BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015I23

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42442.1|  hypothetical protein MIMGU_mgv1a0056111mg               320   1e-106   Erythranthe guttata [common monkey flower]
ref|XP_006343543.1|  PREDICTED: xylose isomerase-like                   325   2e-105   Solanum tuberosum [potatoes]
ref|XP_009801815.1|  PREDICTED: xylose isomerase                        324   5e-105   Nicotiana sylvestris
emb|CDP02939.1|  unnamed protein product                                323   7e-105   Coffea canephora [robusta coffee]
ref|XP_009606829.1|  PREDICTED: xylose isomerase                        323   1e-104   Nicotiana tomentosiformis
ref|XP_002532409.1|  Xylose isomerase, putative                         323   1e-104   Ricinus communis
ref|XP_004242672.1|  PREDICTED: xylose isomerase                        322   2e-104   Solanum lycopersicum
ref|XP_011079316.1|  PREDICTED: xylose isomerase                        321   8e-104   Sesamum indicum [beniseed]
gb|EYU34279.1|  hypothetical protein MIMGU_mgv1a005575mg                320   9e-104   Erythranthe guttata [common monkey flower]
gb|KDP43806.1|  hypothetical protein JCGZ_23014                         320   2e-103   Jatropha curcas
ref|XP_010688509.1|  PREDICTED: xylose isomerase isoform X2             318   7e-103   
ref|XP_010688511.1|  PREDICTED: xylose isomerase isoform X3             318   7e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688508.1|  PREDICTED: xylose isomerase isoform X1             318   3e-102   
ref|XP_002277520.2|  PREDICTED: xylose isomerase                        315   9e-102   Vitis vinifera
ref|XP_003549495.1|  PREDICTED: xylose isomerase                        314   3e-101   Glycine max [soybeans]
ref|XP_008452100.1|  PREDICTED: xylose isomerase                        314   3e-101   Cucumis melo [Oriental melon]
emb|CBI17768.3|  unnamed protein product                                315   3e-101   Vitis vinifera
gb|KGN61107.1|  hypothetical protein Csa_2G049960                       314   3e-101   Cucumis sativus [cucumbers]
gb|KHN17567.1|  Xylose isomerase                                        314   4e-101   Glycine soja [wild soybean]
ref|XP_004149070.1|  PREDICTED: xylose isomerase-like                   314   4e-101   
ref|XP_006453438.1|  hypothetical protein CICLE_v10008154mg             313   5e-101   Citrus clementina [clementine]
gb|KDO62435.1|  hypothetical protein CISIN_1g0373932mg                  314   5e-101   Citrus sinensis [apfelsine]
emb|CAN65150.1|  hypothetical protein VITISV_037086                     312   8e-101   Vitis vinifera
ref|XP_010259769.1|  PREDICTED: xylose isomerase isoform X2             312   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_004958625.1|  PREDICTED: xylose isomerase-like                   312   2e-100   Setaria italica
gb|KJB60240.1|  hypothetical protein B456_009G296100                    311   3e-100   Gossypium raimondii
ref|XP_011069881.1|  PREDICTED: xylose isomerase-like                   311   3e-100   Sesamum indicum [beniseed]
gb|KJB60238.1|  hypothetical protein B456_009G296100                    311   3e-100   Gossypium raimondii
gb|KJB60239.1|  hypothetical protein B456_009G296100                    311   3e-100   Gossypium raimondii
ref|XP_010938719.1|  PREDICTED: xylose isomerase                        311   4e-100   Elaeis guineensis
ref|XP_008223675.1|  PREDICTED: xylose isomerase                        311   4e-100   Prunus mume [ume]
ref|XP_010259768.1|  PREDICTED: xylose isomerase isoform X1             312   6e-100   Nelumbo nucifera [Indian lotus]
gb|KHG02217.1|  Xylose isomerase -like protein                          310   7e-100   Gossypium arboreum [tree cotton]
ref|XP_011018165.1|  PREDICTED: xylose isomerase                        310   8e-100   Populus euphratica
ref|XP_007222807.1|  hypothetical protein PRUPE_ppa005065mg             310   1e-99    Prunus persica
ref|XP_002324488.1|  hypothetical protein POPTR_0018s10460g             310   1e-99    Populus trichocarpa [western balsam poplar]
gb|ACJ84879.1|  unknown                                                 305   1e-99    Medicago truncatula
ref|XP_009391575.1|  PREDICTED: xylose isomerase-like                   310   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004958079.1|  PREDICTED: xylose isomerase-like                   310   2e-99    Setaria italica
ref|XP_008796228.1|  PREDICTED: xylose isomerase isoform X2             310   2e-99    Phoenix dactylifera
ref|XP_004507817.1|  PREDICTED: xylose isomerase-like isoform X3        309   3e-99    Cicer arietinum [garbanzo]
ref|XP_010065878.1|  PREDICTED: xylose isomerase-like isoform X3        308   4e-99    Eucalyptus grandis [rose gum]
ref|XP_007154797.1|  hypothetical protein PHAVU_003G148700g             308   5e-99    Phaseolus vulgaris [French bean]
gb|KCW63564.1|  hypothetical protein EUGRSUZ_G01193                     309   6e-99    Eucalyptus grandis [rose gum]
ref|XP_009348411.1|  PREDICTED: xylose isomerase-like                   308   7e-99    Pyrus x bretschneideri [bai li]
ref|XP_007011128.1|  Xylose isomerase family protein isoform 2          308   7e-99    
ref|XP_008796227.1|  PREDICTED: xylose isomerase isoform X1             310   8e-99    Phoenix dactylifera
ref|XP_010102992.1|  Xylose isomerase                                   308   1e-98    
gb|AES92376.2|  xylose isomerase                                        306   3e-98    Medicago truncatula
ref|XP_009336656.1|  PREDICTED: xylose isomerase-like                   306   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_003610179.1|  Xylose isomerase                                   306   3e-98    
ref|XP_010102993.1|  Xylose isomerase                                   308   3e-98    
ref|XP_008365436.1|  PREDICTED: xylose isomerase-like                   306   4e-98    Malus domestica [apple tree]
ref|XP_007011127.1|  Xylose isomerase family protein isoform 1          307   6e-98    
dbj|BAD95103.1|  xylose isomerase                                       297   7e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417936.1|  PREDICTED: xylose isomerase-like                   305   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658089.1|  PREDICTED: xylose isomerase-like                   304   3e-97    Oryza brachyantha
gb|AFK39166.1|  unknown                                                 303   4e-97    Medicago truncatula
ref|NP_001132889.1|  putative xylose isomerase family protein pre...    303   6e-97    Zea mays [maize]
gb|EPS67638.1|  xylose isomerase                                        303   7e-97    Genlisea aurea
ref|XP_003562496.1|  PREDICTED: xylose isomerase                        303   8e-97    Brachypodium distachyon [annual false brome]
gb|EEC82655.1|  hypothetical protein OsI_27268                          303   9e-97    Oryza sativa Indica Group [Indian rice]
ref|NP_001060585.1|  Os07g0669100                                       303   1e-96    
gb|EMS46439.1|  Xylose isomerase                                        301   2e-96    Triticum urartu
gb|ACG42142.1|  xylose isomerase                                        301   2e-96    Zea mays [maize]
ref|XP_004297371.1|  PREDICTED: xylose isomerase                        301   2e-96    Fragaria vesca subsp. vesca
gb|AGV54617.1|  xylose isomerase                                        300   8e-96    Phaseolus vulgaris [French bean]
gb|ACG35698.1|  xylose isomerase                                        300   1e-95    Zea mays [maize]
ref|NP_001132653.1|  uncharacterized protein LOC100194128 precursor     300   1e-95    Zea mays [maize]
ref|XP_008650947.1|  PREDICTED: uncharacterized protein LOC100194...    300   3e-95    Zea mays [maize]
dbj|BAJ96683.1|  predicted protein                                      299   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006845583.1|  hypothetical protein AMTR_s00019p00197750          298   4e-95    Amborella trichopoda
tpg|DAA64057.1|  TPA: putative xylose isomerase family protein          300   1e-94    
ref|XP_010539451.1|  PREDICTED: xylose isomerase                        296   2e-94    Tarenaya hassleriana [spider flower]
emb|CDY49729.1|  BnaA10g11590D                                          296   4e-94    Brassica napus [oilseed rape]
gb|EMT06905.1|  Xylose isomerase                                        295   5e-94    
emb|CDY25894.1|  BnaC09g32660D                                          296   5e-94    Brassica napus [oilseed rape]
ref|XP_009120281.1|  PREDICTED: xylose isomerase                        295   6e-94    Brassica rapa
ref|NP_568861.3|  xylose isomerase                                      295   1e-93    Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98492.1|  xylose isomerase                                       295   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401183.1|  hypothetical protein EUTSA_v10013406mg             295   1e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010443465.1|  PREDICTED: xylose isomerase                        294   2e-93    Camelina sativa [gold-of-pleasure]
sp|Q40082.1|XYLA_HORVU  RecName: Full=Xylose isomerase                  294   2e-93    Hordeum vulgare [barley]
ref|XP_006280396.1|  hypothetical protein CARUB_v10026323mg             294   2e-93    Capsella rubella
dbj|BAJ34093.1|  unnamed protein product                                293   3e-93    Eutrema halophilum
ref|XP_010483295.1|  PREDICTED: xylose isomerase-like                   293   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002864523.1|  xylose isomerase family protein                    293   4e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_010452612.1|  PREDICTED: xylose isomerase-like                   293   6e-93    Camelina sativa [gold-of-pleasure]
gb|KJB60241.1|  hypothetical protein B456_009G296100                    292   7e-93    Gossypium raimondii
gb|AAM61519.1|  xylose isomerase                                        290   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507815.1|  PREDICTED: xylose isomerase-like isoform X1        291   5e-92    
dbj|BAB08802.1|  xylose isomerase                                       276   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|ABR16225.1|  unknown                                                 261   1e-81    Picea sitchensis
ref|XP_001774702.1|  predicted protein                                  262   4e-81    
ref|XP_002991242.1|  hypothetical protein SELMODRAFT_229601             256   6e-79    
ref|XP_002991182.1|  hypothetical protein SELMODRAFT_161472             256   8e-79    
emb|CAA64544.1|  xylose isomerase                                       242   2e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002739772.1|  PREDICTED: xylose isomerase-like                   209   6e-64    Saccoglossus kowalevskii
ref|XP_002506620.1|  predicted protein                                  206   4e-60    Micromonas commoda
ref|XP_002591809.1|  hypothetical protein BRAFLDRAFT_123544             199   6e-60    Branchiostoma floridae
ref|XP_005646804.1|  xylose isomerase                                   206   1e-59    Coccomyxa subellipsoidea C-169
ref|WP_034568836.1|  xylose isomerase                                   204   4e-59    Clostridiales bacterium oral taxon 876
gb|ERI94441.1|  xylose isomerase                                        204   5e-59    Clostridiales bacterium oral taxon 876 str. F0540
ref|XP_010792168.1|  PREDICTED: xylose isomerase-like                   199   2e-58    Notothenia coriiceps [yellowbelly rockcod]
gb|ETK93389.1|  xylose isomerase                                        197   2e-58    Phytophthora parasitica
gb|ETK93384.1|  xylose isomerase                                        197   3e-58    Phytophthora parasitica
ref|XP_001633389.1|  predicted protein                                  201   4e-58    Nematostella vectensis
gb|KIZ04907.1|  xylose isomerase                                        202   4e-58    Monoraphidium neglectum
gb|ETL46794.1|  xylose isomerase                                        197   7e-58    Phytophthora parasitica
ref|XP_010738383.1|  PREDICTED: xylose isomerase-like isoform X2        199   8e-58    
ref|XP_006636149.1|  PREDICTED: xylose isomerase-like                   199   1e-57    
emb|CAF93733.1|  unnamed protein product                                199   1e-57    Tetraodon nigroviridis
gb|ETI53522.1|  xylose isomerase                                        197   1e-57    Phytophthora parasitica P1569
ref|WP_017895180.1|  xylose isomerase                                   200   1e-57    Clostridium tyrobutyricum
ref|XP_008900733.1|  xylose isomerase                                   200   2e-57    Phytophthora parasitica INRA-310
emb|CDQ80418.1|  unnamed protein product                                199   2e-57    Oncorhynchus mykiss
ref|XP_010065874.1|  PREDICTED: xylose isomerase-like isoform X1        199   4e-57    
ref|XP_003965907.1|  PREDICTED: xylose isomerase-like                   199   5e-57    
ref|XP_010738382.1|  PREDICTED: xylose isomerase-like isoform X1        198   5e-57    
gb|ETI53536.1|  xylose isomerase                                        197   2e-56    Phytophthora parasitica P1569
ref|XP_004356776.1|  xylose isomerase                                   197   2e-56    Acanthamoeba castellanii str. Neff
gb|ETP51333.1|  xylose isomerase                                        197   2e-56    Phytophthora parasitica P10297
gb|ETO82214.1|  xylose isomerase                                        197   2e-56    Phytophthora parasitica P1976
gb|ETL77578.1|  xylose isomerase                                        197   2e-56    Phytophthora parasitica
ref|XP_010883508.1|  PREDICTED: xylose isomerase-like                   197   3e-56    
ref|XP_008290598.1|  PREDICTED: xylose isomerase-like                   196   4e-56    Stegastes partitus
ref|XP_009537176.1|  hypothetical protein PHYSODRAFT_565503             195   7e-56    Phytophthora sojae
ref|WP_016205623.1|  xylose isomerase                                   194   1e-55    Clostridium
ref|XP_008321922.1|  PREDICTED: xylose isomerase-like isoform X2        194   2e-55    
ref|XP_002904118.1|  xylose isomerase 1                                 195   2e-55    Phytophthora infestans T30-4
ref|XP_008321921.1|  PREDICTED: xylose isomerase-like isoform X1        193   5e-55    Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_044593090.1|  xylose isomerase                                   187   6e-55    
ref|XP_009537174.1|  hypothetical protein PHYSODRAFT_306712             195   2e-54    Phytophthora sojae
gb|EQF74127.1|  xylose isomerase                                        187   2e-54    Clostridioides difficile CD212
gb|ELU13203.1|  hypothetical protein CAPTEDRAFT_149382                  191   3e-54    Capitella teleta
ref|WP_036097976.1|  xylose isomerase                                   191   5e-54    Listeria floridensis
ref|WP_007061694.1|  xylose isomerase                                   190   6e-54    Clostridium carboxidivorans
ref|WP_039882234.1|  xylose isomerase                                   190   7e-54    Mesotoga
ref|WP_034536238.1|  xylose isomerase                                   190   7e-54    Bacteroides stercoris
ref|WP_005654109.1|  xylose isomerase                                   190   8e-54    Bacteroides stercoris
emb|CCU83726.1|  Xylose isomerase                                       190   8e-54    Mesotoga infera
gb|ADD61976.1|  putative protein                                        186   9e-54    uncultured organism
ref|WP_014731027.1|  xylose isomerase                                   190   1e-53    Mesotoga prima
ref|WP_010588344.1|  xylose isomerase                                   189   1e-53    Schlesneria paludicola
gb|EPH17343.1|  xylose isomerase                                        190   1e-53    Bacteroides stercoris CC31F
ref|WP_022103428.1|  xylose isomerase                                   190   1e-53    
gb|ERM41646.1|  xylose isomerase                                        186   1e-53    Clostridioides difficile P68
ref|WP_019027960.1|  xylose isomerase                                   189   1e-53    Colwellia piezophila
gb|EFP62823.1|  putative xylose isomerase                               186   2e-53    Erysipelotrichaceae bacterium 3_1_53
ref|XP_003387079.1|  PREDICTED: xylose isomerase-like                   189   2e-53    
ref|WP_010074860.1|  xylose isomerase                                   189   3e-53    Clostridium cellulovorans
ref|WP_038164239.1|  xylose isomerase                                   189   3e-53    Verrucomicrobium sp. BvORR106
ref|WP_032079132.1|  xylose isomerase                                   189   3e-53    Clostridium drakei
ref|WP_013289876.1|  xylose isomerase                                   188   3e-53    Caldicellulosiruptor obsidiansis
gb|EFX66553.1|  hypothetical protein DAPPUDRAFT_218978                  187   3e-53    Daphnia pulex
emb|CBK25455.2|  unnamed protein product                                188   4e-53    Blastocystis hominis
ref|WP_013411463.1|  xylose isomerase                                   188   4e-53    Caldicellulosiruptor owensensis
ref|WP_009959227.1|  xylose isomerase                                   188   5e-53    Verrucomicrobium spinosum
gb|AAR09155.1|  xylose isomerase                                        182   6e-53    Mannheimia granulomatis
ref|WP_026658263.1|  Xylose isomerase                                   187   7e-53    
ref|WP_020532079.1|  hypothetical protein                               187   7e-53    Flexithrix dorotheae
ref|WP_004290957.1|  MULTISPECIES: xylose isomerase                     187   7e-53    Bacteroides eggerthii
ref|WP_041897212.1|  xylose isomerase                                   187   8e-53    Clostridium beijerinckii
ref|WP_015392438.1|  xylose isomerase XylA                              187   8e-53    Clostridium saccharoperbutylacetonicum
ref|WP_022019645.1|  xylose isomerase                                   187   8e-53    
ref|XP_005090167.1|  PREDICTED: xylose isomerase-like                   185   9e-53    
ref|WP_039037140.1|  xylose isomerase                                   187   9e-53    Pseudoalteromonas
ref|WP_021846289.1|  xylose isomerase                                   187   9e-53    
ref|WP_013298905.1|  xylose isomerase                                   187   9e-53    Thermoanaerobacterium thermosaccharolyticum
ref|WP_017209278.1|  xylose isomerase                                   187   1e-52    Clostridium beijerinckii
ref|WP_016601082.1|  xylose isomerase                                   184   1e-52    Yersinia pestis
ref|WP_029228039.1|  xylose isomerase                                   187   1e-52    Caldicellulosiruptor acetigenus
ref|WP_021376347.1|  xylose isomerase                                   187   1e-52    Clostridioides difficile
ref|WP_044271094.1|  xylose isomerase                                   187   1e-52    Bacteroides timonensis
ref|WP_009120973.1|  MULTISPECIES: xylose isomerase                     187   1e-52    Bacteroides clarus
ref|WP_014041981.1|  xylose isomerase                                   187   1e-52    Caldicellulosiruptor lactoaceticus
ref|WP_013433194.1|  xylose isomerase                                   187   1e-52    Caldicellulosiruptor kristjanssonii
ref|WP_012058599.1|  xylose isomerase                                   187   2e-52    Clostridium beijerinckii
ref|WP_023976124.1|  MULTISPECIES: xylose isomerase                     187   2e-52    Clostridium
ref|WP_014625278.1|  xylose isomerase                                   187   2e-52    Spirochaeta thermophila
ref|WP_027072689.1|  xylose isomerase                                   186   2e-52    Luteimonas sp. J29
ref|WP_021423576.1|  xylose isomerase                                   186   2e-52    Clostridioides difficile
ref|WP_034634309.1|  xylose isomerase                                   180   2e-52    
ref|WP_014757233.1|  MULTISPECIES: xylose isomerase                     186   2e-52    Thermoanaerobacterium aotearoense
ref|WP_038172460.1|  xylose isomerase                                   186   3e-52    Verrucomicrobium sp. BvORR106
ref|WP_026887251.1|  xylose isomerase                                   186   3e-52    Clostridium beijerinckii
sp|P30435.1|XYLA_THESA  RecName: Full=Xylose isomerase                  186   3e-52    Thermoanaerobacterium saccharolyticum
ref|WP_013430944.1|  xylose isomerase                                   186   3e-52    Caldicellulosiruptor kronotskyensis
ref|WP_013314408.1|  xylose isomerase                                   186   3e-52    Spirochaeta thermophila
ref|WP_013788885.1|  xylose isomerase                                   186   3e-52    Thermoanaerobacterium xylanolyticum
ref|WP_015312541.1|  xylose isomerase                                   186   3e-52    Thermoanaerobacterium thermosaccharolyticum
ref|WP_013238479.1|  MULTISPECIES: xylose isomerase                     186   3e-52    Clostridium
ref|WP_021369126.1|  xylose isomerase                                   186   3e-52    Clostridioides difficile
ref|WP_021412148.1|  xylose isomerase                                   186   3e-52    Clostridioides difficile
ref|WP_013626379.1|  xylose isomerase                                   186   3e-52    Rubinisphaera brasiliensis
ref|WP_009891378.1|  xylose isomerase                                   186   4e-52    Clostridiales
ref|WP_009898127.1|  xylose isomerase                                   186   4e-52    Clostridiales
ref|WP_002560285.1|  MULTISPECIES: xylose isomerase                     186   4e-52    Bacteroides
ref|WP_009906213.1|  xylose isomerase                                   186   4e-52    Clostridioides difficile
ref|WP_021393548.1|  xylose isomerase                                   186   4e-52    Clostridioides difficile
ref|WP_021421788.1|  xylose isomerase                                   186   4e-52    Clostridioides difficile
ref|WP_021388228.1|  xylose isomerase                                   186   4e-52    Clostridioides difficile
ref|WP_007173223.1|  xylose isomerase                                   186   4e-52    Prevotella bergensis
ref|WP_009959507.1|  xylose isomerase                                   185   5e-52    Verrucomicrobium spinosum
gb|EHJ36230.1|  xylose isomerase                                        186   5e-52    Clostridioides difficile 70-100-2010
ref|WP_012816370.1|  xylose isomerase                                   186   5e-52    
gb|EFH05881.1|  xylose isomerase                                        186   5e-52    Clostridioides difficile NAP08
ref|WP_015907182.1|  xylose isomerase                                   185   5e-52    Caldicellulosiruptor bescii
gb|EHJ32437.1|  xylose isomerase                                        186   5e-52    Clostridioides difficile 002-P50-2011
ref|WP_021361041.1|  xylose isomerase                                   185   6e-52    Clostridioides difficile
ref|WP_012374578.1|  xylose isomerase                                   185   6e-52    Opitutus terrae
ref|WP_038670249.1|  xylose isomerase                                   185   7e-52    Ruminococcus
ref|WP_022287212.1|  xylose isomerase                                   185   7e-52    Ruminococcus
ref|WP_021896825.1|  xylose isomerase                                   185   8e-52    
gb|AIF26293.1|  putative xylose isomerase                               183   8e-52    uncultured bacterium Lq_025_E06
ref|WP_012570371.1|  xylose isomerase                                   184   9e-52    Coxiella burnetii
ref|WP_005769174.1|  xylose isomerase                                   184   9e-52    Coxiella burnetii
ref|WP_022618581.1|  Xylose isomerase                                   185   9e-52    Clostridioides difficile
ref|WP_008131330.1|  xylose isomerase                                   184   1e-51    Pseudoalteromonas sp. BSi20480
ref|WP_043090972.1|  xylose isomerase                                   178   1e-51    
ref|WP_035601129.1|  xylose isomerase                                   184   1e-51    Haloferula sp. BvORR071
ref|WP_012341741.1|  xylose isomerase                                   184   1e-51    Histophilus somni
ref|WP_010556356.1|  xylose isomerase                                   184   1e-51    Pseudoalteromonas marina
gb|EHJ34457.1|  xylose isomerase                                        184   1e-51    Clostridioides difficile 050-P50-2011
ref|WP_006978554.1|  xylose isomerase                                   184   1e-51    Chthoniobacter flavus
ref|WP_016679053.1|  xylose isomerase                                   183   1e-51    Yersinia pestis
ref|WP_035688493.1|  xylose isomerase                                   184   2e-51    Avibacterium paragallinarum
ref|WP_005931926.1|  MULTISPECIES: xylose isomerase                     184   2e-51    Bacteroides salyersiae
ref|WP_013043164.1|  xylose isomerase                                   184   2e-51    Coraliomargarita akajimensis
ref|WP_013403911.1|  xylose isomerase                                   184   2e-51    Caldicellulosiruptor hydrothermalis
ref|WP_022587522.1|  xylose isomerase                                   184   2e-51    Caldanaerobacter subterraneus
ref|WP_028514448.1|  xylose isomerase                                   184   2e-51    Ruminococcus flavefaciens
ref|WP_010040427.1|  xylose isomerase                                   184   2e-51    Gemmata obscuriglobus
ref|WP_041604097.1|  xylose isomerase                                   184   2e-51    Histophilus somni
ref|WP_038506942.1|  xylose isomerase                                   184   2e-51    Cellulophaga lytica
ref|WP_034646410.1|  xylose isomerase                                   184   2e-51    Cellulophaga
gb|ABI24864.1|  D-xylose isomerase                                      184   3e-51    Histophilus somni 129PT
ref|WP_034748529.1|  xylose isomerase                                   183   3e-51    Bacillus wakoensis
ref|WP_007414259.1|  xylose isomerase                                   183   3e-51    Pedosphaera parvula
ref|WP_039529996.1|  xylose isomerase                                   176   3e-51    
ref|WP_015923669.1|  xylose isomerase                                   183   3e-51    Halothermothrix orenii
ref|WP_006569355.1|  xylose isomerase                                   183   3e-51    Thermoanaerobacter siderophilus
ref|WP_033847877.1|  MULTISPECIES: xylose isomerase                     183   3e-51    Yersinia pseudotuberculosis complex
ref|WP_025863290.1|  xylose isomerase                                   183   3e-51    Prolixibacter bellariivorans
ref|WP_032466856.1|  xylose isomerase                                   183   3e-51    Yersinia pseudotuberculosis
ref|WP_012230197.1|  xylose isomerase                                   183   3e-51    Yersinia pestis
ref|WP_002209593.1|  MULTISPECIES: xylose isomerase                     183   3e-51    Yersinia pseudotuberculosis complex
ref|WP_012896352.1|  xylose isomerase                                   183   4e-51    Thermotoga naphthophila
ref|WP_016710605.1|  xylose isomerase                                   183   4e-51    Pseudoalteromonas
ref|WP_018199100.1|  hypothetical protein                               183   4e-51    
ref|WP_025423857.1|  xylose isomerase                                   183   4e-51    Sodalis praecaptivus
gb|KHC94878.1|  xylose isomerase                                        183   4e-51    Thermotoga sp. TBGT1765
ref|WP_038033066.1|  MULTISPECIES: xylose isomerase                     183   4e-51    Thermotoga
ref|WP_022428254.1|  xylose isomerase                                   177   4e-51    
ref|WP_024063558.1|  xylose isomerase                                   183   4e-51    Yersinia pseudotuberculosis
sp|P19148.1|XYLA_THETU  RecName: Full=Xylose isomerase                  183   5e-51    Thermoanaerobacterium thermosulfurigenes
pdb|1A0C|A  Chain A, Xylose Isomerase From Thermoanaerobacterium ...    183   5e-51    Thermoanaerobacterium thermosulfurigenes
ref|WP_025381905.1|  xylose isomerase                                   183   5e-51    Yersinia similis
ref|WP_026462632.1|  xylose isomerase                                   183   5e-51    Adhaeribacter aquaticus
ref|WP_044003575.1|  xylose isomerase                                   183   5e-51    Hymenobacter swuensis
ref|WP_011997245.1|  xylose isomerase                                   182   5e-51    Coxiella burnetii
pdb|1A0E|A  Chain A, Xylose Isomerase From Thermotoga Neapolitana       182   6e-51    Thermotoga neapolitana
ref|WP_015919215.1|  MULTISPECIES: xylose isomerase                     182   6e-51    Thermotoga
ref|WP_039463449.1|  xylose isomerase                                   182   6e-51    Pectobacterium carotovorum
ref|WP_022971245.1|  xylose isomerase                                   182   7e-51    Xanthomonas maliensis
ref|WP_039279877.1|  xylose isomerase                                   182   7e-51    Pectobacterium carotovorum
ref|WP_044878597.1|  xylose isomerase                                   182   7e-51    Paenibacillus sp. IHBB 10380
gb|ACU08186.1|  Xylose isomerase                                        183   7e-51    Flavobacteriaceae bacterium 3519-10
ref|WP_041252697.1|  xylose isomerase                                   182   7e-51    Flavobacteriaceae bacterium 3519-10
gb|ABX77269.1|  xylose isomerase                                        181   8e-51    Coxiella burnetii RSA 331
ref|WP_006450750.1|  hypothetical protein                               177   8e-51    
ref|WP_017173630.1|  xylose isomerase                                   175   9e-51    
emb|CDY02747.1|  BnaC02g11420D                                          179   1e-50    
ref|WP_017173982.1|  xylose isomerase                                   175   1e-50    
ref|WP_037562869.1|  xylose isomerase                                   182   1e-50    Alkalispirochaeta odontotermitis
ref|WP_018751681.1|  xylose isomerase                                   182   1e-50    Paenibacillus sanguinis
ref|WP_003869013.1|  MULTISPECIES: xylose isomerase                     182   1e-50    Thermoanaerobacter indiensis
ref|WP_024860181.1|  xylose isomerase                                   182   1e-50    Ruminococcus flavefaciens
ref|WP_032531500.1|  xylose isomerase                                   182   1e-50    Bacteroides fragilis
ref|WP_018978264.1|  xylose isomerase                                   182   1e-50    
ref|WP_005916113.1|  xylose isomerase                                   174   1e-50    
ref|WP_026990078.1|  xylose isomerase                                   182   1e-50    
ref|WP_035132135.1|  xylose isomerase                                   182   1e-50    
ref|WP_005806049.1|  MULTISPECIES: xylose isomerase                     182   1e-50    
ref|WP_029501331.1|  xylose isomerase                                   182   1e-50    
ref|WP_027073399.1|  xylose isomerase                                   182   1e-50    
ref|WP_008302073.1|  xylose isomerase                                   182   1e-50    
ref|WP_032539378.1|  xylose isomerase                                   182   1e-50    
ref|WP_029487833.1|  xylose isomerase                                   182   1e-50    
ref|WP_028537509.1|  MULTISPECIES: xylose isomerase                     182   1e-50    
ref|WP_036644393.1|  xylose isomerase                                   181   1e-50    
ref|WP_028518112.1|  xylose isomerase                                   181   1e-50    
ref|WP_007985011.1|  MULTISPECIES: xylose isomerase                     181   1e-50    
ref|WP_028525170.1|  xylose isomerase                                   182   1e-50    
gb|EOS54587.1|  xylose isomerase                                        181   1e-50    
gb|EES74125.1|  xylose isomerase                                        181   1e-50    
ref|WP_042834224.1|  xylose isomerase                                   181   2e-50    
gb|EGI71574.1|  xylose isomerase                                        178   2e-50    
ref|WP_026672598.1|  xylose isomerase                                   181   2e-50    
ref|WP_035133012.1|  xylose isomerase                                   181   2e-50    
ref|WP_013970119.1|  xylose isomerase                                   181   2e-50    
ref|WP_007106886.1|  xylose isomerase                                   181   2e-50    
gb|EFF45521.1|  xylose isomerase                                        174   2e-50    
ref|WP_013570854.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_011943656.1|  xylose isomerase                                   181   2e-50    
ref|WP_021013961.1|  Xylose isomerase                                   181   2e-50    
ref|WP_032556812.1|  xylose isomerase                                   181   2e-50    
ref|WP_043088301.1|  xylose isomerase                                   176   2e-50    
ref|WP_019183279.1|  xylose isomerase                                   181   2e-50    
ref|WP_009051955.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_004082185.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_043106581.1|  xylose isomerase                                   176   2e-50    
ref|WP_012310984.1|  xylose isomerase                                   181   2e-50    
ref|WP_014913698.1|  xylose isomerase                                   181   2e-50    
ref|WP_029683770.1|  xylose isomerase                                   181   2e-50    
ref|WP_006990989.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_013622653.1|  xylose isomerase                                   181   2e-50    
ref|WP_015842241.1|  xylose isomerase                                   181   2e-50    
ref|WP_012994345.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_028673307.1|  MULTISPECIES: xylose isomerase                     181   2e-50    
ref|WP_028510817.1|  xylose isomerase                                   181   3e-50    
sp|Q9KGU2.1|XYLA_THEYO  RecName: Full=Xylose isomerase                  181   3e-50    
ref|WP_003868244.1|  xylose isomerase                                   181   3e-50    
ref|WP_017167923.1|  xylose isomerase                                   174   3e-50    
ref|WP_007806216.1|  xylose isomerase                                   181   3e-50    
ref|WP_026292827.1|  xylose isomerase                                   181   3e-50    
gb|AAC44473.1|  xylose isomerase                                        181   3e-50    
gb|AAC46145.1|  xylose isomerase                                        181   3e-50    
ref|WP_042674505.1|  xylose isomerase                                   174   3e-50    
ref|WP_029688173.1|  xylose isomerase                                   181   3e-50    
ref|WP_010664371.1|  xylose isomerase                                   181   3e-50    
ref|WP_028405759.1|  xylose isomerase                                   181   3e-50    
ref|WP_007131701.1|  xylose isomerase                                   181   3e-50    
ref|WP_039284980.1|  xylose isomerase                                   181   4e-50    
ref|WP_044644489.1|  xylose isomerase                                   180   4e-50    
ref|WP_039490220.1|  xylose isomerase                                   180   4e-50    
ref|WP_040043960.1|  xylose isomerase                                   180   4e-50    
ref|WP_039521824.1|  xylose isomerase                                   180   4e-50    
ref|WP_011576446.1|  xylose isomerase                                   180   4e-50    
gb|KGP56503.1|  xylose isomerase                                        174   4e-50    
ref|WP_035145587.1|  xylose isomerase                                   180   4e-50    
ref|WP_039550240.1|  xylose isomerase                                   180   4e-50    
ref|WP_032600983.1|  xylose isomerase                                   180   4e-50    
ref|WP_022352856.1|  xylose isomerase                                   173   4e-50    
ref|WP_014298921.1|  xylose isomerase                                   180   4e-50    
ref|WP_032599677.1|  xylose isomerase                                   180   4e-50    
ref|WP_035660183.1|  xylose isomerase                                   180   4e-50    
ref|WP_033837048.1|  xylose isomerase                                   174   4e-50    
ref|WP_005803483.1|  xylose isomerase                                   180   4e-50    
ref|WP_039417914.1|  xylose isomerase                                   175   4e-50    
ref|WP_038052482.1|  xylose isomerase                                   180   4e-50    
ref|WP_026313111.1|  xylose isomerase                                   180   4e-50    
ref|WP_014062099.1|  xylose isomerase                                   180   5e-50    
ref|WP_039510331.1|  xylose isomerase                                   180   5e-50    
ref|WP_025813316.1|  xylose isomerase                                   180   5e-50    
ref|WP_036626617.1|  xylose isomerase                                   180   5e-50    
ref|WP_032575525.1|  xylose isomerase                                   180   5e-50    
ref|WP_032564865.1|  xylose isomerase                                   180   5e-50    
ref|WP_010992983.1|  xylose isomerase                                   180   5e-50    
ref|WP_018887275.1|  MULTISPECIES: xylose isomerase                     180   5e-50    
ref|WP_024599023.1|  xylose isomerase                                   180   6e-50    
ref|WP_010284187.1|  xylose isomerase                                   180   6e-50    
ref|WP_032562944.1|  xylose isomerase                                   180   6e-50    
ref|WP_005787643.1|  MULTISPECIES: xylose isomerase                     180   6e-50    
ref|WP_044637928.1|  xylose isomerase                                   180   6e-50    
ref|WP_017162694.1|  xylose isomerase                                   174   6e-50    
ref|WP_024594232.1|  xylose isomerase                                   180   6e-50    
ref|WP_007375167.1|  MULTISPECIES: xylose isomerase                     180   6e-50    
ref|WP_004399926.1|  xylose isomerase                                   180   6e-50    
ref|WP_025235120.1|  xylose isomerase                                   180   6e-50    
ref|WP_007585153.1|  xylose isomerase                                   180   6e-50    
ref|WP_005820227.1|  xylose isomerase                                   180   6e-50    
ref|WP_040373941.1|  xylose isomerase                                   180   7e-50    
ref|WP_039316685.1|  xylose isomerase                                   180   7e-50    
ref|WP_022495570.1|  xylose isomerase                                   180   7e-50    
ref|WP_011091740.1|  xylose isomerase                                   180   7e-50    
ref|WP_029828866.1|  xylose isomerase                                   174   7e-50    
ref|WP_014225930.1|  xylose isomerase                                   179   7e-50    
ref|WP_028668460.1|  xylose isomerase                                   180   7e-50    
ref|WP_019678379.1|  xylose isomerase                                   179   7e-50    
ref|WP_015028484.1|  xylose isomerase                                   180   7e-50    
ref|XP_002125575.1|  PREDICTED: xylose isomerase                        180   8e-50    
ref|WP_042525629.1|  xylose isomerase                                   179   8e-50    
ref|WP_009186695.1|  xylose isomerase                                   179   8e-50    
ref|WP_029450677.1|  xylose isomerase                                   179   8e-50    
ref|WP_039483227.1|  xylose isomerase                                   179   8e-50    
ref|WP_009110894.1|  xylose isomerase                                   179   8e-50    
ref|WP_012199251.1|  xylose isomerase                                   179   8e-50    
ref|WP_005777710.1|  xylose isomerase                                   179   9e-50    
ref|WP_003464511.1|  xylose isomerase                                   179   9e-50    
ref|WP_027431549.1|  xylose isomerase                                   179   9e-50    
ref|WP_037440177.1|  xylose isomerase                                   179   9e-50    
ref|WP_042243058.1|  xylose isomerase                                   179   9e-50    
ref|WP_028520139.1|  xylose isomerase                                   179   9e-50    
ref|XP_011445523.1|  PREDICTED: xylose isomerase-like                   180   9e-50    
ref|WP_012439637.1|  xylose isomerase                                   179   1e-49    
ref|WP_025680737.1|  xylose isomerase                                   179   1e-49    
ref|WP_018972597.1|  xylose isomerase                                   179   1e-49    
ref|WP_011036932.1|  xylose isomerase                                   179   1e-49    
ref|WP_013203314.1|  xylose isomerase                                   179   1e-49    
ref|WP_044745389.1|  xylose isomerase                                   179   1e-49    
ref|WP_014507520.1|  xylose isomerase                                   179   1e-49    
ref|WP_014509528.1|  xylose isomerase                                   179   1e-49    
gb|EGD17061.1|  xylose isomerase                                        176   1e-49    
ref|WP_043091886.1|  xylose isomerase                                   179   1e-49    
ref|WP_039508364.1|  xylose isomerase                                   179   1e-49    
ref|WP_039501790.1|  xylose isomerase                                   179   1e-49    
ref|WP_017692238.1|  xylose isomerase                                   179   1e-49    
ref|WP_043910707.1|  xylose isomerase                                   175   1e-49    
ref|WP_036606941.1|  MULTISPECIES: xylose isomerase                     179   1e-49    
ref|WP_019637313.1|  xylose isomerase                                   179   2e-49    
ref|WP_013487174.1|  xylose isomerase                                   179   2e-49    
ref|WP_029765224.1|  xylose isomerase                                   171   2e-49    
ref|WP_024631388.1|  MULTISPECIES: xylose isomerase                     179   2e-49    
ref|WP_003128196.1|  xylose isomerase                                   179   2e-49    
ref|WP_015737501.1|  MULTISPECIES: xylose isomerase                     179   2e-49    
ref|WP_014278132.1|  xylose isomerase                                   179   2e-49    
ref|WP_000904406.1|  xylose isomerase                                   172   2e-49    
ref|WP_012064875.1|  xylose isomerase                                   179   2e-49    
ref|WP_005470141.1|  xylose isomerase                                   179   2e-49    
ref|WP_019113753.1|  hypothetical protein                               179   2e-49    
ref|WP_009594057.1|  xylose isomerase                                   179   2e-49    
ref|WP_019110396.1|  hypothetical protein                               179   2e-49    
gb|AGU12289.1|  Xylose isomerase-like TIM barrel                        179   2e-49    
ref|WP_013551212.1|  xylose isomerase                                   179   2e-49    
ref|WP_042598928.1|  xylose isomerase                                   179   2e-49    
ref|WP_010296596.1|  xylose isomerase                                   178   2e-49    
ref|WP_009134074.1|  xylose isomerase                                   178   2e-49    
ref|WP_039533067.1|  xylose isomerase                                   178   2e-49    
ref|WP_039474499.1|  xylose isomerase                                   178   2e-49    
ref|WP_040032255.1|  xylose isomerase                                   178   2e-49    
ref|WP_020151227.1|  hypothetical protein                               178   2e-49    
ref|WP_005883317.1|  xylose isomerase                                   178   2e-49    
ref|WP_022411455.1|  xylose isomerase                                   178   2e-49    
ref|WP_039546353.1|  xylose isomerase                                   178   2e-49    
ref|WP_022795129.1|  xylose isomerase                                   178   2e-49    
emb|CDZ23165.1|  Xylose isomerase [ [                                   178   2e-49    
ref|WP_007415126.1|  xylose isomerase                                   178   2e-49    
ref|WP_018756053.1|  xylose isomerase                                   178   2e-49    
ref|WP_024481483.1|  xylose isomerase                                   178   2e-49    
ref|WP_005186907.1|  xylose isomerase                                   178   3e-49    
ref|WP_034838066.1|  xylose isomerase [                                 178   3e-49    
ref|WP_023990311.1|  xylose isomerase                                   178   3e-49    
ref|WP_034666576.1|  xylose isomerase                                   178   3e-49    
ref|WP_009089925.1|  xylose isomerase                                   178   3e-49    
ref|WP_042568812.1|  xylose isomerase                                   178   3e-49    
ref|WP_009334243.1|  xylose isomerase                                   178   3e-49    
ref|WP_018381088.1|  xylose isomerase                                   178   3e-49    
ref|WP_019212709.1|  xylose isomerase                                   178   3e-49    
ref|WP_010754998.1|  xylose isomerase                                   178   3e-49    
ref|WP_004957122.1|  xylose isomerase                                   178   3e-49    
ref|WP_015358602.1|  MULTISPECIES: xylose isomerase XylA                178   3e-49    
ref|WP_025216446.1|  xylose isomerase                                   178   3e-49    
ref|WP_039273722.1|  xylose isomerase                                   178   3e-49    
ref|WP_042595851.1|  xylose isomerase                                   178   3e-49    
ref|WP_013311966.1|  MULTISPECIES: xylose isomerase                     178   3e-49    
emb|CDK79554.1|  Xylose isomerase                                       172   3e-49    
ref|WP_019381289.1|  xylose isomerase                                   178   3e-49    
ref|WP_016905129.1|  xylose isomerase                                   176   3e-49    
ref|WP_039413113.1|  xylose isomerase                                   173   3e-49    
ref|WP_044162815.1|  xylose isomerase                                   178   3e-49    
ref|WP_028974176.1|  xylose isomerase                                   178   3e-49    
ref|WP_032233807.1|  xylose isomerase                                   172   3e-49    
ref|WP_019081423.1|  xylose isomerase                                   178   3e-49    
ref|WP_040648148.1|  xylose isomerase                                   178   3e-49    
ref|WP_019084159.1|  xylose isomerase                                   178   3e-49    
ref|WP_039444927.1|  xylose isomerase                                   174   3e-49    
ref|WP_034688673.1|  xylose isomerase                                   178   3e-49    
ref|WP_042614034.1|  xylose isomerase                                   178   4e-49    
ref|WP_023563217.1|  xylose isomerase                                   172   4e-49    
ref|WP_022421525.1|  xylose isomerase                                   177   4e-49    
ref|WP_039307010.1|  xylose isomerase                                   177   4e-49    
ref|WP_031462245.1|  xylose isomerase                                   177   4e-49    
ref|WP_025684083.1|  xylose isomerase                                   177   4e-49    
ref|WP_016820313.1|  MULTISPECIES: xylose isomerase                     177   4e-49    
ref|WP_017117936.1|  xylose isomerase                                   174   4e-49    
ref|WP_034928100.1|  xylose isomerase                                   177   4e-49    
ref|WP_039419410.1|  xylose isomerase                                   175   4e-49    
gb|ERJ95007.1|  xylose isomerase                                        178   4e-49    
ref|WP_042505772.1|  xylose isomerase                                   177   4e-49    
ref|WP_025365846.1|  xylose isomerase                                   177   4e-49    
ref|WP_041883538.1|  xylose isomerase                                   177   4e-49    
ref|WP_036824795.1|  xylose isomerase                                   177   4e-49    
ref|WP_042131068.1|  MULTISPECIES: xylose isomerase                     177   5e-49    
ref|WP_007432158.1|  xylose isomerase                                   177   5e-49    
ref|WP_039516200.1|  xylose isomerase                                   177   5e-49    
ref|WP_022825466.1|  xylose isomerase                                   177   5e-49    
ref|WP_036730361.1|  xylose isomerase                                   177   5e-49    
ref|WP_027624313.1|  xylose isomerase                                   177   5e-49    
ref|WP_029519214.1|  xylose isomerase                                   177   5e-49    
ref|WP_016775947.1|  xylose isomerase                                   177   5e-49    
ref|WP_036680248.1|  MULTISPECIES: xylose isomerase                     177   5e-49    
gb|ACA65427.1|  xylose isomerase                                        177   5e-49    
ref|WP_004713833.1|  xylose isomerase                                   177   5e-49    
gb|KGU38312.1|  xylose isomerase                                        174   6e-49    
ref|WP_013373089.1|  xylose isomerase                                   177   6e-49    
gb|KHI92157.1|  xylose isomerase                                        172   6e-49    
ref|WP_002363086.1|  xylose isomerase                                   177   6e-49    
ref|WP_010774172.1|  xylose isomerase                                   177   6e-49    
ref|WP_042826898.1|  xylose isomerase                                   174   6e-49    



