH + K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVKPVHKHRENRGLTAAGKKSRGL-GRGHSYTKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>ref|XP_009226880.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT71483.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=203

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD++RFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDILRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL  +GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KIW20891.1| 60S ribosomal protein L15 [Exophiala spinifera]
Length=203

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLKVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW+N+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWVNQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>ref|XP_007759046.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
 gb|EXJ56512.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
Length=203

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH ++     RR TW
Sbjct  133  ILVDPNHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNNTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRQNT  196



>ref|XP_007788991.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
 gb|EMR71923.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
Length=203

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRLDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|ACR24948.1| ribosomal protein L15 [Lepidochitona cinerea]
Length=204

 Score =   233 bits (594),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLR+R W+YRQL S+ R +RPTRPDKARRLGY+AKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRIRSWQYRQLASVHRASRPTRPDKARRLGYRAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKP NQGV QLKFQRS +SVAEER GRK  GLRVL+SYW+ +DSTYK+FE+
Sbjct  73   RPVPKGATYGKPVNQGVNQLKFQRSLQSVAEERVGRKCQGLRVLSSYWVAQDSTYKFFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKA-RPSRRAT  188
            ++VD  H AIR DP+INWLCNPVHKHRELRGLT+AGK  RGL  +GH  HK    SRRA 
Sbjct  133  VMVDPFHKAIRRDPKINWLCNPVHKHRELRGLTTAGKSSRGLX-KGHKFHKTIGGSRRAN  191

Query  187  WKRNQT  170
            WKR  T
Sbjct  192  WKRQNT  197



>ref|XP_007804051.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
 gb|ERF70289.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
Length=203

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHRYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>ref|XP_003350788.1| 60S ribosomal protein L15 [Sordaria macrospora k-hell]
 emb|CCC07453.1| unnamed protein product [Sordaria macrospora k-hell]
Length=203

 Score =   233 bits (593),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   KPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKRSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_003382517.1| PREDICTED: 60S ribosomal protein L15-like [Amphimedon queenslandica]
Length=204

 Score =   233 bits (593),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSD++RFLLRVRCW+YRQL  + R  RPTRPDKARRLGYKAKQG+V+YR+RVRRGGRK
Sbjct  13   KKQSDLLRFLLRVRCWQYRQLNVLHRAPRPTRPDKARRLGYKAKQGFVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            R   KG  YGKPTNQGV +LKFQRS +SVAEER GR  GGLRVLNSYW+ +DST+K++EV
Sbjct  73   RKARKGATYGKPTNQGVNELKFQRSLQSVAEERVGRHCGGLRVLNSYWVGQDSTFKFYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKAR-PSRRAT  188
            ILVD AH  IR DPR NW+C PVHKHRE+RGLTS G+K RGL G+GHL  K +  SRRA 
Sbjct  133  ILVDPAHKVIRQDPRTNWICRPVHKHREMRGLTSCGRKNRGL-GKGHLRTKVQGGSRRAN  191

Query  187  WKRNQT  170
            WKR  T
Sbjct  192  WKRRNT  197



>ref|XP_007925894.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME83067.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
Length=203

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKY+E+
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYYEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++  +  RR TW
Sbjct  133  ILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNNTKAGRRHTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRQNT  196



>gb|KHN95867.1| Ribosomal protein L15e [Metarhizium album ARSEF 1941]
Length=203

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWEYRQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYWIN DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWINRDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNKTQAGRRKTW  191

Query  184  KRNQT  170
             R+ T
Sbjct  192  LRHNT  196



>ref|XP_002797110.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_010759628.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
 gb|EEH18959.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb03]
 gb|EEH38048.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH47772.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
Length=203

 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YR+RVRRGGRK
Sbjct  13   KKQSDVIRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTN G+ QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPAPKGATYGKPTNHGINQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL GRGH ++K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GRGHKYNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR  T
Sbjct  192  KRLNT  196



>gb|ESZ93952.1| 60S ribosomal protein L15 [Sclerotinia borealis F-4157]
Length=203

 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  + R +RP+RPDKARRLGYKAKQGYV+YR RVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYVIYRARVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+
Sbjct  73   RPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEI  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RG+T+ GKK RGL G+GH  +K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGMTATGKKSRGL-GKGHGFNKTTAGRRKTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KKHNT  196



>gb|ENH84342.1| 60s ribosomal protein l15 [Colletotrichum orbiculare MAFF 240422]
Length=203

 Score =   232 bits (592),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            +PV KG  +GKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW+N+DSTYKY+EV
Sbjct  73   KPVAKGATFGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYWVNQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K +  RR TW
Sbjct  133  ILVDPQHKAIRIDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTKAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   232 bits (592),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YR+RVRRGGRK
Sbjct  13   KKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRIRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPV KG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYKYFEV
Sbjct  73   RPVLKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYWVNQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD +H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL +K +  RR TW
Sbjct  133  ILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHLFNKTKAGRRHTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KKHNT  196



>ref|XP_001525424.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK45173.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
Length=204

 Score =   232 bits (592),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V+YRVRVRRGGRK
Sbjct  13   KKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV  LK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNHLKYQKSLRSTAEERVGRRAANLRVLNSYWVNQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRYNWIANAVHKHREARGLTSAGKKSRGI-NKGHLYNKTRAGRRHTW  191

Query  184  KRNQT  170
            K++ T
Sbjct  192  KKHNT  196



>ref|XP_001225510.1| 60S ribosomal protein L15 [Chaetomium globosum CBS 148.51]
 gb|EAQ86601.1| 60S ribosomal protein L15 [Chaetomium globosum CBS 148.51]
Length=203

 Score =   232 bits (592),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+ FLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVVCFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH ++K R  RR TW
Sbjct  133  ILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHRYNKTRAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



>ref|XP_007373844.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34260.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
Length=204

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDVMRFL RVRCWEYRQ   I R +RP+RPDKARRLGYKAKQG+V++RVRVRRGGRK
Sbjct  13   KKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFVIFRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+ G LRVLNSYWIN+DSTYKYFEV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAGNLRVLNSYWINQDSTYKYFEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD +H AIR D R NW+  PVHKHRE RGLT+AGKK RG+  +GH + K +  RR TW
Sbjct  133  ILVDPSHKAIRRDARYNWITEPVHKHRESRGLTAAGKKSRGI-NKGHRYTKTKAGRRHTW  191

Query  184  KRNQT  170
            K+N T
Sbjct  192  KKNNT  196



>gb|KJB51845.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=146

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  526  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTA  347
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVILVD A
Sbjct  21   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFEVILVDVA  80

Query  346  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  170
            H AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHLHHK RPSRRATWKRN T
Sbjct  81   HNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRATWKRNNT  139



>ref|XP_007737355.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
 gb|EXJ77910.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
Length=203

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = -3

Query  724  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQgyvvyrvrvrrggrk  545
            KKQSDV+RFLLRVRCWE RQL  I R +RP+RPDKARRLGYKAKQGYV+YRVRVRRGGRK
Sbjct  13   KKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRK  72

Query  544  rpvpkGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  365
            RPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYKY+EV
Sbjct  73   RPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYWINQDSTYKYYEV  132

Query  364  ILVDTAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  185
            ILVD  H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH  +K    RR TW
Sbjct  133  ILVDPQHKAIRRDPRISWIVNPVHKHREARGLTATGKKSRGL-GKGHGFNKTTAGRRKTW  191

Query  184  KRNQT  170
            KR+ T
Sbjct  192  KRHNT  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455