>gb|EYU42442.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
 gb|EYU42443.1| hypothetical protein MIMGU_mgv1a0056111mg, partial [Erythranthe 
guttata]
Length=261

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVMLSV
Sbjct  91   NIECNHATLSGHSCHHEIETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLSV  150

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  151  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLDELVRK  210

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+ELGA IE GK DF++LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  211  RYQSFDTELGAQIEAGKTDFDVLEKKAIEWGEPKVASAKQELAEMIFQSAL  261



>ref|XP_006343543.1| PREDICTED: xylose isomerase-like [Solanum tuberosum]
Length=481

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETARINGLLGNIDANSGDPQ GWDTDQF MDVAEATLVM +V
Sbjct  311  NIECNHATLAGHSCHHELETARINGLLGNIDANSGDPQIGWDTDQFLMDVAEATLVMQTV  370

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL +LVRK
Sbjct  371  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSDLVRK  430

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  431  RYQSFDSELGAAIESGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>ref|XP_009801815.1| PREDICTED: xylose isomerase [Nicotiana sylvestris]
Length=481

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDVAEATLVM +V
Sbjct  311  NIECNHATLAGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLMDVAEATLVMQTV  370

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  371  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLGELVRK  430

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+ELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  431  RYQSFDTELGAAIEAGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>emb|CDP02939.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDANSGDPQTGWDTDQF MD+ EATLVMLSV
Sbjct  308  NIECNHATLSGHSCHHELETARINGLLGNIDANSGDPQTGWDTDQFLMDIQEATLVMLSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FI HI GMDTLARGLR+AAKLIEDGSL E++RK
Sbjct  368  IRNGGLAPGGFNFDAKLRRESTDVEDLFIGHIAGMDTLARGLRNAAKLIEDGSLDEIIRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSELGA IE GKADFELLEKKA EWGEPKVPSAKQELAEMILQ+AL
Sbjct  428  RYQSFDSELGAQIEAGKADFELLEKKAKEWGEPKVPSAKQELAEMILQAAL  478



>ref|XP_009606829.1| PREDICTED: xylose isomerase [Nicotiana tomentosiformis]
Length=481

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDVAEATLVM +V
Sbjct  311  NIECNHATLAGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLMDVAEATLVMQTV  370

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELV+K
Sbjct  371  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSELVKK  430

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+ELGAAIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  431  RYQSFDTELGAAIEAGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>ref|XP_002532409.1| Xylose isomerase, putative [Ricinus communis]
 gb|EEF29973.1| Xylose isomerase, putative [Ricinus communis]
Length=477

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM+SV
Sbjct  307  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDIAEATLVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  367  IRNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRNAAKLIEDGSLAELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  427  RYESFDTEIGAQIEAGKADFEMLEKKAIEWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_004242672.1| PREDICTED: xylose isomerase [Solanum lycopersicum]
Length=481

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETARINGLLGNIDANSGDPQ GWDTDQF MDVAEATLVM +V
Sbjct  311  NIECNHATLAGHSCHHELETARINGLLGNIDANSGDPQIGWDTDQFLMDVAEATLVMQTV  370

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTD+EDIFIAHI GMDTLARGLR+AAKLIE+GSL +LVRK
Sbjct  371  IKNGGLAPGGFNFDAKLRRESTDIEDIFIAHIAGMDTLARGLRNAAKLIEEGSLNDLVRK  430

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSELG+AIE GKADFELLEKKALEWGEPKVPS KQELAEMI QSAL
Sbjct  431  RYQSFDSELGSAIESGKADFELLEKKALEWGEPKVPSGKQELAEMIFQSAL  481



>ref|XP_011079316.1| PREDICTED: xylose isomerase [Sesamum indicum]
 ref|XP_011079317.1| PREDICTED: xylose isomerase [Sesamum indicum]
Length=477

 Score =   321 bits (822),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVMLSV
Sbjct  307  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  367  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIAGMDTLARGLRNAAKLIEDGSLSELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSELGA IE GKADFE+LEKKA+ WGEPKV SAKQELAEMI QSAL
Sbjct  427  RYQSFDSELGAEIEAGKADFEVLEKKAIAWGEPKVASAKQELAEMIFQSAL  477



>gb|EYU34279.1| hypothetical protein MIMGU_mgv1a005575mg [Erythranthe guttata]
Length=478

 Score =   320 bits (821),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV EATLVML+V
Sbjct  308  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVGEATLVMLTV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVEDIFIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  368  VKNGGIAPGGFNFDAKLRRESTDVEDIFIAHIAGMDTLARGLRNAAKLIEDGSLNELVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSELGA IE GKADFE+LEKKA EWGEPKV SAKQELAEMI QSAL
Sbjct  428  RYQSFDSELGALIEAGKADFEMLEKKAKEWGEPKVASAKQELAEMIFQSAL  478



>gb|KDP43806.1| hypothetical protein JCGZ_23014 [Jatropha curcas]
Length=477

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  307  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+AA+LIEDGSL ELVRK
Sbjct  367  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNAARLIEDGSLAELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFE LEKKA EWGEPKVPSAKQELAEMI QSAL
Sbjct  427  RYQSFDTEIGAQIEAGKADFETLEKKAFEWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_010688509.1| PREDICTED: xylose isomerase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   318 bits (816),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSV
Sbjct  316  NIECNHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSV  375

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+K
Sbjct  376  IKNGGMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKK  435

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  436  RYQSFDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  486



>ref|XP_010688511.1| PREDICTED: xylose isomerase isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSV
Sbjct  305  NIECNHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSV  364

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+K
Sbjct  365  IKNGGMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKK  424

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  425  RYQSFDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  475



>ref|XP_010688508.1| PREDICTED: xylose isomerase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARINGLLGNIDANSGDPQTGWDTDQF  D+AEAT+VMLSV
Sbjct  347  NIECNHATLSGHSCHHDLETARINGLLGNIDANSGDPQTGWDTDQFMTDIAEATMVMLSV  406

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAH+ GMDT+ARGLR+AAKLIEDGSL ELV+K
Sbjct  407  IKNGGMAPGGFNFDAKLRRESTDVEDLFIAHVSGMDTMARGLRNAAKLIEDGSLGELVKK  466

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GKADFE LEKKA+EWGEPKVPS KQELAEMI QSAL
Sbjct  467  RYQSFDSEIGAKIEAGKADFEYLEKKAIEWGEPKVPSGKQELAEMIFQSAL  517



>ref|XP_002277520.2| PREDICTED: xylose isomerase [Vitis vinifera]
 ref|XP_010656801.1| PREDICTED: xylose isomerase [Vitis vinifera]
Length=478

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  308  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIEDGSL+ LVRK
Sbjct  368  VRNGGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDGSLENLVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  428  RYQSFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  478



>ref|XP_003549495.1| PREDICTED: xylose isomerase [Glycine max]
Length=480

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSV
Sbjct  310  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  370  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIEDGSLAELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFELLEKK  EWGEPKV SAKQELAEMILQS L
Sbjct  430  RYQSFDTEIGAQIEAGKADFELLEKKVKEWGEPKVASAKQELAEMILQSVL  480



>ref|XP_008452100.1| PREDICTED: xylose isomerase [Cucumis melo]
 ref|XP_008452108.1| PREDICTED: xylose isomerase [Cucumis melo]
Length=476

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNH TLSGHSCHH++ETAR+NG+LG+IDAN+GDPQ GWDTDQF MD++EAT+VMLSV
Sbjct  306  NIECNHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMMDLSEATMVMLSV  365

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL ELVRK
Sbjct  366  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLTELVRK  425

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKALEWGEPKVPSAKQELAEMI QSAL
Sbjct  426  RYESFDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL  476



>emb|CBI17768.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  356  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSV  415

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIEDGSL+ LVRK
Sbjct  416  VRNGGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDGSLENLVRK  475

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  476  RYQSFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  526



>gb|KGN61107.1| hypothetical protein Csa_2G049960 [Cucumis sativus]
Length=476

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNH TLSGHSCHH++ETAR+NG+LG+IDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  306  NIECNHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMTDIAEATMVMLSV  365

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL ELVRK
Sbjct  366  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLTELVRK  425

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKALEWGEPKVPSAKQELAEMI QSAL
Sbjct  426  RYESFDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL  476



>gb|KHN17567.1| Xylose isomerase [Glycine soja]
Length=480

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSV
Sbjct  310  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  370  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIEDGSLAELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFELLEKK  EWGEPKV SAKQELAEMILQS L
Sbjct  430  RYQSFDTEIGAQIEAGKADFELLEKKVKEWGEPKVASAKQELAEMILQSVL  480



>ref|XP_004149070.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
 ref|XP_004166789.1| PREDICTED: xylose isomerase-like [Cucumis sativus]
Length=476

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNH TLSGHSCHH++ETAR+NG+LG+IDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  306  NIECNHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMTDIAEATMVMLSV  365

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL ELVRK
Sbjct  366  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLTELVRK  425

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKALEWGEPKVPSAKQELAEMI QSAL
Sbjct  426  RYESFDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL  476



>ref|XP_006453438.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
 ref|XP_006474142.1| PREDICTED: xylose isomerase-like [Citrus sinensis]
 gb|ESR66678.1| hypothetical protein CICLE_v10008154mg [Citrus clementina]
Length=478

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+ EAT +MLSV
Sbjct  308  NIECNHATLSGHSCHHDIETARLNGLLGNIDANTGDPQVGWDTDQFLTDIGEATSIMLSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRK
Sbjct  368  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTVARGLRTAAKLIEDGSLPELVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+G  IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSA+
Sbjct  428  RYQSFDSEIGQKIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAI  478



>gb|KDO62435.1| hypothetical protein CISIN_1g0373932mg, partial [Citrus sinensis]
Length=487

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+ EAT +MLSV
Sbjct  317  NIECNHATLSGHSCHHDIETARLNGLLGNIDANTGDPQVGWDTDQFLTDIGEATSIMLSV  376

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRK
Sbjct  377  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTVARGLRTAAKLIEDGSLPELVRK  436

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+G  IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSA+
Sbjct  437  RYQSFDSEIGQKIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAI  487



>emb|CAN65150.1| hypothetical protein VITISV_037086 [Vitis vinifera]
Length=462

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTDQF  D+AEAT+VMLSV
Sbjct  292  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMLSV  351

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FI+HI GMDTLARGLR+ AKLIED SL+ LVRK
Sbjct  352  VRNGGLAPGGFNFDAKLRRESTDVEDLFISHISGMDTLARGLRNVAKLIEDXSLENLVRK  411

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFE+LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  412  RYQSFDTEIGAQIEAGKADFEMLEKKAMEWGEPKVPSAKQELAEMIFQSAL  462



>ref|XP_010259769.1| PREDICTED: xylose isomerase isoform X2 [Nelumbo nucifera]
Length=479

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATMVMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  369  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHITGMDTLARGLRNVAKLIEDGSLAELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LE KA+EWGEPKVPSAKQELAEM+ QSAL
Sbjct  429  RYESFDTEIGAQIEAGKADFEFLETKAMEWGEPKVPSAKQELAEMVFQSAL  479



>ref|XP_004958625.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV
Sbjct  310  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVEDIFIAHI GMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  370  VKNGGLAPGGFNFDAKLRRESTDVEDIFIAHISGMDTLARGLRNVAKLIEDGSLDELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  430  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  480



>gb|KJB60240.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSV
Sbjct  304  NIECNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSV  363

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  364  IRNGGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRK  423

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  424  RYSSFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  474



>ref|XP_011069881.1| PREDICTED: xylose isomerase-like [Sesamum indicum]
Length=475

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF MDV+EATLVMLSV
Sbjct  305  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMMDVSEATLVMLSV  364

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHI GMDT+ARGLR+AAKL+ DG L ELVR+
Sbjct  365  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIAGMDTVARGLRNAAKLLADGLLSELVRQ  424

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+ELGA IE GK DF+LLEKKA+EWGEP V SAKQELAEMI QSAL
Sbjct  425  RYQSFDTELGAQIEAGKGDFDLLEKKAIEWGEPTVASAKQELAEMIFQSAL  475



>gb|KJB60238.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
 gb|KJB60242.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=475

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSV
Sbjct  305  NIECNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSV  364

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  365  IRNGGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRK  424

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  425  RYSSFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  475



>gb|KJB60239.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=474

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSV
Sbjct  304  NIECNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSV  363

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  364  IRNGGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRK  423

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  424  RYSSFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  474



>ref|XP_010938719.1| PREDICTED: xylose isomerase [Elaeis guineensis]
Length=479

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVMLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIAEATLVMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  369  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDSE+GA IE GKADFE LEKKA+EWGEP V S KQELAEMI QSAL
Sbjct  429  RYSSFDSEIGALIEAGKADFETLEKKAMEWGEPSVASGKQELAEMIFQSAL  479



>ref|XP_008223675.1| PREDICTED: xylose isomerase [Prunus mume]
Length=479

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQTGWDTDQF  D+AEATLVML+V
Sbjct  309  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQTGWDTDQFLTDIAEATLVMLTV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KLIEDGSL ELVRK
Sbjct  369  VKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVVKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEM+ QS L
Sbjct  429  RYESFDTEIGAHIEAGKGDFEYLEKKAIEWGEPKVPSAKQELAEMLFQSVL  479



>ref|XP_010259768.1| PREDICTED: xylose isomerase isoform X1 [Nelumbo nucifera]
Length=515

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV
Sbjct  345  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATMVMLSV  404

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  405  VRNGGLAPGGFNFDAKLRRESTDVEDLFIAHITGMDTLARGLRNVAKLIEDGSLAELVRK  464

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LE KA+EWGEPKVPSAKQELAEM+ QSAL
Sbjct  465  RYESFDTEIGAQIEAGKADFEFLETKAMEWGEPKVPSAKQELAEMVFQSAL  515



>gb|KHG02217.1| Xylose isomerase -like protein [Gossypium arboreum]
Length=475

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VM+SV
Sbjct  305  NIECNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMISV  364

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELV K
Sbjct  365  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVSK  424

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQELAEMI QSAL
Sbjct  425  RYSSFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQELAEMIFQSAL  475



>ref|XP_011018165.1| PREDICTED: xylose isomerase [Populus euphratica]
 ref|XP_011018166.1| PREDICTED: xylose isomerase [Populus euphratica]
Length=477

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EAT+VMLSV
Sbjct  307  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDISEATMVMLSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRREST+VEDIF+AHI GMDTLARGLRSAAKLI+DGSL ELVRK
Sbjct  367  IRNGGLAPGGFNFDAKLRRESTEVEDIFLAHISGMDTLARGLRSAAKLIQDGSLAELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA +E GK DFE LEK A++WGEPKVPSAKQELAEMI QSAL
Sbjct  427  RYQSFDTEIGAQVEAGKGDFETLEKLAMKWGEPKVPSAKQELAEMIFQSAL  477



>ref|XP_007222807.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
 gb|EMJ24006.1| hypothetical protein PRUPE_ppa005065mg [Prunus persica]
Length=479

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQTGWDTDQF  D+AEATLVML+V
Sbjct  309  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQTGWDTDQFLTDIAEATLVMLTV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KLIEDGSL ELVRK
Sbjct  369  VKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVVKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GK DFE LEKKA+EWGEP+VPSAKQELAEM+ QS L
Sbjct  429  RYESFDTEIGAHIEAGKGDFEYLEKKAIEWGEPRVPSAKQELAEMLFQSVL  479



>ref|XP_002324488.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
 gb|EEF03053.1| hypothetical protein POPTR_0018s10460g [Populus trichocarpa]
Length=477

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EAT+VM+SV
Sbjct  307  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDISEATMVMISV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRREST+VEDIF+AHI GMDTLARGLRSAAKLI+DGSL ELVRK
Sbjct  367  IRNGGLAPGGFNFDAKLRRESTEVEDIFLAHISGMDTLARGLRSAAKLIQDGSLAELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GK DFE LEK A++WGEPKVPSAKQELAEMI QSAL
Sbjct  427  RYQSFDTEIGAQIEAGKGDFETLEKLAMKWGEPKVPSAKQELAEMIFQSAL  477



>gb|ACJ84879.1| unknown [Medicago truncatula]
Length=329

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDT+QF +D+ EAT++MLSV
Sbjct  159  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTNQFLVDIQEATMIMLSV  218

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFD KLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRK
Sbjct  219  IRNGGIAPGGFNFDVKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRK  278

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  279  RYQSFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  329



>ref|XP_009391575.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKL EDGSL ELVRK
Sbjct  369  VRNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLTEDGSLAELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFE LEKK +EWGEP VPS KQELAEMI QSAL
Sbjct  429  RYQSFDTEIGALIEAGKADFETLEKKVMEWGEPSVPSGKQELAEMIFQSAL  479



>ref|XP_004958079.1| PREDICTED: xylose isomerase-like [Setaria italica]
Length=480

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V
Sbjct  310  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  370  VKNGGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLRNVAKLIEDGSLDELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  430  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  480



>ref|XP_008796228.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796229.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
 ref|XP_008796230.1| PREDICTED: xylose isomerase isoform X2 [Phoenix dactylifera]
Length=483

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGN+DAN+GDPQ GWDTDQF  D+AEATLVMLSV
Sbjct  313  NIECNHATLSGHSCHHELETARINGLLGNVDANTGDPQIGWDTDQFLTDIAEATLVMLSV  372

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL + AKLIEDGSL ELVRK
Sbjct  373  VRNGGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLHNVAKLIEDGSLDELVRK  432

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+E+GA +E GKADFE LEKKA+EWGEP VPS KQELAEMI QSAL
Sbjct  433  RYSSFDTEIGALVEAGKADFETLEKKAMEWGEPSVPSGKQELAEMIFQSAL  483



>ref|XP_004507817.1| PREDICTED: xylose isomerase-like isoform X3 [Cicer arietinum]
Length=479

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRK
Sbjct  369  IRNDGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRTAAKLIEDGSLAELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADF+LLEKKA EWGEPKV SAKQELAEMI QSA+
Sbjct  429  RYQSFDTEIGAQIEAGKADFDLLEKKAKEWGEPKVASAKQELAEMIFQSAI  479



>ref|XP_010065878.1| PREDICTED: xylose isomerase-like isoform X3 [Eucalyptus grandis]
Length=480

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETAR+NGL GN+DAN+GDPQ GWDTDQF  D+ EATLVMLSV
Sbjct  310  NVECNHATLSGHSCHHELETARLNGLFGNLDANTGDPQIGWDTDQFLTDIGEATLVMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGG NFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  370  VRNGGLAPGGINFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLIEDGSLDELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  430  RYESFDTEFGAQIEAGKVDFETLEKKAMEWGEPKVPSAKQELAEMIFQSAL  480



>ref|XP_007154797.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
 gb|ESW26791.1| hypothetical protein PHAVU_003G148700g [Phaseolus vulgaris]
Length=479

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSC HE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSV
Sbjct  309  NIECNHATLSGHSCQHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLI+DGSL ELVRK
Sbjct  369  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIKDGSLSELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFELLEKK  EWGEP V SAKQELAEMI QSAL
Sbjct  429  RYQSFDTEIGAQIEAGKADFELLEKKVKEWGEPTVASAKQELAEMIFQSAL  479



>gb|KCW63564.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
 gb|KCW63565.1| hypothetical protein EUGRSUZ_G01193 [Eucalyptus grandis]
Length=495

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETAR+NGL GN+DAN+GDPQ GWDTDQF  D+ EATLVMLSV
Sbjct  325  NVECNHATLSGHSCHHELETARLNGLFGNLDANTGDPQIGWDTDQFLTDIGEATLVMLSV  384

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGG NFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKLIEDGSL ELVRK
Sbjct  385  VRNGGLAPGGINFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLIEDGSLDELVRK  444

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E GA IE GK DFE LEKKA+EWGEPKVPSAKQELAEMI QSAL
Sbjct  445  RYESFDTEFGAQIEAGKVDFETLEKKAMEWGEPKVPSAKQELAEMIFQSAL  495



>ref|XP_009348411.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV
Sbjct  307  NIECNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL +LVRK
Sbjct  367  VKNGGIAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLVEDGSLPDLVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM+ QS L
Sbjct  427  RYKSFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMLFQSVL  477



>ref|XP_007011128.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
 gb|EOY19938.1| Xylose isomerase family protein isoform 2 [Theobroma cacao]
Length=471

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV
Sbjct  301  NIECNHATLSGHSCHHDLETARINGLLGNIDANTGDPQIGWDTDQFMTDIGEATMVMLSV  360

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  361  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLVELVRK  420

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+E+GA IE GKADFE+LEK A EWGEPKV SAKQELAEMI QSAL
Sbjct  421  RYSSFDTEIGAEIEAGKADFEMLEKLAKEWGEPKVASAKQELAEMIFQSAL  471



>ref|XP_008796227.1| PREDICTED: xylose isomerase isoform X1 [Phoenix dactylifera]
Length=529

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGN+DAN+GDPQ GWDTDQF  D+AEATLVMLSV
Sbjct  359  NIECNHATLSGHSCHHELETARINGLLGNVDANTGDPQIGWDTDQFLTDIAEATLVMLSV  418

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL + AKLIEDGSL ELVRK
Sbjct  419  VRNGGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLHNVAKLIEDGSLDELVRK  478

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+E+GA +E GKADFE LEKKA+EWGEP VPS KQELAEMI QSAL
Sbjct  479  RYSSFDTEIGALVEAGKADFETLEKKAMEWGEPSVPSGKQELAEMIFQSAL  529



>ref|XP_010102992.1| Xylose isomerase [Morus notabilis]
 gb|EXB94559.1| Xylose isomerase [Morus notabilis]
Length=482

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETAR+N LLGNIDAN+GDPQ GWDTDQF  D+AEAT+VM SV
Sbjct  312  NIECNHATLAGHSCHHELETARLNDLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMQSV  371

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL +AAK+IEDGSL ELVRK
Sbjct  372  VKNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLCNAAKIIEDGSLAELVRK  431

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFELLEKKAL+WGEPKVPSAKQELAEMI QSAL
Sbjct  432  RYASFDTELGALIETGKADFELLEKKALQWGEPKVPSAKQELAEMIFQSAL  482



>gb|AES92376.2| xylose isomerase [Medicago truncatula]
Length=480

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSV
Sbjct  310  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRK
Sbjct  370  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  430  RYQSFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  480



>ref|XP_009336656.1| PREDICTED: xylose isomerase-like [Pyrus x bretschneideri]
Length=477

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV
Sbjct  307  NIECNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVED+FIAHIGGMDTLARGLR+ AKL+EDGSL +LVRK
Sbjct  367  VKNGGIAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLVEDGSLPDLVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM  QS L
Sbjct  427  RYKSFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMHFQSVL  477



>ref|XP_003610179.1| Xylose isomerase [Medicago truncatula]
Length=478

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSV
Sbjct  308  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRK
Sbjct  368  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  428  RYQSFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  478



>ref|XP_010102993.1| Xylose isomerase [Morus notabilis]
 gb|EXB94560.1| Xylose isomerase [Morus notabilis]
Length=523

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSCHHE+ETAR+N LLGNIDAN+GDPQ GWDTDQF  D+AEAT+VM SV
Sbjct  353  NIECNHATLAGHSCHHELETARLNDLLGNIDANTGDPQIGWDTDQFLTDIAEATMVMQSV  412

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGL +AAK+IEDGSL ELVRK
Sbjct  413  VKNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLCNAAKIIEDGSLAELVRK  472

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+ELGA IE GKADFELLEKKAL+WGEPKVPSAKQELAEMI QSAL
Sbjct  473  RYASFDTELGALIETGKADFELLEKKALQWGEPKVPSAKQELAEMIFQSAL  523



>ref|XP_008365436.1| PREDICTED: xylose isomerase-like [Malus domestica]
 ref|XP_008365437.1| PREDICTED: xylose isomerase-like [Malus domestica]
Length=477

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSC+HE+ETAR+NGLLGN+DAN+GDPQTGWDTDQF  D+AEATLVM SV
Sbjct  307  NIECNHATLSGHSCYHELETARLNGLLGNVDANTGDPQTGWDTDQFLTDIAEATLVMQSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+ AKL+EDGSL +LVRK
Sbjct  367  VKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNVAKLVEDGSLPDLVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GKADFE LEKKA+EWGEP VPSAKQELAEM+ QS L
Sbjct  427  RYKSFDTEVGALIEAGKADFEYLEKKAIEWGEPTVPSAKQELAEMLFQSVL  477



>ref|XP_007011127.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY19937.1| Xylose isomerase family protein isoform 1 [Theobroma cacao]
Length=538

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EAT+VMLSV
Sbjct  368  NIECNHATLSGHSCHHDLETARINGLLGNIDANTGDPQIGWDTDQFMTDIGEATMVMLSV  427

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  428  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLVELVRK  487

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+E+GA IE GKADFE+LEK A EWGEPKV SAKQELAEMI QSAL
Sbjct  488  RYSSFDTEIGAEIEAGKADFEMLEKLAKEWGEPKVASAKQELAEMIFQSAL  538



>dbj|BAD95103.1| xylose isomerase [Arabidopsis thaliana]
Length=233

 Score =   297 bits (760),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  63   NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  122

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  123  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRK  182

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  183  RYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  233



>ref|XP_009417936.1| PREDICTED: xylose isomerase-like [Musa acuminata subsp. malaccensis]
Length=479

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+  KL EDGSL ELVRK
Sbjct  369  VRNGGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTLARGLRNVQKLTEDGSLAELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+G+ IE GKADFE LEK+A+EW EP VPS KQELAEMI QSAL
Sbjct  429  RYQSFDTEIGSLIEAGKADFETLEKQAMEWDEPSVPSGKQELAEMIFQSAL  479



>ref|XP_006658089.1| PREDICTED: xylose isomerase-like [Oryza brachyantha]
Length=480

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV
Sbjct  310  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KL+EDGSL +LVRK
Sbjct  370  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLMEDGSLDDLVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  430  RYQSFDSEIGAIIEAGKGDFETLEKKVLEWGEPSVPSGKQELAEMLFQSAL  480



>gb|AFK39166.1| unknown [Medicago truncatula]
Length=480

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDT+QF +D+ EAT++MLSV
Sbjct  310  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTNQFLVDIQEATMIMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFD KLRRESTDVED+FIAHI GMDT+ARGLR+AAKL+EDGSL ELVRK
Sbjct  370  IRNGGIAPGGFNFDVKLRRESTDVEDLFIAHIVGMDTMARGLRNAAKLVEDGSLAELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADF+ LEKK  EWGEPKV SAKQELAEMI Q+A+
Sbjct  430  RYQSFDTEIGAQIEAGKADFDFLEKKVKEWGEPKVASAKQELAEMIFQNAM  480



>ref|NP_001132889.1| putative xylose isomerase family protein precursor [Zea mays]
 gb|ACF81922.1| unknown [Zea mays]
 gb|ACG41148.1| xylose isomerase [Zea mays]
 tpg|DAA41688.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=482

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V
Sbjct  312  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTV  371

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+AAKLIEDGSL  LVRK
Sbjct  372  VKNGGLAPGGFNFDAKLRRESTDVEDLFLAHISGMDTLARGLRNAAKLIEDGSLDALVRK  431

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++  SAL
Sbjct  432  RYQSFDSEIGALIEAGKGDFEALEKKVLEWGEPTVPSGKQELAEILFHSAL  482



>gb|EPS67638.1| xylose isomerase [Genlisea aurea]
Length=472

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQ GWDTDQF MDVAEAT+VMLSV
Sbjct  302  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQVGWDTDQFMMDVAEATMVMLSV  361

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FI HI GMDTLARGLR+A KLIE+G L E+V+K
Sbjct  362  IKNGGLAPGGFNFDAKLRRESTDVEDMFIGHIAGMDTLARGLRNARKLIEEGQLSEIVKK  421

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFDSELG  IE G  DFELLEKKA+E GEP+V S KQELAEMI QSAL
Sbjct  422  RYKSFDSELGGEIEAGNGDFELLEKKAVELGEPQVASGKQELAEMIFQSAL  472



>ref|XP_003562496.1| PREDICTED: xylose isomerase [Brachypodium distachyon]
Length=479

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTD+F  D++EATLVM SV
Sbjct  309  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDEFLTDISEATLVMSSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRK
Sbjct  369  VKNDGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTMARGLRNVAKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  429  RYQSFDTEIGAMIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEMLFQSAL  479



>gb|EEC82655.1| hypothetical protein OsI_27268 [Oryza sativa Indica Group]
 gb|EEE67782.1| hypothetical protein OsJ_25511 [Oryza sativa Japonica Group]
Length=478

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV
Sbjct  308  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KLIEDGSL ELVRK
Sbjct  368  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDGSLDELVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++ Q+AL
Sbjct  428  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL  478



>ref|NP_001060585.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAC83596.1| putative xylose isomerase [Oryza sativa Japonica Group]
 dbj|BAF22499.1| Os07g0669100 [Oryza sativa Japonica Group]
 dbj|BAG92890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D++EATLVM SV
Sbjct  309  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISEATLVMSSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+  KLIEDGSL ELVRK
Sbjct  369  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++ Q+AL
Sbjct  429  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL  479



>gb|EMS46439.1| Xylose isomerase [Triticum urartu]
Length=445

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV
Sbjct  275  NVECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRK
Sbjct  335  VKNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRK  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  395  RYQSFDTEIGAMIEAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  445



>gb|ACG42142.1| xylose isomerase [Zea mays]
Length=484

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM +V
Sbjct  314  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSTV  373

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+AAKLIEDGSL  LVRK
Sbjct  374  VKNGGLAPGGFNFDAKLRRESTDVEDLFLAHISGMDTLARGLRNAAKLIEDGSLDALVRK  433

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFDSE+GA IE GK DFE LEKK LEWGEP VPS KQELAE++  SAL
Sbjct  434  RYRSFDSEMGALIEAGKGDFEALEKKVLEWGEPTVPSGKQELAEILFHSAL  484



>ref|XP_004297371.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
 ref|XP_011463128.1| PREDICTED: xylose isomerase [Fragaria vesca subsp. vesca]
Length=478

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETAR+NGLLGNIDAN+GDPQ GWDTD+F  D+AEAT VML+V
Sbjct  308  NIECNHATLSGHSCHHELETARLNGLLGNIDANTGDPQIGWDTDEFLTDIAEATRVMLTV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGL + AKLIEDGSL ELVRK
Sbjct  368  VKNGGLAPGGFNFDAKLRRESTDVEDLFVAHISGMDTLARGLHNVAKLIEDGSLAELVRK  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+E+GA IE GK DFE LEKKA+EWGEPKVPSAKQELAE + Q AL
Sbjct  428  RYESFDTEVGAQIEAGKGDFEYLEKKAMEWGEPKVPSAKQELAERLFQFAL  478



>gb|AGV54617.1| xylose isomerase [Phaseolus vulgaris]
Length=480

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHA LSGHSC HE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EATL+MLSV
Sbjct  310  NIECNHAPLSGHSCQHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATLIMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDTLARGLR+AAKLI+DGSL ELVRK
Sbjct  370  IRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTLARGLRNAAKLIKDGSLFELVRK  429

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GKADFELLEKK  EWGEP V  AKQELAEMI Q AL
Sbjct  430  RYQSFDTEIGAQIEAGKADFELLEKKVKEWGEPTVAFAKQELAEMIFQFAL  480



>gb|ACG35698.1| xylose isomerase [Zea mays]
Length=484

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV
Sbjct  314  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSV  373

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+ HI GMDTLARGLR+ AKLIEDGSL +LVRK
Sbjct  374  VKNGGLAPGGFNFDAKLRRESTDVEDMFLVHISGMDTLARGLRNVAKLIEDGSLDDLVRK  433

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDS++GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  434  RYQSFDSDIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  484



>ref|NP_001132653.1| uncharacterized protein LOC100194128 precursor [Zea mays]
 ref|XP_008650948.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 ref|XP_008650949.1| PREDICTED: uncharacterized protein LOC100194128 isoform X1 [Zea 
mays]
 gb|ACF81585.1| unknown [Zea mays]
Length=484

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV
Sbjct  314  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSV  373

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRK
Sbjct  374  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRK  433

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  434  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  484



>ref|XP_008650947.1| PREDICTED: uncharacterized protein LOC100194128 isoform X2 [Zea 
mays]
Length=533

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV
Sbjct  363  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSV  422

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRK
Sbjct  423  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRK  482

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  483  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  533



>dbj|BAJ96683.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV
Sbjct  309  NVECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRK
Sbjct  369  VKNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  429  RYQSFDTEIGAMIETGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  479



>ref|XP_006845583.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
 gb|ERN07258.1| hypothetical protein AMTR_s00019p00197750 [Amborella trichopoda]
Length=477

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARING LGNIDAN+GDPQ GWDTDQF  D+ EATLVMLSV
Sbjct  307  NIECNHATLSGHSCHHELETARINGALGNIDANTGDPQIGWDTDQFLTDIGEATLVMLSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGG+APGGFNFDAKLRRESTDVEDIF+AHI GMDT+ARGLR+ AKL+EDGSL EL+RK
Sbjct  367  VRNGGIAPGGFNFDAKLRRESTDVEDIFLAHISGMDTMARGLRNVAKLMEDGSLSELIRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFD+E GA IE GK DFE LEKKA+EWGEP V S KQELAEMI +SAL
Sbjct  427  RYASFDTEFGAEIEAGKVDFETLEKKAMEWGEPAVASGKQELAEMIFRSAL  477



>tpg|DAA64057.1| TPA: putative xylose isomerase family protein [Zea mays]
Length=559

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF  D+AEATLVM SV
Sbjct  389  NVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTDIAEATLVMSSV  448

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGGFNFDAKLRRESTDVED+F+AHI GMDTLARGLR+ AKLI DGSL +LVRK
Sbjct  449  VKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVAKLIGDGSLDDLVRK  508

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFDSE+GA IE GK DFE LEKK LEWGEP V S KQELAE++ QSAL
Sbjct  509  RYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPTVASGKQELAEILFQSAL  559



>ref|XP_010539451.1| PREDICTED: xylose isomerase [Tarenaya hassleriana]
Length=477

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDANSGD QTGWDTDQF  DVAEAT++M SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANSGDAQTGWDTDQFLTDVAEATMIMFSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIE+G+L E+V K
Sbjct  367  IKNGGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAAKLIEEGTLGEVVSK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA EWGE KV SAKQELAEMI QSAL
Sbjct  427  RYSSWDSELGKQIEEGKADFEYLEKKAKEWGEMKVASAKQELAEMIFQSAL  477



>emb|CDY49729.1| BnaA10g11590D [Brassica napus]
Length=477

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++E+G L ELV K
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEEGRLSELVGK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  427  RYSSWDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  477



>gb|EMT06905.1| Xylose isomerase [Aegilops tauschii]
Length=450

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV
Sbjct  276  NVECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSV  335

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+ AKLIEDGSL ELVRK
Sbjct  336  VKNDGLAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNVAKLIEDGSLDELVRK  395

Query  312  RYQSFDSELGAAIE----GGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE     GK DFE LEKK LEWGEP VPS KQELAEM+ QSAL
Sbjct  396  RYQSFDTEIGAMIEVHKLAGKGDFETLEKKVLEWGEPTVPSGKQELAEMLFQSAL  450



>emb|CDY25894.1| BnaC09g32660D [Brassica napus]
Length=491

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  D+ EAT+VM+SV
Sbjct  321  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDLGEATMVMMSV  380

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++EDG L ELV K
Sbjct  381  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEDGRLSELVGK  440

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  441  RYSSWDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  491



>ref|XP_009120281.1| PREDICTED: xylose isomerase [Brassica rapa]
 ref|XP_009120282.1| PREDICTED: xylose isomerase [Brassica rapa]
Length=477

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAK++E+G L ELV K
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTVARGLRNAAKILEEGRLSELVGK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  427  RYSSWDSELGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  477



>ref|NP_568861.3| xylose isomerase [Arabidopsis thaliana]
 sp|Q9FKK7.2|XYLA_ARATH RecName: Full=Xylose isomerase [Arabidopsis thaliana]
 gb|AAM97134.1| expressed protein; supported by full length cDNA: Ceres: 122798 
[Arabidopsis thaliana]
 gb|AAP31951.1| At5g57655 [Arabidopsis thaliana]
 gb|AED96932.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>dbj|BAE98492.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_006401183.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
 gb|ESQ42636.1| hypothetical protein EUTSA_v10013406mg [Eutrema salsugineum]
Length=482

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  312  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  371

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+G L ELVRK
Sbjct  372  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTIARGLRNAVKILEEGRLSELVRK  431

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSE+G  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  432  RYSSWDSEIGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  482



>ref|XP_010443465.1| PREDICTED: xylose isomerase [Camelina sativa]
Length=477

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYASWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>sp|Q40082.1|XYLA_HORVU RecName: Full=Xylose isomerase [Hordeum vulgare]
 emb|CAA64545.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV
Sbjct  309  NVECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNF AKLRRESTDVED+FIAHI GMDT+ARG R+  KLIEDGSL ELVRK
Sbjct  369  VKNDGLAPGGFNFYAKLRRESTDVEDLFIAHISGMDTMARGRRNVVKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IE GK DFE LEKKALEWGEP VPS KQELAEM+ QSAL
Sbjct  429  RYQSFDTEIGAMIEAGKGDFETLEKKALEWGEPTVPSGKQELAEMLFQSAL  479



>ref|XP_006280396.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
 gb|EOA13294.1| hypothetical protein CARUB_v10026323mg [Capsella rubella]
Length=477

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ RGLR+AAK++E+GSL ELVRK
Sbjct  367  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMGRGLRNAAKILEEGSLNELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSE+G  IE GKADFE LEKKA E GEPKVPSAKQELAEMI QSA+
Sbjct  427  RYASWDSEIGKQIEEGKADFEYLEKKAKEIGEPKVPSAKQELAEMIFQSAM  477



>dbj|BAJ34093.1| unnamed protein product [Thellungiella halophila]
Length=482

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGN+DAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  312  NIECNHATLSGHTCHHELETARLNGLLGNMDANTGDAQTGWDTDQFLTDVGEATMVMMSV  371

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+G L ELVRK
Sbjct  372  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTIARGLRNAVKILEEGRLSELVRK  431

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSE+G  IE GKADFE LEKKA E+GEPKVPSAKQELAEMI QSA+
Sbjct  432  RYSSWDSEIGKQIEEGKADFEYLEKKAKEFGEPKVPSAKQELAEMIFQSAM  482



>ref|XP_010483295.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IRNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYASWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_002864523.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40782.1| xylose isomerase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_010452612.1| PREDICTED: xylose isomerase-like [Camelina sativa]
Length=477

 Score =   293 bits (749),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETAR+NGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARLNGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLNELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DSELG  IE GKADFE LEKKA E+GEPKV SAKQELAEMI +SA+
Sbjct  427  RYASWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFKSAM  477



>gb|KJB60241.1| hypothetical protein B456_009G296100 [Gossypium raimondii]
Length=465

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHH++ETARING+LGNIDAN+GDPQ GWDTDQF  DV EAT+VMLSV
Sbjct  305  NIECNHATLSGHSCHHDLETARINGMLGNIDANTGDPQVGWDTDQFLTDVGEATMVMLSV  364

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGLAPGGFNFDAKLRRES DVED+FIAHI GMDTLARGLR+AAKLIEDGSL ELVRK
Sbjct  365  IRNGGLAPGGFNFDAKLRRESKDVEDLFIAHISGMDTLARGLRNAAKLIEDGSLAELVRK  424

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  193
            RY SFD+ELGA IE GKADFE+LEKKA+EWGEPKV SAKQ
Sbjct  425  RYSSFDTELGAQIEAGKADFEMLEKKAMEWGEPKVASAKQ  464



>gb|AAM61519.1| xylose isomerase [Arabidopsis thaliana]
Length=477

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD  TGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAXTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY ++DSELG  IE G+ADFE LEKKA E+GEPKV SAKQELAEMI QSA+
Sbjct  427  RYATWDSELGKQIEEGEADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM  477



>ref|XP_004507815.1| PREDICTED: xylose isomerase-like isoform X1 [Cicer arietinum]
 ref|XP_004507816.1| PREDICTED: xylose isomerase-like isoform X2 [Cicer arietinum]
Length=491

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+ETARINGLLGNIDAN+GDPQ GWDTDQF +D+ EAT++MLSV
Sbjct  309  NIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFLVDIQEATMIMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N G+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+AAKLIEDGSL ELVRK
Sbjct  369  IRNDGIAPGGFNFDAKLRRESTDVEDLFIAHIVGMDTMARGLRTAAKLIEDGSLAELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  193
            RYQSFD+E+GA IE GKADF+LLEKKA EWGEPKV SAKQ
Sbjct  429  RYQSFDTEIGAQIEAGKADFDLLEKKAKEWGEPKVASAKQ  468



>dbj|BAB08802.1| xylose isomerase [Arabidopsis thaliana]
Length=472

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGH+CHHE+ETARINGLLGNIDAN+GD QTGWDTDQF  DV EAT+VM+SV
Sbjct  307  NIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEATMVMMSV  366

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGGFNFDAKLRRESTDVED+FIAHI GMDT+ARGLR+A K++E+GSL ELVRK
Sbjct  367  IKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSLSELVRK  426

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQ  193
            RY ++DSELG  IE GKADFE LEKKA E+GEPKV SAKQ
Sbjct  427  RYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQ  466



>gb|ABR16225.1| unknown [Picea sitchensis]
Length=399

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATLSGHSCHHE+E +RI G+LGNIDAN+GD QTGWDTDQF  D+ EATLVML+V
Sbjct  229  NIECNHATLSGHSCHHELEMSRIYGMLGNIDANTGDAQTGWDTDQFLTDIGEATLVMLTV  288

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRES DVED+FI HI GMDTLARGLR+AAKL++DG L ELV K
Sbjct  289  IKNGGLAPGGFNFDAKLRRESVDVEDLFIGHISGMDTLARGLRNAAKLLQDGKLSELVAK  348

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY++ +S+LGA IE  +  FE LEKKA EWGEP + S KQELAEMI QS L
Sbjct  349  RYETLNSKLGALIEEEEVSFEELEKKAHEWGEPPLSSGKQELAEMIFQSYL  399



>ref|XP_001774702.1| predicted protein [Physcomitrella patens]
 gb|EDQ60517.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARI G+LG++DAN+GD QTGWDTDQF  DV+EATL+MLSV
Sbjct  309  NLECNHATLSGHSCHHELETARIYGMLGSVDANTGDAQTGWDTDQFLTDVSEATLIMLSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGLAPGGFNFDAKLRRES DVED+FIAHI GMDT+ARGLR+AAKL+E+G L +LV  
Sbjct  369  IKNGGLAPGGFNFDAKLRRESVDVEDLFIAHISGMDTIARGLRNAAKLLEEGRLTKLVED  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF+S LG  IE GK  FE LEK +LE  EP + S KQELAEMI  S +
Sbjct  429  RYSSFNSPLGKTIEEGKVGFEELEKISLEAEEPPITSGKQELAEMIFYSYV  479



>ref|XP_002991242.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
 gb|EFJ07670.1| hypothetical protein SELMODRAFT_229601 [Selaginella moellendorffii]
Length=476

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSC+HE+E +RING+LGNIDAN+GD QTGWDTDQF MD+AE T VMLSV
Sbjct  306  NIECNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAETTQVMLSV  365

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FI+HI GMD +ARGLR+AAK++E+G+L  +V++
Sbjct  366  LQNGGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGTLPSIVKE  425

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS LGA+IE G+  FE LE++AL   EP   S KQELAEM+  +++
Sbjct  426  RYASFDSALGASIESGELGFEELEREALRMEEPLPASGKQELAEMVFYNSI  476



>ref|XP_002991182.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
 gb|EFJ07726.1| hypothetical protein SELMODRAFT_161472 [Selaginella moellendorffii]
Length=478

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIECNHATL+GHSC+HE+E +RING+LGNIDAN+GD QTGWDTDQF MD+AE T VMLSV
Sbjct  308  NIECNHATLAGHSCYHELEVSRINGVLGNIDANTGDAQTGWDTDQFLMDIAETTQVMLSV  367

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPGGFNFDAKLRRESTDVED+FI+HI GMD +ARGLR+AAK++E+G+L  +V++
Sbjct  368  LQNGGLAPGGFNFDAKLRRESTDVEDLFISHIAGMDAMARGLRNAAKILEEGTLPSIVKE  427

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS LGA+IE G+  FE LE++AL   EP   S KQELAEM+  +++
Sbjct  428  RYASFDSALGASIESGELGFEELEQEALRMEEPLPASGKQELAEMVFYNSI  478



>emb|CAA64544.1| xylose isomerase [Hordeum vulgare subsp. vulgare]
 prf||2209268A xylose isomerase
Length=479

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSCHHE+ETARIN +LGNIDAN+GDPQ GWDTD+F  D++EATL+M SV
Sbjct  309  NVECNHATLSGHSCHHELETARINDILGNIDANTGDPQVGWDTDEFLTDISEATLIMSSV  368

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GLAPGGFNF AKLRRESTDVED+FIAHI GMDT+ARG R+  KLIEDGSL ELVRK
Sbjct  369  VKNDGLAPGGFNFYAKLRRESTDVEDLFIAHISGMDTMARGRRNVVKLIEDGSLDELVRK  428

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSFD+E+GA IEG  +     +  +     P       ELAEM+ QSAL
Sbjct  429  RYQSFDTEIGAMIEGSSSFTAQCKYISAPMIVPYDLLLPAELAEMLFQSAL  479



>ref|XP_002739772.1| PREDICTED: xylose isomerase-like [Saccoglossus kowalevskii]
Length=189

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM +V
Sbjct  19   NIEPNHTTLAGHGYEHDIVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIKNTTLVMKAV  78

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +  GGL PGG NFDAK+RREST+++D+FIAHIG MD+ ARGLR+A K+I+DG L  LV++
Sbjct  79   LDQGGLKPGGLNFDAKVRRESTNLQDMFIAHIGAMDSFARGLRNAVKIIKDGVLPNLVQE  138

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+ +++GA IE  K  FE LEK A+E GEPK  S +QE  E IL + +
Sbjct  139  RYSSYTNDIGAKIEKNKTSFEELEKYAMEQGEPKKISGQQEKYESILNNYI  189



>ref|XP_002506620.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67878.1| predicted protein [Micromonas sp. RCC299]
Length=411

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATL+GHSC HE+ETA    +LG +DAN+GDPQ GWDTDQF  D  EA LV+ ++
Sbjct  238  NVECNHATLAGHSCSHEIETAVAMDMLGGLDANTGDPQVGWDTDQFMTDGREAALVLSAI  297

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIE-DGSLKELVR  316
            +++ G APGG NFDAK RRESTDV D+  AHIGGMD +A GL+ AAKL++ DG+L+ + R
Sbjct  298  VRSKGFAPGGINFDAKTRRESTDVNDLLYAHIGGMDAMANGLKLAAKLVDPDGALERVKR  357

Query  315  KRYQSFDSELGAAIEGGKADFELLEKKALEW-GEPKVPSAKQELAEMILQSAL  160
            +RY S+ SELGA IE GKA  + LEK ALE  GEP V S KQELA+ I+ + +
Sbjct  358  ERYSSWASELGAKIEKGKATLKELEKLALEADGEPAVGSGKQELADNIIAAVV  410



>ref|XP_002591809.1| hypothetical protein BRAFLDRAFT_123544 [Branchiostoma floridae]
 gb|EEN47820.1| hypothetical protein BRAFLDRAFT_123544 [Branchiostoma floridae]
Length=189

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H+V  A   G+LG+ID+N+G P  GWDTDQFPMDV   T+VM +V
Sbjct  19   NIEPNHTTLAGHGYEHDVVMAAAFGMLGSIDSNTGSPDLGWDTDQFPMDVKNCTMVMKTV  78

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFD K+RRESTD+ED+FI+H+G MD  ARGL+SAAK++++G L  LV++
Sbjct  79   LEMGGLAPGGLNFDCKVRRESTDLEDMFISHVGAMDAFARGLKSAAKVLQEGVLTRLVKE  138

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  169
            RY SF S +GA I  G A  E  E   ++ GEPK  S KQE  E IL 
Sbjct  139  RYLSFSSGIGARIAKGTATMEECEDYIMQKGEPKAASGKQEKFETILN  186



>ref|XP_005646804.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE22260.1| xylose isomerase [Coccomyxa subellipsoidea C-169]
Length=471

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATL+GHSC HE++ A   G LGNIDAN+GD QTGWDTDQF  D  EATLV   +
Sbjct  298  NVECNHATLAGHSCEHELQLASAYGKLGNIDANTGDAQTGWDTDQFLTDPKEATLVAAVI  357

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGLAPGG NFDAKLRRESTDV D+F  HI GMD LARGLR+AA+++E+G L  +++ 
Sbjct  358  LKQGGLAPGGINFDAKLRRESTDVNDLFYGHISGMDALARGLRNAAQMLEEGILPGMIKD  417

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPK--VPSAKQELAEMILQSAL  160
            RY ++   +G  I  GK DF  LEK AL   +P   +PSA+ EL E++L   +
Sbjct  418  RYSTYSKGVGKKIRDGKVDFVELEKVALASADPAEDLPSARAELYEIVLSRYI  470



>ref|WP_034568836.1| xylose isomerase [Clostridiales bacterium oral taxon 876]
Length=440

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V
Sbjct  266  NIEANHATLAGHTFQHEVHLARINGMLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+ PGG NFDAK+RR S +VED+F+ +I GMDTLA+GL+ A K++E+G  + +V++
Sbjct  326  LKNGGITPGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLKIAYKMLEEGEFENIVKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SF+  +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  386  RYKSFNEGIGKDIVEGKADFESLEKYALSHSSIKNNSGRQELLEARLNQYI  436



>gb|ERI94441.1| xylose isomerase [Clostridiales bacterium oral taxon 876 str. 
F0540]
Length=455

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V
Sbjct  281  NIEANHATLAGHTFQHEVHLARINGMLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEV  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+ PGG NFDAK+RR S +VED+F+ +I GMDTLA+GL+ A K++E+G  + +V++
Sbjct  341  LKNGGITPGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLKIAYKMLEEGEFENIVKE  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SF+  +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  401  RYKSFNEGIGKDIVEGKADFESLEKYALSHSSIKNNSGRQELLEARLNQYI  451



>ref|XP_010792168.1| PREDICTED: xylose isomerase-like [Notothenia coriiceps]
Length=312

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+  ATLVM ++
Sbjct  142  NIEPNHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNATLVMKTI  201

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ED+FIAHIG MDT ARGLR+A ++IEDG +  +V+ 
Sbjct  202  IEQGGLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDTFARGLRNAVRIIEDGIIPGMVKD  261

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +   +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  262  RYSSFSHGIWQKVEEGSASLEEMEDFIKQNGEPKVTSGKQEKYESIFNHYI  312



>gb|ETK93389.1| xylose isomerase, partial [Phytophthora parasitica]
 gb|ETL46799.1| xylose isomerase, partial [Phytophthora parasitica]
Length=269

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  98   NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  157

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  158  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  217

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  218  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  264



>gb|ETK93384.1| xylose isomerase [Phytophthora parasitica]
Length=287

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  116  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  175

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  176  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  235

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  236  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  282



>ref|XP_001633389.1| predicted protein [Nematostella vectensis]
 gb|EDO41326.1| predicted protein [Nematostella vectensis]
Length=399

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A   G+LG+IDAN+G P  GWDTDQFPM+V     +M ++
Sbjct  229  NIEPNHTTLAGHSYEHDIVLASKVGMLGSIDANTGSPDLGWDTDQFPMNVKNCMFIMKAI  288

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFD K+RRESTD+ED+FI+HIG MDTLAR LR AA LIE+G +  LV++
Sbjct  289  IEQGGLAPGGLNFDCKVRRESTDIEDMFISHIGAMDTLARALRCAATLIEEGKMSGLVKE  348

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  169
            RY SFDS +G+ IE G A  E LE   +  GEP++ S KQE  E IL 
Sbjct  349  RYSSFDSGIGSKIEKGLATLEELENFVMANGEPQLLSGKQEKYESILN  396



>gb|KIZ04907.1| xylose isomerase [Monoraphidium neglectum]
Length=472

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 4/175 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+ECNHATLSGHSC HE+ETARING+LGNIDAN+GDPQTGWDTDQF +D  EATL+ML+V
Sbjct  298  NVECNHATLSGHSCEHELETARINGVLGNIDANTGDPQTGWDTDQFLVDPREATLIMLAV  357

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGL  GGFNFDAKLRREST + D+F  HI GMD LARGLR+AA L++ G+L +L  +
Sbjct  358  IRNGGLGTGGFNFDAKLRRESTALVDLFYGHISGMDALARGLRNAAALLDAGALTKLREE  417

Query  312  RYQSFDSE--LGAAIEGGKADFELLEKKALEWGEPK--VPSAKQELAEMILQSAL  160
            RY S+ ++  +G  I  GK  F+ LEK AL   +P   V S  QELAE++L   L
Sbjct  418  RYASWGAKGGIGPKIIAGKVGFDDLEKFALSHPDPADDVGSGSQELAEILLDMHL  472



>gb|ETL46794.1| xylose isomerase, partial [Phytophthora parasitica]
Length=307

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  136  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  195

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  196  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  255

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  256  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  302



>ref|XP_010738383.1| PREDICTED: xylose isomerase-like isoform X2 [Larimichthys crocea]
Length=365

 Score =   199 bits (505),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++
Sbjct  195  NIEPNHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTI  254

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A ++IEDG +  +V++
Sbjct  255  VEQGGLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRIIEDGLIAGMVKE  314

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  315  RYSSFSHGIGQKVEEGSATLEEMEAFITQKGEPKVTSGKQEKYESIFNHYI  365



>ref|XP_006636149.1| PREDICTED: xylose isomerase-like [Lepisosteus oculatus]
Length=378

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A   G+LG++D+N+G P  GWDTDQFPMD+   T+VM  V
Sbjct  208  NIEPNHTTLAGHSYEHDIIMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIKNTTMVMKCV  267

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ED+FIAH+G MDT ARGLRSA ++IE+G + +++++
Sbjct  268  IEQGGLQPGGLNFDAKVRRESTDLEDLFIAHVGAMDTFARGLRSAVQIIEEGVIAQMLQQ  327

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF S +G+ +E G A    LE+   + GEPK  S KQE  E I    L
Sbjct  328  RYLSFSSGIGSMVEEGTATLVELEEFIKQNGEPKTTSGKQEKYESIFNHYL  378



>emb|CAF93733.1| unnamed protein product [Tetraodon nigroviridis]
Length=414

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A   G+LG++DAN+G P  GWDTDQFPMDV   TLVM +V
Sbjct  244  NIEPNHTTLAGHSYEHDVVMASAFGMLGSVDANTGSPDLGWDTDQFPMDVRNTTLVMKTV  303

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ED+FIAHI  MD  ARGLR+AA+++EDG +  +V++
Sbjct  304  IEQGGLQPGGLNFDAKVRRESTDMEDLFIAHIAAMDAFARGLRNAARIVEDGIMAAMVKE  363

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF  ++G  ++ G A  E +E    E GEPK  S KQE  E I    +
Sbjct  364  RYSSFSRDIGQKVDEGSATLEEMEAFIKENGEPKTTSGKQEKYESIFNCYI  414



>gb|ETI53522.1| xylose isomerase [Phytophthora parasitica P1569]
Length=349

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  178  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  237

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  238  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  297

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  298  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  344



>ref|WP_017895180.1| xylose isomerase [Clostridium tyrobutyricum]
 emb|CDL91629.1| Xylose isomerase [Clostridium tyrobutyricum DIVETGP]
Length=440

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE++TARIN  LG++DAN GDP  GWDTDQFP ++ + TL M  V
Sbjct  266  NIEANHATLAGHTFQHEIQTARINNALGSLDANQGDPNLGWDTDQFPTNIYDTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGG NFDAK+RR S + ED+F+A+I GMDT A+GLR A KL+EDG ++  +++
Sbjct  326  LKNGGIAPGGLNFDAKVRRASFEPEDLFLAYIAGMDTFAKGLRVAYKLLEDGPIENFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF+S++G  I  GK  F  LEK ALE    +  S +QE+ E I+   +
Sbjct  386  KYSSFNSKIGKDIIEGKIGFNELEKYALENTSIENKSGRQEMLESIVNQYI  436



>ref|XP_008900733.1| xylose isomerase [Phytophthora parasitica INRA-310]
 gb|ETN13656.1| xylose isomerase [Phytophthora parasitica INRA-310]
Length=452

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  281  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGGFNFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  341  IEIGGLAPGGFNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  401  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>emb|CDQ80418.1| unnamed protein product [Oncorhynchus mykiss]
Length=438

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A + G+LG++D+N+G P  GWDTDQFPMD+   T++M +V
Sbjct  268  NIEPNHTTLAGHSYEHDVVMASVFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTMIMKTV  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ED+FIAH+G MD  ARGLR+A ++IE+G +  +V++
Sbjct  328  IEQGGLQPGGLNFDAKVRRESTDLEDLFIAHVGAMDAFARGLRNAVRIIEEGVITSMVKE  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  +E G    E LE    + GEPKV S KQE  E +    L
Sbjct  388  RYMSFSHGIGQKVEDGSTSLEELEDFVKQNGEPKVTSGKQEKYETVFNHYL  438



>ref|XP_010065874.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065875.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065876.1| PREDICTED: xylose isomerase-like isoform X1 [Eucalyptus grandis]
Length=467

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 109/134 (81%), Gaps = 5/134 (4%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATLSG SCHHE+ET R+NG  GN+DAN+GD Q GWDTDQF  D+ EATLVMLSV
Sbjct  310  NVEYNHATLSGRSCHHELETGRLNGRFGNLDANTGDTQIGWDTDQFQTDIGEATLVMLSV  369

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGGLAPG     A +  ES DVED+FIAHI GMDTLARG R+ AKLIEDGSL ELVRK
Sbjct  370  VRNGGLAPG-----ASIYEESMDVEDLFIAHISGMDTLARGFRNVAKLIEDGSLDELVRK  424

Query  312  RYQSFDSELGAAIE  271
            RY+SFD+E GA IE
Sbjct  425  RYESFDAECGAQIE  438



>ref|XP_003965907.1| PREDICTED: xylose isomerase-like [Takifugu rubripes]
Length=439

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM +V
Sbjct  269  NIEPNHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIRNTTLVMKTV  328

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL PGG NFDAK+RRESTDVED+F+AH+  MDT ARGLR+A ++IEDG +  +V+ 
Sbjct  329  VEQGGLQPGGLNFDAKVRRESTDVEDLFVAHVAAMDTFARGLRNAVRIIEDGIMAGMVKD  388

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF  ++G  ++ G A  E +E    E GEPK+ S KQE  E I    +
Sbjct  389  RYSSFSRDIGQKVDEGSATLEEMEAFIKEKGEPKMMSGKQETYESIFNRYI  439



>ref|XP_010738382.1| PREDICTED: xylose isomerase-like isoform X1 [Larimichthys crocea]
Length=439

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++
Sbjct  269  NIEPNHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTI  328

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A ++IEDG +  +V++
Sbjct  329  VEQGGLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRIIEDGLIAGMVKE  388

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  389  RYSSFSHGIGQKVEEGSATLEEMEAFITQKGEPKVTSGKQEKYESIFNHYI  439



>gb|ETI53536.1| xylose isomerase [Phytophthora parasitica P1569]
Length=452

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  281  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  341  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  401  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|XP_004356776.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
 gb|ELR24876.1| xylose isomerase [Acanthamoeba castellanii str. Neff]
Length=437

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH+  HE+  A   G LG+IDAN+GDP  GWDTDQF MDV + TL M  V
Sbjct  267  NIEANHCTLAGHTFEHELTYASAYGFLGSIDANTGDPLLGWDTDQFNMDVKQTTLAMQVV  326

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL PGG NFDAKLRRES+D+ED+FI HI GMDT ARGL +AA+L E+G+ +    +
Sbjct  327  LRQGGLQPGGLNFDAKLRRESSDLEDLFIGHIAGMDTFARGLLAAARLEEEGTFQAWRDE  386

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+  ELG  I  G+  F  LE+ AL+ GEPK  SAKQE  EM+L
Sbjct  387  RYASWKGELGQKIVSGQVTFAELEQFALQAGEPKQVSAKQEKYEMLL  433



>gb|ETP51333.1| xylose isomerase [Phytophthora parasitica P10297]
Length=452

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  281  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  341  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  401  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>gb|ETO82214.1| xylose isomerase [Phytophthora parasitica P1976]
Length=452

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  281  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  341  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  401  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>gb|ETL77578.1| xylose isomerase [Phytophthora parasitica]
 gb|ETL99919.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM30630.1| xylose isomerase [Phytophthora parasitica]
 gb|ETM53081.1| xylose isomerase [Phytophthora parasitica]
 gb|ETO82200.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETO82215.1| xylose isomerase [Phytophthora parasitica P1976]
 gb|ETP23318.1| xylose isomerase [Phytophthora parasitica CJ01A1]
 gb|ETP23343.1| xylose isomerase [Phytophthora parasitica CJ01A1]
Length=452

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  281  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  340

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  341  IEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  400

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE GKA  E +   A E GEP   S KQELAE++L
Sbjct  401  RYASWKSALGERIEQGKATLEEVAAYAKESGEPDHVSGKQELAELML  447



>ref|XP_010883508.1| PREDICTED: xylose isomerase-like [Esox lucius]
Length=501

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A + G+LG++D+N+G P  GWDTDQFPMD+   T+VM +V
Sbjct  331  NIEPNHTTLAGHSYEHDIVMASVFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTMVMKTV  390

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL  GG NFDAK+RRESTD+ED+FIAHIG MD  +RGLR+A +++EDG +  +V++
Sbjct  391  VEQGGLKTGGLNFDAKVRRESTDIEDLFIAHIGAMDAFSRGLRNAVRILEDGVITSMVKE  450

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  +E G A  E LE    + GEPKV S KQE  E +    L
Sbjct  451  RYMSFSHGIGQKVEDGSASLEDLEDFVKQNGEPKVTSGKQEKYETVFNHYL  501



>ref|XP_008290598.1| PREDICTED: xylose isomerase-like [Stegastes partitus]
Length=440

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A   G+LG++D+N+G P  GWDTDQFPMD+   TLVM ++
Sbjct  270  NIEPNHTTLAGHSYEHDVVMASAFGMLGSVDSNTGSPDLGWDTDQFPMDIRNTTLVMKTI  329

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ED+FIAHIG MD  ARGLR+A +++EDG +  ++++
Sbjct  330  IEQGGLQPGGLNFDAKVRRESTDLEDLFIAHIGAMDAFARGLRNAVRILEDGLIGGMLKE  389

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   LG  +E G A  E +E    + GEPKV S KQE  E I    +
Sbjct  390  RYSSFSHGLGQKVEEGSATLEEMEAFVNQNGEPKVTSGKQEKYESIFNHYI  440



>ref|XP_009537176.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
 gb|EGZ07610.1| hypothetical protein PHYSODRAFT_565503 [Phytophthora sojae]
Length=409

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  238  NVEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  297

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  298  VEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  357

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE G+A  E +   A E GEP   S KQELAE++L
Sbjct  358  RYASWKSALGERIEDGRATLEEVAAYAKEAGEPDHVSGKQELAELML  404



>ref|WP_016205623.1| xylose isomerase [Clostridium sartagoforme]
 gb|EOR28235.1| xylose isomerase [Clostridium sartagoforme AAU1]
Length=439

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HEV  ARING+LG++D N GDP  GWDTDQFP ++ +ATL+M  V
Sbjct  266  NIEANHATLAGHTFQHEVALARINGVLGSLDINQGDPNLGWDTDQFPTNIYDATLLMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+  GG NFDAK+RR S +VED+F+ +I GMDTLA+GLR A K++E+G  +  V +
Sbjct  326  LKNGGIGQGGLNFDAKVRRASFEVEDLFLGYIAGMDTLAQGLRIAYKMLEEGEFEAAVAE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+SF   +G  I  GKADFE LEK AL     K  S +QEL E  L   +
Sbjct  386  RYKSFTEGIGKDILEGKADFESLEKYALTNSLIKNKSGRQELLEAKLNQYI  436



>ref|XP_008321922.1| PREDICTED: xylose isomerase-like isoform X2 [Cynoglossus semilaevis]
Length=407

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM ++
Sbjct  237  NIEPNHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIKNTTLVMKTI  296

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ D+FIAHIG MD  ARGLR+A ++++DG +  +V +
Sbjct  297  IEQGGLQPGGLNFDAKVRRESTDLVDLFIAHIGAMDAFARGLRNAVRIMDDGIMTGMVME  356

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   LG  ++ G A  E +E   ++ GEP+V S KQE  E I    +
Sbjct  357  RYSSFSHGLGHKVDNGSATLEEMEDFVIQNGEPEVKSGKQEKYESIFNHYI  407



>ref|XP_002904118.1| xylose isomerase 1 [Phytophthora infestans T30-4]
 gb|EEY54296.1| xylose isomerase 1 [Phytophthora infestans T30-4]
Length=469

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 119/170 (70%), Gaps = 0/170 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  280  NIEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  339

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L ELV++
Sbjct  340  VEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGELVKQ  399

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSA  163
            RY S+ S LG  IE G+A  E +   A E GEP   S KQELAE++  + 
Sbjct  400  RYASWKSTLGERIEQGQATLEEVAAYAKESGEPDHVSGKQELAELMWSTV  449



>ref|XP_008321921.1| PREDICTED: xylose isomerase-like isoform X1 [Cynoglossus semilaevis]
Length=439

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H++  A   G+LG++DAN+G P  GWDTDQFPMD+   TLVM ++
Sbjct  269  NIEPNHTTLAGHSYEHDIVMASAFGMLGSVDANTGSPDLGWDTDQFPMDIKNTTLVMKTI  328

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL PGG NFDAK+RRESTD+ D+FIAHIG MD  ARGLR+A ++++DG +  +V +
Sbjct  329  IEQGGLQPGGLNFDAKVRRESTDLVDLFIAHIGAMDAFARGLRNAVRIMDDGIMTGMVME  388

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   LG  ++ G A  E +E   ++ GEP+V S KQE  E I    +
Sbjct  389  RYSSFSHGLGHKVDNGSATLEEMEDFVIQNGEPEVKSGKQEKYESIFNHYI  439



>ref|WP_044593090.1| xylose isomerase, partial [Peptoclostridium difficile]
Length=228

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  49   NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  108

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  109  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  168

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  169  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  219



>ref|XP_009537174.1| hypothetical protein PHYSODRAFT_306712 [Phytophthora sojae]
 gb|EGZ07608.1| hypothetical protein PHYSODRAFT_306712 [Phytophthora sojae]
Length=587

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NH TL+GH   H++  A    +LG++D N+GDP  GWDTDQF MD  +A LVM  +
Sbjct  416  NVEPNHTTLAGHDYEHDIYYAASYKMLGSVDCNTGDPLVGWDTDQFLMDEKKAVLVMKKI  475

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFDAK+RRESTD+EDIFIAHIG MD  ARGLR AAKL+E   L E+V++
Sbjct  476  VEIGGLAPGGLNFDAKVRRESTDLEDIFIAHIGSMDCFARGLRQAAKLLEKNELGEMVKQ  535

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY S+ S LG  IE G+A  E +   A E GEP   S KQELAE++L
Sbjct  536  RYASWKSALGERIEDGRATLEEVAAYAKEAGEPDHVSGKQELAELML  582



>gb|EQF74127.1| xylose isomerase [Peptoclostridium difficile CD212]
Length=272

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  93   NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  152

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  153  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  212

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  213  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  263



>gb|ELU13203.1| hypothetical protein CAPTEDRAFT_149382 [Capitella teleta]
Length=442

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NH TL+GH   H++  A   G+LG+ID+N+G P  GWDTDQFPMD    T+VM +V
Sbjct  272  NVEPNHTTLAGHCYEHDIVMASAFGMLGSIDSNTGSPDLGWDTDQFPMDTKACTMVMKTV  331

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GG+ PGG NFDAK+RREST+V D+FIAHIG MD  ARGL++AA+LIEDG +K+ +  
Sbjct  332  LEQGGIQPGGLNFDAKVRRESTEVSDMFIAHIGAMDAFARGLKNAARLIEDGIIKKNLEA  391

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  169
            RY+SF  ++GA I+ G A  E  E   L+ GEPK  S KQE  E +L 
Sbjct  392  RYKSFSVDIGAKIKAGSATLEECEAFILKNGEPKKTSGKQEHFESMLN  439



>ref|WP_036097976.1| xylose isomerase [Listeria floridensis]
 gb|EUJ28504.1| xylose isomerase [Listeria floridensis FSL S10-1187]
Length=435

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GH+  HE+  ARING LG+IDAN GD   GWDTD+FP ++ + TL M  +
Sbjct  264  NLEANHATLAGHTFEHELTVARINGALGSIDANQGDVLLGWDTDEFPTNIYDVTLTMREI  323

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++NGG+APGG NFDAK+RR + DVED+F+AHI GMDT ARGL++AAKL +DG L+EL+ +
Sbjct  324  LENGGIAPGGINFDAKVRRSAFDVEDLFLAHIAGMDTFARGLKNAAKLKQDGFLEELIAE  383

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF + +GA+I   + D E L   ALE  + +V S+  E  + +L   +
Sbjct  384  RYASFQTGIGASILADQEDLESLSTFALEHEDAEVKSSHIEYVKNVLNDYM  434



>ref|WP_007061694.1| xylose isomerase [Clostridium carboxidivorans]
 gb|EET86757.1| xylose isomerase [Clostridium carboxidivorans P7]
 gb|EFG89380.1| xylose isomerase [Clostridium carboxidivorans P7]
Length=440

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  AR N +LG++DAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAGHTFQHEICLARNNNVLGSLDANQGDPHLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGG NFDAK+RR S + ED+F+++I GMDT A+GLR A KL++DG ++  +++
Sbjct  326  LKNGGIAPGGLNFDAKVRRASFEPEDLFLSYIAGMDTFAKGLRIAYKLLQDGPIENFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF + +G  I  GK  FE LEK AL        S +QE  E I+   +
Sbjct  386  RYSSFSTGIGKDIVDGKVGFEELEKYALSNNVMNNKSGRQEYLESIVNQYI  436



>ref|WP_039882234.1| xylose isomerase [Mesotoga infera]
Length=440

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +
Sbjct  265  NVEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEI  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ 
Sbjct  325  IKNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKD  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  385  RYRSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  435



>ref|WP_034536238.1| xylose isomerase [Bacteroides stercoris]
 gb|ADD61712.1| putative protein [uncultured organism]
Length=438

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  328  IRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHIAGMDVMARALESAAKLLEESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDSGKGKEFEEGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  434



>ref|WP_005654109.1| xylose isomerase [Bacteroides stercoris]
 gb|EDS15937.1| xylose isomerase [Bacteroides stercoris ATCC 43183]
 gb|AEK21499.1| xylose isomerase [Bacteroides stercoris]
Length=438

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  328  IRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHIAGMDVMARALESAAKLLEESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDSGKGKEFEEGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  434



>emb|CCU83726.1| Xylose isomerase [Mesotoga infera]
Length=446

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +
Sbjct  271  NVEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEI  330

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ 
Sbjct  331  IKNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKD  390

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  391  RYRSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  441



>gb|ADD61976.1| putative protein [uncultured organism]
Length=291

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 117/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP +  +ATL M  V
Sbjct  116  NIEANHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNAYDATLCMYEV  175

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK RR S  +EDIF+++I GMDT A GL++AAK+IEDG L + V  
Sbjct  176  LKAGGFTNGGLNFDAKARRGSYTMEDIFLSYIAGMDTFALGLKAAAKIIEDGRLDKFVDD  235

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  160
            RY S+ + +GA I  GKAD E LEK A+E GE    + S +QE  E +L   +
Sbjct  236  RYASWTTGIGADIIAGKADMESLEKYAVEKGEVTDSLSSGRQEYLESVLNQIM  288



>ref|WP_014731027.1| xylose isomerase [Mesotoga prima]
 gb|AFK07082.1| xylose isomerase [Mesotoga prima MesG1.Ag.4.2]
Length=440

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GH+  HE+  ARIN LLG++DAN GDP  GWDTDQFP D+   TL M  +
Sbjct  265  NVEANHATLAGHTFQHELRFARINDLLGSVDANQGDPLLGWDTDQFPTDLYSTTLGMYEI  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGGL PGG NFDAK+RR S D  D+FI HI GMDT A GL++AAKLI++G+L+ L++ 
Sbjct  325  IKNGGLNPGGLNFDAKVRRGSYDERDLFIGHIAGMDTFALGLKAAAKLIDEGTLESLLKD  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+ S +G  I  G ADF  LE+  ++   P    + QE  E ++  A+
Sbjct  385  RYSSYQSGVGKEITEGIADFRSLEEYIIDKKNPLPEPSNQEYLERLVNWAI  435



>ref|WP_010588344.1| xylose isomerase [Schlesneria paludicola]
Length=436

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+E ARI G LG+IDAN+GD   GWDTDQFP D+   T  ML +
Sbjct  265  NIETNHATLAGHTMMHELEYARIQGALGSIDANTGDLLLGWDTDQFPTDIYLTTQCMLVI  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GG+APGG NFDAK+RRES D  D+F AHIG MD  ARG + AA + +DG LK+ V+K
Sbjct  325  LEQGGIAPGGVNFDAKVRRESFDPIDLFHAHIGAMDAFARGTKIAAAIRKDGVLKDFVKK  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKAL--EWGEPKVPSAKQELAEMILQSAL  160
            RY+SFD+ +GA IE GKA FE LEK  L  E   P   S +QE+ E I+   L
Sbjct  385  RYRSFDTGVGAEIESGKATFESLEKYVLGKETLNPN-ESGRQEMLENIINQYL  436



>gb|EPH17343.1| xylose isomerase [Bacteroides stercoris CC31F]
Length=456

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  286  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  345

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  346  IRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHIAGMDVMARALESAAKLLEESPYKKMLAD  405

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  406  RYASFDSGKGKEFEEGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  452



>ref|WP_022103428.1| xylose isomerase [Bacteroides stercoris CAG:120]
 emb|CDA49117.1| xylose isomerase [Bacteroides stercoris CAG:120]
Length=455

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  285  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  344

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  345  IRNGGFGDGGTNFDAKTRRNSTDLEDIFIAHIAGMDVMARALESAAKLLEESPYKKMLAD  404

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  405  RYASFDSGKGKEFEEGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  451



>gb|ERM41646.1| xylose isomerase [Clostridium difficile P68]
Length=316

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  137  NIEANHATLAGHTFQHELNIARINDVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  196

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  197  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  256

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  257  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  307



>ref|WP_019027960.1| xylose isomerase [Colwellia piezophila]
Length=438

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHEV  A   G+LG+IDAN GD Q GWDTDQFP DVAE TLVM  +
Sbjct  267  NIEANHATLAGHSFHHEVAVACAEGILGSIDANRGDMQNGWDTDQFPNDVAECTLVMYEI  326

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGL  GGFNFD KLRR+S + +D+FIAHIGGMDT+A+ L +AAKLIED  L   V +
Sbjct  327  LKNGGLDTGGFNFDTKLRRQSCERDDLFIAHIGGMDTMAKALLNAAKLIEDAPLSNFVDE  386

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  172
            RY  +  +LG +I  G    + L K  L+    PK  S +QEL E I+
Sbjct  387  RYAGWKGQLGQSIMSGDHSLDSLSKLVLDNDINPKQESGRQELLENIV  434



>gb|EFP62823.1| putative xylose isomerase [Erysipelotrichaceae bacterium 3_1_53]
Length=300

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 117/173 (68%), Gaps = 0/173 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARING+LG++DAN GD   GWDTDQFP ++ +ATL M  +
Sbjct  128  NIEANHATLASHTFQHELNMARINGMLGSVDANQGDMLLGWDTDQFPTNLYDATLAMYEI  187

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL  GG NFDAK+RRES  +EDI  A+I GMDT A+GLR+AA L+EDG LK+ V++
Sbjct  188  LQTGGLKSGGLNFDAKVRRESFTMEDIAYAYIAGMDTYAKGLRTAALLLEDGILKQAVKE  247

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*K  154
            RY+S+   +G  I  GK DF  L   AL      + S KQE  E IL   L K
Sbjct  248  RYESYTYGIGKKISEGKTDFRELSAYALSLPTITIGSGKQERLERILSDYLVK  300



>ref|XP_003387079.1| PREDICTED: xylose isomerase-like [Amphimedon queenslandica]
Length=460

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H+V  A   G+LG+ID+N+G P  GWDTDQFPM++   TL+M ++
Sbjct  288  NIEPNHTTLAGHGHEHDVVVASKFGMLGSIDSNTGSPDLGWDTDQFPMEIKNTTLIMKAI  347

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGLAPGG NFD K+RRES D++D+FIAHIG MD+ ARGL  A +L   G +++ V+ 
Sbjct  348  IEQGGLAPGGLNFDCKVRRESIDLQDLFIAHIGAMDSFARGLMCAVELFNQGVMEKCVKD  407

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+DS +G++IE GKA  E LE+     G P   S +QE+ E++  +AL
Sbjct  408  RYSSYDSGIGSSIENGKASLEQLEEYIKANGFPTPTSGQQEMYEVLFNNAL  458



>ref|WP_010074860.1| xylose isomerase [Clostridium cellulovorans]
 gb|ADL50361.1| xylose isomerase [Clostridium cellulovorans 743B]
Length=439

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HEV  AR+NG+LG++D N GDP  GWDTDQFP ++ +AT+VM  V
Sbjct  266  NIEANHATLAQHTFQHEVAVARVNGVLGSLDVNQGDPNLGWDTDQFPTNIYDATMVMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGG NFDAK RR S + ED+F+++I GMDT+A+GLR A  L++D  L+    +
Sbjct  326  LKNGGIAPGGLNFDAKTRRASFEPEDLFLSYIAGMDTMAKGLRVAYSLLDDAVLENNTSE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY++F   +G  I  GK DFE LEK ALE       S +QE  E ++   +
Sbjct  386  RYKTFSEGIGKDIVEGKVDFESLEKYALENSVISNKSGRQEYLESVVNQYI  436



>ref|WP_038164239.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=437

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GHS  HE+E A   G LG++DAN+GD   GWDTDQF  D + AT +ML+ 
Sbjct  266  NLETNHATLAGHSMQHEMEVAGAAGALGSLDANTGDLLLGWDTDQFLTDASTATQMMLTT  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGL  GG NFDAK+RRES D ED+F +HIGGMDT ARGL++AA +  DG L + V++
Sbjct  326  LKYGGLTTGGVNFDAKVRRESVDPEDLFYSHIGGMDTFARGLKNAAAIRADGRLGDFVKQ  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE-PKVPSAKQELAEMIL  172
            RY ++D+ LGA+IE GK  F  LE  ALE GE  +VPS +QE  E ++
Sbjct  386  RYSTWDTGLGASIEAGKESFSSLEAFALEKGEATQVPSGRQEFLENLV  433



>ref|WP_032079132.1| xylose isomerase [Clostridium drakei]
Length=440

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  AR N +LG++DAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAGHTFQHEICLARNNNVLGSLDANQGDPHLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNG +APGG NFDAK+RR S + ED+F+++I GMDT A+GLR A KL+ DG ++  +++
Sbjct  326  LKNGDIAPGGLNFDAKVRRASFEPEDLFLSYIAGMDTFAKGLRIAYKLLHDGPIENFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF + +G  I  GKA FE LEK AL        S +QE  E I+   +
Sbjct  386  RYSSFSTGIGKDIVDGKAGFEELEKYALSNNTMNNQSGRQEYLESIVNQYI  436



>ref|WP_013289876.1| xylose isomerase [Caldicellulosiruptor obsidiansis]
 gb|ADL41871.1| xylose isomerase [Caldicellulosiruptor obsidiansis OB47]
Length=438

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRSSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYRSYKEGIGAKIVSGQADFKTLEEYALNLSQIENKSGKQELLEMILNKYM  435



>gb|EFX66553.1| hypothetical protein DAPPUDRAFT_218978 [Daphnia pulex]
Length=399

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H+V  A   G+LG+IDAN+G P  GWDTDQFPMD+   T VML V
Sbjct  229  NIEPNHTTLAGHGYEHDVVMASTFGILGSIDANTGSPDLGWDTDQFPMDIRACTAVMLQV  288

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GG+ PGG NFDAK+RREST+ +D+FIAHI  MD+ ARGLR+A+K++EDG +   +++
Sbjct  289  IRQGGVQPGGLNFDAKVRRESTNTKDLFIAHIAAMDSFARGLRNASKIVEDGIMARHLKE  348

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF+S  G  I  G  D E  E+   + GEP++ S +QE  E I    L
Sbjct  349  RYISFESGFGLKICNGLTDLEECEEFIHQHGEPEMISGQQEHCEAIFNRYL  399



>emb|CBK25455.2| unnamed protein product [Blastocystis hominis]
Length=435

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GH   H++  A   G+LG++DAN+GD   GWDTDQFPMDV +A +VM  +
Sbjct  265  NIEPNHTTLAGHDYEHDIVFACNEGMLGSVDANTGDTLLGWDTDQFPMDVKKAVIVMYHI  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GGL  GG NFDA +RRESTD+ED FIAHIG MDT AR L    K++ D   +E+V K
Sbjct  325  IRAGGLHSGGLNFDAHVRRESTDMEDRFIAHIGAMDTFARALLIVEKIMNDKIYQEMVDK  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY+S+ + +GA IE G+A FE  EK  LE G+P+  SAKQE  EM+L
Sbjct  385  RYESYTTGIGARIENGEATFEECEKYILENGKPEPQSAKQEKFEMLL  431



>ref|WP_013411463.1| xylose isomerase [Caldicellulosiruptor owensensis]
 gb|ADQ04052.1| xylose isomerase [Caldicellulosiruptor owensensis OL]
Length=438

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRSSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYRSYKEGIGAKIVSGQADFKTLEEYALNLSQIENKSGKQELLEMILNKYM  435



>ref|WP_009959227.1| xylose isomerase [Verrucomicrobium spinosum]
Length=437

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GHS  HE+E A   G LG++DAN+GD   GWDTDQF  D + AT +ML+ 
Sbjct  266  NLETNHATLAGHSMQHEMEVAGAAGALGSLDANTGDLLLGWDTDQFLTDASTATQMMLTA  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGL  GG NFDAK+RRES D ED+F +HIGGMDT ARGL++AA +  DG L + V++
Sbjct  326  LKYGGLTTGGVNFDAKVRRESVDPEDLFYSHIGGMDTFARGLKNAAAIRADGRLGDFVKQ  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE-PKVPSAKQELAEMIL  172
            RY ++D+ LGA+IE GK  F  LE  ALE GE  +VPS +QE  E ++
Sbjct  386  RYSTWDTGLGASIEAGKESFSSLEAFALEKGEATQVPSGRQEYLENLV  433



>gb|AAR09155.1| xylose isomerase [Mannheimia granulomatis]
Length=239

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = -3

Query  681  MSSNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVM  502
            +  NIE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TLVM
Sbjct  63   IKMNIEANHATLAGHTFQHEIATATALGIFGSIDANRGDPQLGWDTDQFPNSVEENTLVM  122

Query  501  LSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKEL  322
              ++K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+ ED +L+++
Sbjct  123  YEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKQAAKMFEDQTLQKV  182

Query  321  VRKRYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  160
            V  RY  ++ +LG  I  GKA  E L K     G +PK  S +QE  E ++ S +
Sbjct  183  VDNRYAGWNQDLGQQILTGKASLEALAKIVETQGLDPKPVSGQQEYLENLVNSYI  237



>ref|WP_026658263.1| Xylose isomerase [Acholeplasma palmae]
 ref|YP_008636038.1| Xylose isomerase [Acholeplasma palmae J233]
 emb|CCV64223.1| Xylose isomerase [Acholeplasma palmae J233]
Length=439

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 111/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TARI G+ G+IDAN GD   GWDTDQFP +V +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHEIATARIEGVFGSIDANEGDLLLGWDTDQFPFNVYDATLCMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK RR S  VED+ +A+I GMDT A GLR A +LIED  L      
Sbjct  326  LKAGGFTDGGLNFDAKTRRPSNTVEDLLLAYIHGMDTYALGLRKAVELIEDERLDNFKEN  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RYQSF++E G  I   K   E L + AL+  EP V S KQE  EMI+   L
Sbjct  386  RYQSFNTEFGQKILNNKITLEELTEHALKNQEPDVKSGKQEYLEMIVNQIL  436



>ref|WP_020532079.1| hypothetical protein [Flexithrix dorotheae]
Length=438

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  H++  A  + +LG+IDAN GD Q GWDTD FP D+ +AT VM+ +
Sbjct  268  NIEANHATLAGHTFAHDIRVAADHKMLGSIDANQGDYQNGWDTDYFPHDIYDATEVMMVL  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +++GGL  GGFNFDAK+RR STD+EDIFI+HI GMD  ARGL  A K++++ +  +L + 
Sbjct  328  LESGGLGKGGFNFDAKVRRNSTDLEDIFISHIAGMDIFARGLLVADKILKETNFTQLKKD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS  GAA E G+ + E L + A+E GEPK  S KQEL E ++   +
Sbjct  388  RYSSFDSGKGAAYEKGELNLEALREIAVEVGEPKKISGKQELFESLVNQCI  438



>ref|WP_004290957.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EEC53078.1| xylose isomerase [Bacteroides eggerthii DSM 20697]
 gb|EFV28579.1| xylose isomerase [Bacteroides eggerthii 1_2_48FAA]
 emb|CCY57543.1| xylose isomerase [Bacteroides eggerthii CAG:109]
Length=438

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N GL  GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  328  IRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAKLLEESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD+  G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDNGKGKEFEDGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  434



>ref|WP_041897212.1| xylose isomerase [Clostridium beijerinckii]
 gb|AJG99715.1| xylose isomerase [Clostridium beijerinckii]
Length=441

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELHFARINNFLGSIDANQGDPLLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGG NFD+K+RR S + ED+F+A+I GMDT A+GLR A KL+E+G L++ +++
Sbjct  326  LKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGMDTFAKGLRVAYKLLENGDLEDFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK  F+ LE  AL        S +QEL E I+   +
Sbjct  386  KYSSFTQGIGKEIVEGKVGFKELEAYALNNNPIINKSGRQELLESIVNQYI  436



>ref|WP_015392438.1| xylose isomerase XylA [Clostridium saccharoperbutylacetonicum]
 gb|AGF56119.1| xylose isomerase XylA [Clostridium saccharoperbutylacetonicum 
N1-4(HMT)]
Length=439

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELNFARINNFLGSIDANQGDPMLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGG NFDAK+RR S + ED+F+A+I GMDT A+GL+ A KL+E+G L+  ++ 
Sbjct  326  LKNGGLAPGGVNFDAKVRRASFEKEDLFLAYIAGMDTFAKGLKVAHKLLENGELENFIKN  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK   + LE  AL+  E    S +QEL E I+   +
Sbjct  386  KYASFSEGIGKEIVEGKVGLKELEAYALKNNEITNKSGRQELLEAIVNQYI  436



>ref|WP_022019645.1| xylose isomerase [Bacteroides sp. CAG:661]
 emb|CCZ48270.1| xylose isomerase [Bacteroides sp. CAG:661]
Length=438

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E    M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNFELIQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   ++++ +
Sbjct  328  IRGGGFKDGGTNFDAKTRRNSTDLEDIFIAHISGMDAMARALESAAKLLEESPYRQMLAQ  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS LG   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDSGLGKDFEDGKLTLEDIVAYAKRNGEPKQISGKQELYEAIV  434



>ref|XP_005090167.1| PREDICTED: xylose isomerase-like [Aplysia californica]
Length=338

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NH TL+GHS  H+V  A    +LG++D+N+G P  GWDTDQFPMDV  ATL+M  +
Sbjct  168  NIEPNHTTLAGHSYEHDVVMASAYNMLGSVDSNTGSPDLGWDTDQFPMDVKNATLLMKVL  227

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGL PGG NFD K+RRESTD++D+FI+HIG MDT AR L+ AAK+ ++  + + V +
Sbjct  228  LRQGGLQPGGLNFDCKVRRESTDLKDMFISHIGAMDTFARALKCAAKIFDEEVISKQVEE  287

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY++F S +GA IE G    E LE+  L+ GEP   S +QE  E +L   L
Sbjct  288  RYKTFQSGIGAKIESGDTTLEELEEYVLQNGEPSQISGQQEHFENMLNYYL  338



>ref|WP_039037140.1| xylose isomerase [Pseudoalteromonas sp. ECSMB14103]
Length=439

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = -3

Query  681  MSSNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVM  502
            +  NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M
Sbjct  265  IKVNIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIM  324

Query  501  LSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKEL  322
              ++KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + 
Sbjct  325  YEILKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDF  384

Query  321  VRKRYQSFDSELGAAIEGGKADFELLEKKALEWGE---PKVPSAKQELAEMILQSAL  160
            V KRY  +  ELG +I  G+   E L   AL  G+   PK  S +QEL E I+   L
Sbjct  385  VEKRYAGWKEELGRSILNGEQSLESL--SALVHGQDINPKQVSGRQELLENIVNRYL  439



>ref|WP_021846289.1| xylose isomerase [Bacteroides sp. CAG:598]
 emb|CCX61086.1| xylose isomerase [Bacteroides sp. CAG:598]
Length=447

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  N +LG+IDAN GD Q GWDTDQFP+D  E    M+ +
Sbjct  277  NIEVNHATLAGHTFEHELAVAVDNDMLGSIDANRGDYQNGWDTDQFPIDNFELIQAMMQI  336

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GG   GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++ +
Sbjct  337  IRGGGFKDGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAKLLEESPYKQMLTQ  396

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS LG   E GK   E +   A + GEPK  S KQEL E I+
Sbjct  397  RYASFDSGLGKDFEDGKLTLEDVVAYAKQNGEPKQTSGKQELYEAIV  443



>ref|WP_013298905.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum]
 sp|P29441.2|XYLA_THETC RecName: Full=Xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69948.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=439

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  V
Sbjct  266  NIEANHATLAAHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  326  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +GA I  GKADF+ LEK ALE  E    S +QE+ E IL   L
Sbjct  386  RYASYKDGIGADIVSGKADFKSLEKYALEHSEIVNKSGRQEMLESILNQYL  436



>ref|WP_017209278.1| xylose isomerase [Clostridium beijerinckii]
Length=441

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELHFARINNFLGSIDANQGDPLLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGG NFD+K+RR S + ED+F+A+I GMDT A+GLR A KL+E+G L++ +++
Sbjct  326  LKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGMDTFAKGLRVAYKLLENGDLEDFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK  F+ LE  AL        S +QEL E I+   +
Sbjct  386  KYSSFTEGIGKEIVEGKVGFKELEAYALNNNPIINKSGRQELLESIVNQYI  436



>ref|WP_016601082.1| xylose isomerase, partial [Yersinia pestis]
Length=328

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  155  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  214

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  215  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  274

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  275  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  319



>ref|WP_029228039.1| xylose isomerase [Caldicellulosiruptor acetigenus]
Length=438

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYRSYKEGIGAKIVSGQADFKTLEEYALNLSKIENKSGKQELLEMILNKYM  435



>ref|WP_021376347.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE83572.1| xylose isomerase [Peptoclostridium difficile CD69]
 gb|KJF63558.1| xylose isomerase [Peptoclostridium difficile]
Length=445

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +  +++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_044271094.1| xylose isomerase [Candidatus Bacteroides timonensis]
Length=438

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N GL  GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  328  IRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAKLLEESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD   G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDGGKGKEFEEGKLSLEDVVAYAKANGEPKQTSGKQELYEAIV  434



>ref|WP_009120973.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EGF54042.1| xylose isomerase [Bacteroides clarus YIT 12056]
 emb|CDB82037.1| xylose isomerase [Bacteroides clarus CAG:160]
Length=438

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N GL  GG NFDAK RR STD+EDIFIAHI GMD +AR L SAAKL+E+   K+++  
Sbjct  328  IRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAAKLLEESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD   G   E GK   E +   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDGGKGKEFEDGKLTLEDVVAYAKANGEPKQTSGKQELYEAIV  434



>ref|WP_014041981.1| xylose isomerase [Caldicellulosiruptor lactoaceticus]
 gb|AEM73030.1| Xylose isomerase [Caldicellulosiruptor lactoaceticus 6A]
Length=438

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKAGGFDKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYRSYKEGIGAKIVSGQADFKTLEEYALNLSKIENKSGKQELLEMILNKYM  435



>ref|WP_013433194.1| xylose isomerase [Caldicellulosiruptor kristjanssonii]
 gb|ADQ41469.1| xylose isomerase [Caldicellulosiruptor kristjanssonii I77R1B]
Length=438

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKAGGFDKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+ADF+ LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYRSYKEGIGAKIVSGQADFKTLEEYALNLSKIENKSGKQELLEMILNKYM  435



>ref|WP_012058599.1| xylose isomerase [Clostridium beijerinckii]
 gb|ABR34543.1| xylose isomerase [Clostridium beijerinckii NCIMB 8052]
 gb|AIU04761.1| xylose isomerase [Clostridium beijerinckii ATCC 35702]
Length=441

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELHFARINKFLGSIDANQGDPLLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGG NFD+K+RR S + ED+F+A+I GMDT A+GLR A KL+E+G L++ +++
Sbjct  326  LKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGMDTFAKGLRVAYKLLENGDLEDFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK  F+ LE  AL        S +QEL E I+   +
Sbjct  386  KYSSFTEGIGKEIVEGKVGFKELEAYALNNNPIINKSGRQELLESIVNQYI  436



>ref|WP_023976124.1| MULTISPECIES: xylose isomerase [Clostridium]
 gb|ETD67089.1| xylose isomerase [Clostridium pasteurianum NRRL B-598]
Length=441

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELHFARINNFLGSIDANQGDPLLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGG NFD+K+RR S + ED+F+A+I GMDT A+GLR A KL+E+G L++ +++
Sbjct  326  LKNGGIAPGGVNFDSKVRRASFEKEDLFLAYIAGMDTFAKGLRVAYKLLENGDLEDFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK  F+ LE  AL        S +QEL E I+   +
Sbjct  386  KYSSFTQGIGKEIVEGKVGFKELEAYALNNNPIINKSGRQELLESIVNQYI  436



>ref|WP_014625278.1| xylose isomerase [Spirochaeta thermophila]
 gb|AEJ61949.1| Xylose isomerase [Spirochaeta thermophila DSM 6578]
Length=440

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARING+LG++D N GD   GWDTDQFP ++ E TL M  V
Sbjct  267  NIEMNHATLAYHTFQHELHFARINGILGSMDVNQGDYLLGWDTDQFPTNIYETTLAMYEV  326

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGG NFDAK+RR S + EDIFIAHI GMD  ARG + A KL+ED ++++ V +
Sbjct  327  IKNGGIAPGGLNFDAKVRRGSFEPEDIFIAHIAGMDAFARGFKVAWKLLEDKAIEKHVEE  386

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +G  I  GK  FE LE   ++  E K  S +QEL E +L   L
Sbjct  387  RYASYREGIGKKIVEGKVGFEDLEAYIIDKAEIKNASGRQELLEAVLNRYL  437



>ref|WP_027072689.1| xylose isomerase [Luteimonas sp. J29]
Length=444

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 118/177 (67%), Gaps = 1/177 (1%)
 Frame = -3

Query  681  MSSNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVM  502
             S NIE NHATLSGH+  H+++ A  +GLLG+IDAN G+PQ GWDTDQFP D+ +    M
Sbjct  269  FSLNIEANHATLSGHTFEHDLQVASDHGLLGSIDANRGNPQNGWDTDQFPTDLYDTVGAM  328

Query  501  LSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKEL  322
            L V++ GGL PGG NFDAK RRESTD+ED+FIAHIGGMD  ARGL  A  L+ D   ++ 
Sbjct  329  LVVLRQGGL-PGGLNFDAKPRRESTDMEDLFIAHIGGMDAFARGLEVAHALLNDSPWEQW  387

Query  321  VRKRYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*KR  151
             ++RY SFDS  GA  E GK     L   A + GEP+  S KQE  E +L   L +R
Sbjct  388  RKERYASFDSGPGADFEAGKLSLADLVAHAAKHGEPQQTSGKQERYENLLNQYLLRR  444



>ref|WP_021423576.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ65588.1| xylose isomerase [Clostridium difficile P38]
Length=445

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_034634309.1| xylose isomerase, partial [Bacillus okhensis]
 gb|KHF37733.1| xylose isomerase, partial [Bacillus okhensis]
Length=213

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TARING+LG++DAN GD   GWDTD+FP D+   TL M  +
Sbjct  38   NIEANHATLAGHTFEHELRTARINGMLGSVDANQGDTLLGWDTDEFPTDLYSTTLAMYEI  97

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KN GL  GG NFDAK+RR S D +D+F AHI GMD  A G + A +LIED  L E V  
Sbjct  98   LKNDGLGTGGLNFDAKVRRGSFDTDDLFHAHIAGMDAFAIGTKVAQRLIEDKVLDEFVAD  157

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQEL  187
            RY SF S +G  I  GK DF  LE+ AL   E    S +QEL
Sbjct  158  RYSSFTSGIGLDIVEGKTDFHKLEQHALSLKEIGNKSGRQEL  199



>ref|WP_014757233.1| MULTISPECIES: xylose isomerase [Thermoanaerobacterium]
 ref|YP_006390910.1| Xylose isomerase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|AFK85311.1| Xylose isomerase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|ETO38801.1| Xylose isomerase [Thermoanaerobacterium aotearoense SCUT27]
 gb|AIE39924.1| xylose isomerase [Thermoanaerobacterium saccharolyticum]
Length=439

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  V
Sbjct  266  NIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  326  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +GA I  GKADF+ LEK ALE  +    S +QEL E IL   L
Sbjct  386  RYASYKDGIGADIVSGKADFKSLEKYALEHSQIVNKSGRQELLESILNQYL  436



>ref|WP_038172460.1| xylose isomerase [Verrucomicrobium sp. BvORR106]
Length=436

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+E A   G LG+IDAN+GD   GWDTDQFP D+   T +ML +
Sbjct  266  NIETNHATLAGHTMRHELEVALAAGALGSIDANTGDELIGWDTDQFPTDIYLTTEIMLVL  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA +IEDG L   V++
Sbjct  326  LKMGGFTSGGLNFDAKVRRESFEPVDLFHAHIGGMDAFARGLKIAAAIIEDGRLDAFVKQ  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  169
            RY +FD+ +GA IE G+  FE LE   L+ GEP + S +QE+ E ++ 
Sbjct  386  RYSTFDNGIGAQIERGEVGFEELEAYTLKNGEPPIGSGRQEMLENLVN  433



>ref|WP_026887251.1| xylose isomerase [Clostridium beijerinckii]
Length=441

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARIN  LG+IDAN GDP  GWDTDQFP ++ +ATL M  +
Sbjct  266  NIEANHATLAQHTFQHELHFARINNFLGSIDANQGDPLLGWDTDQFPTNIYDATLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGLAPGG NFD+K+RR S + ED+F+A+I GMDT A+GLR A KL+ +G L+E +++
Sbjct  326  LKNGGLAPGGVNFDSKVRRASFEKEDLFLAYIAGMDTFAKGLRVAHKLLANGDLEEFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            +Y SF   +G  I  GK  F+ LE  AL        S +QEL E I+   +
Sbjct  386  KYSSFTQGIGKEIVEGKVGFKELEAYALNNNPIINKSGRQELLESIVNQYI  436



>sp|P30435.1|XYLA_THESA RecName: Full=Xylose isomerase [Thermoanaerobacterium saccharolyticum]
 gb|AAA03088.1| xylose isomerase [Thermoanaerobacterium saccharolyticum]
Length=439

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  V
Sbjct  266  NIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  326  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +GA I  GKADF+ LEK ALE  +    S +QEL E IL   L
Sbjct  386  RYASYKEGIGADIVSGKADFKSLEKYALEHSQIVNKSGRQELLESILNQYL  436



>ref|WP_013430944.1| xylose isomerase [Caldicellulosiruptor kronotskyensis]
 gb|ADQ46870.1| xylose isomerase [Caldicellulosiruptor kronotskyensis 2002]
Length=438

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKAGGFGKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIDE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+A+F++LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYKSYKEGIGAKIVSGEANFKMLEEYALSLDKIENKSGKQELLEMILNKYM  435



>ref|WP_013314408.1| xylose isomerase [Spirochaeta thermophila]
 gb|ADN02569.1| xylose isomerase [Spirochaeta thermophila DSM 6192]
Length=440

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  ARING+LG++D N GD   GWDTDQFP ++ E TL M  V
Sbjct  267  NIEMNHATLAYHTFQHELHFARINGILGSMDVNQGDYLLGWDTDQFPTNLYETTLAMYEV  326

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKNGG+APGG NFDAK+RR S + EDIFIAHI GMD  ARG + A KL+ED ++++ V +
Sbjct  327  IKNGGIAPGGLNFDAKVRRGSFEPEDIFIAHIAGMDAFARGFKVAWKLLEDKAIEKHVEE  386

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +G  I  GK  FE LE   ++  E K  S +QEL E +L   L
Sbjct  387  RYASYREGIGKKIVEGKVGFEDLEAYIIDKAEIKNASGRQELLEAVLNRYL  437



>ref|WP_013788885.1| xylose isomerase [Thermoanaerobacterium xylanolyticum]
 gb|AEF18157.1| Xylose isomerase [Thermoanaerobacterium xylanolyticum LX-11]
Length=439

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H   HE+  ARING+LG+IDAN+GD   GWDTDQFP D+   TL M  V
Sbjct  266  NIEANHATLAFHDFQHELRYARINGVLGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  326  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +GA I  GKADF  LEK ALE  +    S +QEL E IL   L
Sbjct  386  RYASYKDGIGADIVSGKADFRSLEKYALEHSQIVNKSGRQELLESILNQYL  436



>ref|WP_015312541.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum]
 gb|AGB20103.1| xylose isomerase [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=439

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H   HE+  ARING LG+IDAN+GD   GWDTDQFP D+   TL M  V
Sbjct  266  NIEANHATLAAHDFQHELRYARINGALGSIDANTGDMLLGWDTDQFPTDIRMTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  326  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+   +GA I  GKADF+ LEK ALE  E    S +QE+ E IL   L
Sbjct  386  RYASYKEGIGADIVSGKADFKSLEKYALEHSEIVNKSGRQEMLESILNQYL  436



>ref|WP_013238479.1| MULTISPECIES: xylose isomerase [Clostridium]
 gb|ADK14887.1| predicted xylose isomerase [Clostridium ljungdahlii DSM 13528]
 gb|AGY78133.1| Xylose isomerase [Clostridium autoethanogenum DSM 10061]
Length=440

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  AR N  LG++DAN GDP  GWDTDQFP +V + TL M  V
Sbjct  266  NIEANHATLAGHTFQHEICLARNNNALGSLDANQGDPHLGWDTDQFPTNVYDTTLSMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG+APGG NFDAK+RR S + ED+F+A+I GMD+ A+GLR A KL++D  ++  +++
Sbjct  326  LKNGGIAPGGLNFDAKVRRASFEPEDLFLAYIAGMDSFAKGLRVAYKLLQDAPIENFIKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF + +G  I  GK  F+ LEK ALE       S +QE  E ++   +
Sbjct  386  RYSSFSTGIGKDIVDGKVGFDELEKYALENNVINNKSGRQEYLESVVNQYI  436



>ref|WP_021369126.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE42109.1| xylose isomerase [Peptoclostridium difficile CD41]
 gb|EQF66993.1| xylose isomerase [Peptoclostridium difficile CD201]
Length=445

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_021412148.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQI20652.1| xylose isomerase [Clostridium difficile Y165]
Length=445

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_013626379.1| xylose isomerase [Planctomyces brasiliensis]
 gb|ADY57635.1| D-xylose isomerase [Planctomyces brasiliensis DSM 5305]
Length=436

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 114/168 (68%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS  HE+E ARI  +LG+IDAN+GD   GWDTDQFP D+   T  ML +
Sbjct  265  NIETNHATLAGHSMMHEMEYARIQDMLGSIDANTGDLLLGWDTDQFPTDIYLTTQCMLVI  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGL PGG NFDAK+RRES D  D+F AHIGGMD  ARG + AA +  DG L + V+ 
Sbjct  325  LKQGGLKPGGINFDAKVRRESFDPTDLFYAHIGGMDAFARGAKIAAAIRADGVLDDFVKD  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKV-PSAKQELAEMIL  172
            RY S+DS +G  IE G A+FE L K  L+ GE     S +QE  E I+
Sbjct  385  RYSSYDSGVGQEIEDGSANFESLSKYMLDKGEADANTSGRQEYLENII  432



>ref|WP_009891378.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_006200085.1| xylose isomerase [Peptoclostridium difficile BI1]
 gb|EQH96874.1| xylose isomerase [Clostridium difficile F253]
 gb|EQJ38592.1| xylose isomerase [Clostridium difficile P23]
 gb|EQJ77358.1| xylose isomerase [Clostridium difficile P45]
 gb|EQK85731.1| xylose isomerase [Clostridium difficile P31]
Length=445

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_009898127.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_001089578.1| xylose isomerase [Peptoclostridium difficile 630]
 emb|CAJ69956.1| Xylose isomerase [Peptoclostridium difficile 630]
 gb|EQE01648.1| xylose isomerase [Peptoclostridium difficile CD3]
 gb|EQE08496.1| xylose isomerase [Peptoclostridium difficile CD13]
 gb|EQE15056.1| xylose isomerase [Peptoclostridium difficile CD17]
 gb|EQE18626.1| xylose isomerase [Peptoclostridium difficile CD18]
 gb|EQE20922.1| xylose isomerase [Peptoclostridium difficile CD21]
 gb|EQE25993.1| xylose isomerase [Peptoclostridium difficile CD22]
 gb|EQE29593.1| xylose isomerase [Peptoclostridium difficile CD34]
 gb|EQE32510.1| xylose isomerase [Peptoclostridium difficile CD38]
 gb|EQE40998.1| xylose isomerase [Peptoclostridium difficile CD39]
 gb|EQE47185.1| xylose isomerase [Peptoclostridium difficile CD42]
 gb|EQE52245.1| xylose isomerase [Peptoclostridium difficile CD43]
 gb|EQE56340.1| xylose isomerase [Peptoclostridium difficile CD44]
 gb|EQE59925.1| xylose isomerase [Peptoclostridium difficile CD45]
 gb|EQE61807.1| xylose isomerase [Peptoclostridium difficile CD46]
 gb|EQE67835.1| xylose isomerase [Peptoclostridium difficile CD47]
 gb|EQE73383.1| xylose isomerase [Peptoclostridium difficile CD49]
 gb|EQE76032.1| xylose isomerase [Peptoclostridium difficile CD51]
 gb|EQE78106.1| xylose isomerase [Peptoclostridium difficile CD68]
 gb|EQE89803.1| xylose isomerase [Peptoclostridium difficile CD70]
 gb|EQE90036.1| xylose isomerase [Peptoclostridium difficile CD104]
 gb|EQE95031.1| xylose isomerase [Peptoclostridium difficile CD109]
 gb|EQF01536.1| xylose isomerase [Peptoclostridium difficile CD129]
 gb|EQF01725.1| xylose isomerase [Peptoclostridium difficile CD131]
 gb|EQF04489.1| xylose isomerase [Peptoclostridium difficile CD132]
 gb|EQF08956.1| xylose isomerase [Peptoclostridium difficile CD133]
 gb|EQF13448.1| xylose isomerase [Peptoclostridium difficile CD144]
 gb|EQF17676.1| xylose isomerase [Peptoclostridium difficile CD149]
 gb|EQF25157.1| xylose isomerase [Peptoclostridium difficile CD159]
 gb|EQF30719.1| xylose isomerase [Peptoclostridium difficile CD165]
 gb|EQF35439.1| xylose isomerase [Peptoclostridium difficile CD166]
 gb|EQF38595.1| xylose isomerase [Peptoclostridium difficile CD169]
 gb|EQF43727.1| xylose isomerase [Peptoclostridium difficile CD170]
 gb|EQF49602.1| xylose isomerase [Peptoclostridium difficile CD178]
 gb|EQF51757.1| xylose isomerase [Peptoclostridium difficile CD181]
 gb|EQF59063.1| xylose isomerase [Peptoclostridium difficile CD200]
 gb|EQF60209.1| xylose isomerase [Peptoclostridium difficile CD196]
 gb|EQF74925.1| xylose isomerase [Peptoclostridium difficile CD211]
 gb|EQF79514.1| xylose isomerase [Peptoclostridium difficile 342]
 gb|EQF85662.1| xylose isomerase [Peptoclostridium difficile 655]
 gb|EQF87405.1| xylose isomerase [Peptoclostridium difficile 824]
 gb|EQF93982.1| xylose isomerase [Peptoclostridium difficile 840]
 gb|EQF94288.1| xylose isomerase [Peptoclostridium difficile 842]
 gb|EQG00794.1| xylose isomerase [Peptoclostridium difficile 6041]
 gb|EQG04453.1| xylose isomerase [Peptoclostridium difficile 6042]
 gb|EQG07308.1| xylose isomerase [Peptoclostridium difficile 6057]
 gb|EQG08669.1| xylose isomerase [Peptoclostridium difficile DA00044]
 gb|EQG17277.1| xylose isomerase [Peptoclostridium difficile DA00062]
 gb|EQG21796.1| xylose isomerase [Peptoclostridium difficile DA00114]
 gb|EQG27364.1| xylose isomerase [Peptoclostridium difficile DA00126]
 gb|EQG31616.1| xylose isomerase [Peptoclostridium difficile DA00129]
 gb|EQG32925.1| xylose isomerase [Peptoclostridium difficile DA00128]
 gb|EQG39021.1| xylose isomerase [Clostridium difficile DA00131]
 gb|EQG41765.1| xylose isomerase [Clostridium difficile DA00132]
 gb|EQG44081.1| xylose isomerase [Clostridium difficile DA00134]
 gb|EQG50860.1| xylose isomerase [Clostridium difficile DA00141]
 gb|EQG55523.1| xylose isomerase [Clostridium difficile DA00142]
 gb|EQG55697.1| xylose isomerase [Clostridium difficile DA00145]
 gb|EQG58956.1| xylose isomerase [Clostridium difficile DA00149]
 gb|EQG64463.1| xylose isomerase [Clostridium difficile DA00154]
 gb|EQG67823.1| xylose isomerase [Clostridium difficile DA00160]
 gb|EQG74313.1| xylose isomerase [Clostridium difficile DA00165]
 gb|EQG74989.1| xylose isomerase [Clostridium difficile DA00167]
 gb|EQG80554.1| xylose isomerase [Clostridium difficile DA00183]
 gb|EQG82128.1| xylose isomerase [Clostridium difficile DA00174]
 gb|EQG90093.1| xylose isomerase [Clostridium difficile DA00191]
 gb|EQG91727.1| xylose isomerase [Clostridium difficile DA00189]
 gb|EQG93286.1| xylose isomerase [Clostridium difficile DA00193]
 gb|EQH01415.1| xylose isomerase [Clostridium difficile DA00196]
 gb|EQH02374.1| xylose isomerase [Clostridium difficile DA00195]
 gb|EQH07253.1| xylose isomerase [Clostridium difficile DA00197]
 gb|EQH11286.1| xylose isomerase [Clostridium difficile DA00203]
 gb|EQH16986.1| xylose isomerase [Clostridium difficile DA00210]
 gb|EQH19049.1| xylose isomerase [Clostridium difficile DA00212]
 gb|EQH21244.1| xylose isomerase [Clostridium difficile DA00211]
 gb|EQH27947.1| xylose isomerase [Clostridium difficile DA00215]
 gb|EQH33652.1| xylose isomerase [Clostridium difficile DA00238]
 gb|EQH33729.1| xylose isomerase [Clostridium difficile DA00232]
 gb|EQH35646.1| xylose isomerase [Clostridium difficile DA00216]
 gb|EQH40082.1| xylose isomerase [Clostridium difficile DA00244]
 gb|EQH46390.1| xylose isomerase [Clostridium difficile DA00246]
 gb|EQH48431.1| xylose isomerase [Clostridium difficile DA00245]
 gb|EQH54096.1| xylose isomerase [Clostridium difficile DA00261]
 gb|EQH59051.1| xylose isomerase [Clostridium difficile DA00273]
 gb|EQH60142.1| xylose isomerase [Clostridium difficile DA00275]
 gb|EQH63488.1| xylose isomerase [Clostridium difficile DA00256]
 gb|EQH67395.1| xylose isomerase [Clostridium difficile DA00305]
 gb|EQH69872.1| xylose isomerase [Clostridium difficile DA00306]
 gb|EQH74613.1| xylose isomerase [Clostridium difficile DA00307]
 gb|EQH79245.1| xylose isomerase [Clostridium difficile DA00310]
 gb|EQH81328.1| xylose isomerase [Clostridium difficile DA00313]
 gb|EQH86870.1| xylose isomerase [Clostridium difficile F152]
 gb|EQH92463.1| xylose isomerase [Clostridium difficile F249]
 gb|EQH98070.1| xylose isomerase [Clostridium difficile F314]
 gb|EQI04458.1| xylose isomerase [Clostridium difficile Y10]
 gb|EQI09688.1| xylose isomerase [Clostridium difficile Y21]
 gb|EQI16335.1| xylose isomerase [Clostridium difficile Y41]
 gb|EQI20016.1| xylose isomerase [Clostridium difficile Y155]
 gb|EQI24220.1| xylose isomerase [Clostridium difficile Y171]
 gb|EQI28648.1| xylose isomerase [Clostridium difficile Y184]
 gb|EQI33282.1| xylose isomerase [Clostridium difficile Y215]
 gb|EQI37326.1| xylose isomerase [Clostridium difficile Y202]
 gb|EQI40230.1| xylose isomerase [Clostridium difficile Y231]
 gb|EQI45261.1| xylose isomerase [Clostridium difficile Y247]
 gb|EQI50233.1| xylose isomerase [Clostridium difficile Y270]
 gb|EQI54457.1| xylose isomerase [Clostridium difficile Y266]
 gb|EQI55619.1| xylose isomerase [Clostridium difficile Y307]
 gb|EQI56034.1| xylose isomerase [Clostridium difficile Y312]
 gb|EQI64060.1| xylose isomerase [Clostridium difficile Y343]
 gb|EQI65175.1| xylose isomerase [Clostridium difficile Y358]
 gb|EQI71845.1| xylose isomerase [Clostridium difficile Y381]
 gb|EQI77153.1| xylose isomerase [Clostridium difficile Y384]
 gb|EQI78026.1| xylose isomerase [Clostridium difficile Y401]
 gb|EQI78173.1| xylose isomerase [Clostridium difficile P1]
 gb|EQI84893.1| xylose isomerase [Clostridium difficile P2]
 gb|EQI90063.1| xylose isomerase [Clostridium difficile P3]
 gb|EQI98886.1| xylose isomerase [Clostridium difficile P6]
 gb|EQJ08241.1| xylose isomerase [Clostridium difficile P8]
 gb|EQJ14493.1| xylose isomerase [Clostridium difficile P9]
 gb|EQJ15166.1| xylose isomerase [Clostridium difficile P11]
 gb|EQJ22276.1| xylose isomerase [Clostridium difficile P15]
 gb|EQJ29066.1| xylose isomerase [Clostridium difficile P19]
 gb|EQJ33738.1| xylose isomerase [Clostridium difficile P21]
 gb|EQJ34478.1| xylose isomerase [Clostridium difficile P20]
 gb|EQJ44681.1| xylose isomerase [Clostridium difficile P25]
 gb|EQJ45644.1| xylose isomerase [Clostridium difficile P24]
 gb|EQJ57731.1| xylose isomerase [Clostridium difficile P32]
 gb|EQJ67025.1| xylose isomerase [Clostridium difficile P42]
 gb|EQJ70774.1| xylose isomerase [Clostridium difficile P36]
 gb|EQJ87881.1| xylose isomerase [Clostridium difficile P50]
 gb|EQJ89221.1| xylose isomerase [Clostridium difficile P49]
 gb|EQJ94626.1| xylose isomerase [Clostridium difficile P51]
 gb|EQJ99998.1| xylose isomerase [Clostridium difficile P61]
 gb|EQK02305.1| xylose isomerase [Clostridium difficile P59]
 gb|EQK04229.1| xylose isomerase [Clostridium difficile P78]
 gb|EQK10687.1| xylose isomerase [Clostridium difficile P69]
 gb|EQK16957.1| xylose isomerase [Clostridium difficile P72]
 gb|EQK37729.1| xylose isomerase [Clostridium difficile P77]
 gb|EQK49092.1| xylose isomerase [Clostridium difficile F480]
 gb|EQK51346.1| xylose isomerase [Clostridium difficile F525]
 gb|EQK54747.1| xylose isomerase [Clostridium difficile F200]
 gb|EQK58237.1| xylose isomerase [Clostridium difficile F548]
 gb|EQK64361.1| xylose isomerase [Clostridium difficile F601]
 gb|EQK68079.1| xylose isomerase [Clostridium difficile CD90]
 gb|EQK69966.1| xylose isomerase [Clostridium difficile CD92]
 gb|EQK72693.1| xylose isomerase [Clostridium difficile CD111]
 gb|EQK74047.1| xylose isomerase [Clostridium difficile CD113]
 gb|EQK80012.1| xylose isomerase [Clostridium difficile CD127]
 gb|EQK85900.1| xylose isomerase [Clostridium difficile P30]
 gb|EQL05253.1| xylose isomerase [Clostridium difficile CD88]
 gb|EQL06681.1| xylose isomerase [Clostridium difficile CD86]
 gb|ERM23750.1| xylose isomerase [Clostridium difficile P41]
 gb|ERM24697.1| xylose isomerase [Clostridium difficile P33]
 gb|ERM26495.1| xylose isomerase [Clostridium difficile DA00130]
 gb|ERM34891.1| xylose isomerase [Clostridium difficile P64]
 gb|ERM45012.1| xylose isomerase [Clostridium difficile F665]
 gb|ERM46949.1| xylose isomerase [Clostridium difficile P53]
 emb|CCL09474.1| Xylose isomerase [Peptoclostridium difficile E16]
 emb|CCL27325.1| Xylose isomerase [Clostridium difficile T11]
 emb|CCL31303.1| Xylose isomerase [Clostridium difficile E15]
 emb|CCL35322.1| Xylose isomerase [Peptoclostridium difficile T23]
 emb|CCL39146.1| Xylose isomerase [Clostridium difficile E19]
 emb|CCL43343.1| Xylose isomerase [Clostridium difficile E24]
 emb|CCL47357.1| Xylose isomerase [Clostridium difficile T42]
 emb|CCL54438.1| Xylose isomerase [Clostridium difficile E14]
 emb|CCL58589.1| Xylose isomerase [Peptoclostridium difficile T17]
 emb|CCL62121.1| Xylose isomerase [Clostridium difficile E9]
 emb|CCL66125.1| Xylose isomerase [Clostridium difficile E7]
 emb|CCL70060.1| Xylose isomerase [Clostridium difficile T3]
 emb|CCL73732.1| Xylose isomerase [Clostridium difficile E28]
 emb|CCL77430.1| Xylose isomerase [Clostridium difficile E23]
 emb|CCL81265.1| Xylose isomerase [Clostridium difficile E12]
 emb|CCL84764.1| Xylose isomerase [Clostridium difficile T19]
 emb|CCL88962.1| Xylose isomerase [Clostridium difficile T10]
 emb|CCL92635.1| Xylose isomerase [Clostridium difficile T14]
 emb|CCL96886.1| Xylose isomerase [Peptoclostridium difficile T61]
 gb|EZR29626.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDS88891.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CDS89521.1| xylose isomerase [Peptoclostridium difficile]
 emb|CDT71017.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CEJ99702.1| Xylose isomerase [Peptoclostridium difficile]
 gb|AJP12826.1| xylose isomerase [Peptoclostridium difficile 630]
Length=445

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_002560285.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EIY49934.1| xylose isomerase [Bacteroides nordii CL02T12C05]
 gb|EOA57940.1| xylose isomerase [Bacteroides sp. HPS0048]
Length=438

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N GL  GG NFDAK RR STD+EDIFIAHI GMD +AR L SAA L+ +   K+++  
Sbjct  328  IRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAANLLNESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD+  G   E GK   E L   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDAGKGKEFEDGKLSLEDLVSYAKTNGEPKQTSGKQELYEAIV  434



>ref|WP_009906213.1| xylose isomerase [Peptoclostridium difficile]
 emb|CCK88406.1| Xylose isomerase [Peptoclostridium difficile T5]
 emb|CCK91841.1| Xylose isomerase [Peptoclostridium difficile T20]
 emb|CCK95551.1| Xylose isomerase [Peptoclostridium difficile E1]
 emb|CCK99539.1| Xylose isomerase [Peptoclostridium difficile E10]
Length=445

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_021393548.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQG16946.1| xylose isomerase [Peptoclostridium difficile DA00065]
 gb|EQK20169.1| xylose isomerase [Clostridium difficile P71]
 gb|EQK28958.1| xylose isomerase [Clostridium difficile P74]
 emb|CCL03401.1| Xylose isomerase [Peptoclostridium difficile E13]
 emb|CCL08382.1| Xylose isomerase [Peptoclostridium difficile CD002]
Length=445

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_021421788.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQJ55091.1| xylose isomerase [Clostridium difficile P29]
Length=445

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLESILNRYI  436



>ref|WP_021388228.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQF46170.1| xylose isomerase [Peptoclostridium difficile CD175]
Length=445

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_007173223.1| xylose isomerase [Prevotella bergensis]
 gb|EFA44479.1| xylose isomerase [Prevotella bergensis DSM 17361]
Length=439

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  N +LG+IDAN GD Q GWDTDQFP+D  + T  M+ V
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNDMLGSIDANRGDAQNGWDTDQFPIDNFDLTQAMMQV  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGL  GG NFDAKLRR STD EDIFIAHI GMD +AR L +AA ++E+  L  ++++
Sbjct  328  IRNGGLGTGGSNFDAKLRRNSTDPEDIFIAHISGMDAMARALLNAAAIMEESPLPGMLKE  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  G   E GK   E L   A + GEPK  S KQEL E I+
Sbjct  388  RYASFDSGEGKCFEEGKMSLEDLVAYAKKAGEPKQISGKQELYETIV  434



>ref|WP_009959507.1| xylose isomerase [Verrucomicrobium spinosum]
Length=436

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+E A   G LG+IDAN+GD   GWDTDQFP D+   T +ML +
Sbjct  266  NIETNHATLAGHTMRHELEVALAAGALGSIDANTGDELIGWDTDQFPTDIYLTTEIMLVL  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA +IEDG L+  +++
Sbjct  326  LKMGGFTTGGLNFDAKVRRESFEPVDLFHAHIGGMDAFARGLKIAAAIIEDGRLEGFLKQ  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQ  169
            RY +FDS +GA IE G   FE LE   L+ GEP + S +QE+ E ++ 
Sbjct  386  RYSTFDSGIGAQIERGDVGFEELEAYTLKNGEPAIGSGRQEMLENLVN  433



>gb|EHJ36230.1| xylose isomerase [Peptoclostridium difficile 70-100-2010]
Length=454

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  275  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  335  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  395  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_012816370.1| xylose isomerase [Peptoclostridium difficile]
 ref|YP_003219374.1| xylose isomerase [Peptoclostridium difficile R20291]
 emb|CBA65635.1| xylose isomerase [Peptoclostridium difficile CD196]
 emb|CBE06558.1| xylose isomerase [Peptoclostridium difficile R20291]
Length=454

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  275  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  335  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  395  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>gb|EFH05881.1| xylose isomerase [Clostridium difficile NAP08]
 gb|EFH17349.1| xylose isomerase [Clostridium difficile NAP07]
Length=454

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  275  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  335  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  395  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_015907182.1| xylose isomerase [Caldicellulosiruptor bescii]
 sp|B9MPG8.1|XYLA_CALBD RecName: Full=Xylose isomerase [Caldicellulosiruptor bescii DSM 
6725]
 gb|ACM59729.1| xylose isomerase [Caldicellulosiruptor bescii DSM 6725]
Length=438

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKAGGFDKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKDGVFDKFIDE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+A+F++LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYKSYKEGIGAKIVSGEANFKMLEEYALSLDKIENKSGKQELLEMILNKYM  435



>gb|EHJ32437.1| xylose isomerase [Peptoclostridium difficile 002-P50-2011]
Length=454

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  275  NIEANHATLAGHTFQHELNIARINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  335  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  395  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_021361041.1| xylose isomerase [Peptoclostridium difficile]
 gb|EQE03070.1| xylose isomerase [Peptoclostridium difficile CD8]
 gb|EQE03425.1| xylose isomerase [Peptoclostridium difficile CD9]
 gb|EQI94371.1| xylose isomerase [Clostridium difficile P5]
 gb|EQJ05263.1| xylose isomerase [Clostridium difficile P7]
 gb|EQJ16852.1| xylose isomerase [Clostridium difficile P13]
 gb|EQJ77004.1| xylose isomerase [Clostridium difficile P46]
 gb|EQJ80819.1| xylose isomerase [Clostridium difficile P48]
 gb|EQK14534.1| xylose isomerase [Clostridium difficile P70]
 gb|EQK27028.1| xylose isomerase [Clostridium difficile P73]
 gb|EQK29846.1| xylose isomerase [Clostridium difficile P75]
 gb|ERM33438.1| xylose isomerase [Clostridium difficile P37]
Length=445

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNIARINDVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_012374578.1| xylose isomerase [Opitutus terrae]
 ref|YP_001818641.1| xylose isomerase [Opitutus terrae PB90-1]
 gb|ACB75041.1| xylose isomerase [Opitutus terrae PB90-1]
Length=444

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 1/172 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+E A   G+LG+IDAN+GD   GWDTDQF  DV E TL M+S+
Sbjct  271  NIETNHATLAGHTFSHEIEVAASQGMLGSIDANTGDLLLGWDTDQFNTDVKELTLAMVSI  330

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGL  GGFNFDAK+RR+S D++D+F AHIGGMD  A   + A +++ DG  ++ V  
Sbjct  331  LKAGGLGSGGFNFDAKVRRQSIDLDDLFHAHIGGMDAYALAFKIARRILADGKFEQFVAD  390

Query  312  RYQSFDSELGAAIEGGKADFELLEKKAL-EWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS+ G  IE G+  F+ L K  L + GEPK  S KQE  E +L S L
Sbjct  391  RYASFDSDYGRDIEKGRIGFKELNKLVLNKLGEPKPRSGKQEYLENLLNSYL  442



>ref|WP_038670249.1| xylose isomerase [Ruminococcus bicirculans]
 emb|CCO03825.1| xylose isomerase [Ruminococcus bicirculans]
Length=441

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 117/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP +  +ATL M  V
Sbjct  266  NIEANHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNAYDATLCMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK RR S  +EDIF+++I GMDT A GL++AAK+IEDG L + V  
Sbjct  326  LKAGGFTNGGLNFDAKARRGSYTMEDIFLSYIAGMDTFALGLKAAAKIIEDGRLDKFVDD  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  160
            RY S+ + +GA I  GKAD E LEK A+E GE    + S +QE  E +L   +
Sbjct  386  RYASWTTGIGADIIAGKADMESLEKYAVEKGEVTDSLSSGRQEYLESVLNQIM  438



>ref|WP_022287212.1| xylose isomerase [Ruminococcus sp. CAG:57]
 emb|CDC67329.1| xylose isomerase [Ruminococcus sp. CAG:57]
Length=441

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 117/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP +  +ATL M  V
Sbjct  266  NIEANHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNAYDATLCMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK RR S  +EDIF+++I GMDT A GL++AAK+IEDG L + V  
Sbjct  326  LKAGGFTNGGLNFDAKARRGSYTMEDIFLSYIAGMDTFALGLKAAAKIIEDGRLDKFVDD  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  160
            RY S+ + +GA I  GKAD E LEK A+E GE    + S +QE  E +L   +
Sbjct  386  RYASWTTGIGADIIAGKADMESLEKYAVEKGEVTDSLSSGRQEYLESVLNQIM  438



>ref|WP_021896825.1| xylose isomerase [Prevotella sp. CAG:924]
 emb|CCY01767.1| xylose isomerase [Prevotella sp. CAG:924]
Length=439

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  + T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELACAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYDLTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+NGGL  GG NFDAKLRR STD EDIFIAHI GMD +AR L +AA +IE   +  +V++
Sbjct  328  IRNGGLHEGGSNFDAKLRRNSTDPEDIFIAHISGMDAMARALLNAADIIEHSEIPAMVKE  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD+  G A E GK   E +   A + GEPK  S KQE  E ++
Sbjct  388  RYASFDAGEGKAFEEGKLSLEQIVDYAKKVGEPKQTSGKQEKYETLV  434



>gb|AIF26293.1| putative xylose isomerase, partial [uncultured bacterium Lq_025_E06]
Length=374

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  AR NG LG+IDAN GD Q GWDTDQFP+D  E T  M+ V
Sbjct  203  NIEVNHATLAGHTFEHELTVARENGFLGSIDANRGDAQNGWDTDQFPVDAYELTQAMMQV  262

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I NGGL  GG NFDAKLRR STD EDIFIAHI  MD +A  L +AA ++E+  L ++V++
Sbjct  263  ILNGGLGNGGTNFDAKLRRSSTDPEDIFIAHISAMDAMAHALLNAATVLEESPLCQMVKE  322

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS LG   E GKA  E L K A   GEP V S KQEL E +L
Sbjct  323  RYASFDSGLGKQFEEGKATLEDLYKYAKAVGEPTVASGKQELYETLL  369



>ref|WP_012570371.1| xylose isomerase [Coxiella burnetii]
 gb|ACJ18944.1| xylose isomerase [Coxiella burnetii CbuG_Q212]
Length=436

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS  HE+  A  N + G++DAN GDPQ GWDTDQFP+D+ E  LV+  +
Sbjct  266  NIEANHATLAGHSFAHEIAYACANDIFGSVDANRGDPQLGWDTDQFPIDLQETVLVLYLI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K+GG   GGFNFDAKLRR+S D+ED+F AHI G+DTLARGL  AA +IE+  LK    K
Sbjct  326  LKHGGFTSGGFNFDAKLRRQSLDLEDLFYAHISGIDTLARGLLIAATIIENDKLKTTKEK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  172
            RYQ++   L A +  GK DFE + K+AL+   +PK  S +QE  E  L
Sbjct  386  RYQAWKEPLNANMLSGKLDFETIAKRALDNNLDPKPTSGEQEKLERWL  433



>ref|WP_005769174.1| xylose isomerase [Coxiella burnetii]
 gb|EAX33351.1| xylose isomerase [Coxiella burnetii 'MSU Goat Q177']
 gb|EDR36202.1| xylose isomerase [Coxiella burnetii Q321]
 gb|ACJ19819.1| xylose isomerase [Coxiella burnetii CbuK_Q154]
 gb|AIT62837.1| Xylose isomerase [Coxiella burnetii str. Namibia]
Length=436

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS  HE+  A  N + G++DAN GDPQ GWDTDQFP+D+ E  LV+  +
Sbjct  266  NIEANHATLAGHSFAHEIAYACANDIFGSVDANRGDPQLGWDTDQFPIDLQETVLVLYLI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K+GG   GGFNFDAKLRR+S D+ED+F AHI G+DTLARGL  AA +IE+  LK    K
Sbjct  326  LKHGGFTSGGFNFDAKLRRQSLDLEDLFYAHISGIDTLARGLLIAATIIENDKLKTTKEK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  172
            RYQ++   L A +  GK DFE + K+AL+   +PK  S +QE  E  L
Sbjct  386  RYQAWKEPLNANMLSGKLDFETIAKRALDNNLDPKPTSGEQEKLERWL  433



>ref|WP_022618581.1| Xylose isomerase [Peptoclostridium difficile]
 emb|CCL15498.1| Xylose isomerase [Peptoclostridium difficile T22]
 emb|CCL19498.1| Xylose isomerase [Clostridium difficile E25]
 emb|CCL23442.1| Xylose isomerase [Clostridium difficile T15]
 emb|CCL50480.1| Xylose isomerase [Clostridium difficile T6]
Length=445

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  +RIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  266  NIEANHATLAGHTFQHELNISRINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  326  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  386  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  436



>ref|WP_008131330.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
 dbj|GAA76310.1| xylose isomerase [Pseudoalteromonas sp. BSi20480]
Length=439

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 1/175 (1%)
 Frame = -3

Query  681  MSSNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVM  502
            +  NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M
Sbjct  265  IKVNIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIM  324

Query  501  LSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKEL  322
              ++KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + 
Sbjct  325  YEILKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDF  384

Query  321  VRKRYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  160
            V KRY  +  ELG +I  G+   E L     +    P+  S +QEL E I+   L
Sbjct  385  VEKRYAGWKEELGQSILNGEQSLESLSALVHQQNINPEQVSGRQELLENIVNRYL  439



>ref|WP_043090972.1| xylose isomerase, partial [Xanthomonas sp. SHU166]
Length=201

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATLSGHS  H+++ A   GLLG+IDAN G+PQ GWDTDQFP+D+ +    ML V
Sbjct  29   NIEANHATLSGHSFEHDLQVASDAGLLGSIDANRGNPQNGWDTDQFPVDLYDTVGAMLVV  88

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFDAK+RRES+D +D+FIAHIGGMD  ARGL  A  L+    L++  R+
Sbjct  89   LRQGGLAPGGLNFDAKVRRESSDPQDLFIAHIGGMDAFARGLEVAHALLTASPLEQWRRE  148

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS  GAA   G +    L   A + GEP   S +QE  E ++   L
Sbjct  149  RYASFDSGAGAAFAAGTSTLADLATHAAQAGEPTQRSGRQEAYENLINQYL  199



>ref|WP_035601129.1| xylose isomerase [Haloferula sp. BvORR071]
Length=435

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A   G LG+IDAN GD   GWDTDQFP D+   T VML +
Sbjct  265  NIETNHATLAGHTMEHELTVAMDAGALGSIDANQGDELLGWDTDQFPSDLYGTTKVMLKL  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GG   GG NFDAK RRES +  D+F AHIGGMD  ARGLR AA + EDG +   V+ 
Sbjct  325  LEMGGFTTGGLNFDAKRRRESHEPVDLFHAHIGGMDAFARGLRVAAAIREDGRISNFVKT  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY S+D+ +GA IE GK DF+ L   AL  GEP V S +QEL E IL   L
Sbjct  385  RYSSWDNGIGAEIEAGKMDFDQLSDWALRNGEPVVASGRQELMENILNELL  435



>ref|WP_012341741.1| xylose isomerase [Histophilus somni]
 sp|B0UT19.1|XYLA_HISS2 RecName: Full=Xylose isomerase [Haemophilus somnus 2336]
 gb|ACA32619.1| xylose isomerase [Haemophilus somnus 2336]
Length=439

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  +
Sbjct  266  NIEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  
Sbjct  326  LKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDN  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  160
            RY  +D ELG  I  GKA  E L K     G +PK  S +QE  E ++ S L
Sbjct  386  RYAGWDQELGQKILSGKASLEDLAKIVETQGLDPKPVSGQQEYLENLVNSYL  437



>ref|WP_010556356.1| xylose isomerase [Pseudoalteromonas marina]
 gb|ERG25884.1| xylose isomerase [Pseudoalteromonas marina mano4]
Length=439

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 117/170 (69%), Gaps = 5/170 (3%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TL+M  +
Sbjct  268  NIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLIMYEI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG   GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + V K
Sbjct  328  LKNGGFTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELSDFVEK  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE---PKVPSAKQELAEMIL  172
            RY  +  ELG +I  G+   E L   AL  G+   P+  S +QEL E I+
Sbjct  388  RYAGWKEELGQSILNGEQSLESL--SALVHGQNINPEQVSGRQELLENIV  435



>gb|EHJ34457.1| xylose isomerase [Peptoclostridium difficile 050-P50-2011]
Length=454

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  +RIN +LG+IDAN GD   GWDTDQFP ++ +ATL M  V
Sbjct  275  NIEANHATLAGHTFQHELNISRINNVLGSIDANQGDLLLGWDTDQFPTNIYDATLAMYEV  334

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG+APGGFNFD+K+RR S +VED+F+A+I GMDT A+GL  A KL+ED   +   ++
Sbjct  335  LKQGGIAPGGFNFDSKVRRASFEVEDLFLAYIAGMDTFAKGLLIAHKLLEDEVFENFTKE  394

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF   +G  I  GK  F+ LE  AL+    K  S +QE+ E IL   +
Sbjct  395  RYASFSEGIGKDIVEGKVGFKELESYALQMPVIKNKSGRQEMLEAILNRYI  445



>ref|WP_006978554.1| xylose isomerase [Chthoniobacter flavus]
 gb|EDY20935.1| xylose isomerase [Chthoniobacter flavus Ellin428]
Length=437

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 115/168 (68%), Gaps = 1/168 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GHS  HE+E A  +G LG+IDAN+GD   GWDTDQFP DV   T  ML +
Sbjct  266  NLETNHATLAGHSMQHEMEVAGASGALGSIDANTGDLLLGWDTDQFPTDVYLTTQCMLGI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RRES D ED+F AHIGGMD  ARGL+ AA +  DG L + V+ 
Sbjct  326  LKYGGFTTGGVNFDAKVRRESIDPEDLFHAHIGGMDAFARGLKIAAAIRADGRLDQFVKD  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEP-KVPSAKQELAEMIL  172
            RY S+D+ LGA+IE GK  F  LEK ALE GE     S +QE  E ++
Sbjct  386  RYASWDNGLGASIEAGKESFASLEKFALEKGEAGGAASGRQEFLENLI  433



>ref|WP_016679053.1| xylose isomerase, partial [Yersinia pestis]
Length=395

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  222  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  281

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  282  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  341

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  342  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  386



>ref|WP_035688493.1| xylose isomerase [Avibacterium paragallinarum]
Length=439

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 7/175 (4%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ TA   G+ G+IDAN GDPQ+GWDTDQFP  V E TLVM  +
Sbjct  266  NIEANHATLAGHSFHHEIATAYALGIFGSIDANRGDPQSGWDTDQFPNSVEENTLVMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGG   GGFNFDAK+RR+S D  D+F  HIG +D LA  LR AA +I+D  L++LV +
Sbjct  326  LKNGGFTTGGFNFDAKIRRQSNDPYDLFYGHIGAIDVLALSLRRAADMIQDQQLQKLVEQ  385

Query  312  RYQSFDSELGAAIEGGKADFE----LLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY  +DS+LG AI  G    E    L+E + L    P+  S +QE  E ++   +
Sbjct  386  RYSGWDSQLGKAILSGNTSLEALAQLVETQNL---NPQPVSGQQEYLENLVNRYI  437



>ref|WP_005931926.1| MULTISPECIES: xylose isomerase [Bacteroides]
 gb|EIY61146.1| xylose isomerase [Bacteroides salyersiae CL02T12C01]
 gb|EOA48558.1| xylose isomerase [Bacteroides salyersiae WAL 10018 = DSM 18765 
= JCM 12988]
 emb|CCY48397.1| xylose isomerase [Bacteroides sp. CAG:189]
Length=438

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 111/167 (66%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A  NG+LG+IDAN GD Q GWDTDQFP+D  E T  M+ +
Sbjct  268  NIEVNHATLAGHTFEHELAVAVDNGMLGSIDANRGDYQNGWDTDQFPIDNYELTQAMMQI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+N GL  GG NFDAK RR STD+EDIFIAHI GMD +AR L SAA L+ +   K+++  
Sbjct  328  IRNDGLGNGGTNFDAKTRRNSTDLEDIFIAHIAGMDAMARALESAANLLNESPYKKMLAD  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFD   G   E GK   E L   A   GEPK  S KQEL E I+
Sbjct  388  RYASFDGGKGKDFEEGKLSLEDLVAYAKANGEPKQTSGKQELYEAIV  434



>ref|WP_013043164.1| xylose isomerase [Coraliomargarita akajimensis]
 gb|ADE54442.1| xylose isomerase [Coraliomargarita akajimensis DSM 45221]
Length=434

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 113/171 (66%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  A    +LG+IDAN GD   GWDTDQFP D+   T VML V
Sbjct  264  NIETNHATLAGHTMEHELTVAMNANMLGSIDANRGDELIGWDTDQFPTDIYLTTQVMLCV  323

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GG   GG NFDAK RRES +  D+  AHIGGMD  ARGL+ AA + EDG L   V+ 
Sbjct  324  LEMGGFTTGGLNFDAKRRRESHEPIDLMHAHIGGMDAFARGLKIAAAIREDGRLANFVKD  383

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS+LGA IE G   F+ LEK AL  GEP + S +QE+ E ++   L
Sbjct  384  RYSSFDSDLGAKIEAGNCSFDELEKLALSAGEPSLASGRQEMLENLVNEFL  434



>ref|WP_013403911.1| xylose isomerase [Caldicellulosiruptor hydrothermalis]
 gb|ADQ07765.1| xylose isomerase [Caldicellulosiruptor hydrothermalis 108]
Length=438

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH  HHE+  ARIN +LG+IDAN GD   GWDTDQFP DV   TL M  V
Sbjct  265  NIEVNHATLAGHDFHHELRFARINNMLGSIDANMGDLLLGWDTDQFPTDVRLTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S ++ED+ I HI GMD  A+G + A KL+++G   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRGSFELEDLVIGHIAGMDAFAKGFKIAYKLVKNGVFDKFIDE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+A+F++LE+ AL   + +  S KQEL EMIL   +
Sbjct  385  RYKSYKEGIGAKIVSGEANFKMLEEYALSLDKIENKSGKQELLEMILNKYM  435



>ref|WP_022587522.1| xylose isomerase [Caldanaerobacter subterraneus]
 gb|ERM92670.1| xylose isomerase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=438

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH   HE+  ARIN +LG+IDAN GD   GWDTDQFP D+   TL M  V
Sbjct  265  NIEVNHATLAGHEFQHELRYARINNILGSIDANMGDMLLGWDTDQFPTDIRMTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+FIAHI GMD  A+G + A +L++DG   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRASFEPEDLFIAHIAGMDAFAKGFKVAYRLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKV--PSAKQELAEMILQSAL  160
            RY+S+   +GA I  G+A+F+ LE+ AL    PK+   S KQEL E IL   L
Sbjct  385  RYKSYKEGIGAEIVSGRANFKTLEEYAL--NNPKIENKSGKQELLESILNQYL  435



>ref|WP_028514448.1| xylose isomerase [Ruminococcus flavefaciens]
Length=438

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 115/173 (66%), Gaps = 2/173 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE+  AR NG+ G+IDAN GDP  GWDTDQFP ++ + T+ M  V
Sbjct  263  NIEANHATLAQHTFQHELRVARDNGVFGSIDANQGDPLLGWDTDQFPTNIYDTTMCMYEV  322

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK RR S   EDIF+++I GMD  A G R+A KLIEDG + + V  
Sbjct  323  IKAGGFTNGGLNFDAKARRGSFTPEDIFLSYIAGMDAFALGFRAALKLIEDGRIDKFVED  382

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMILQSAL  160
            RY S+ + +GA I  GKADF  LEK ALE GE    + S +QE+ E I+ + L
Sbjct  383  RYASWKTGIGADIIAGKADFASLEKYALEKGEVTASLTSGRQEMLESIVNNVL  435



>ref|WP_010040427.1| xylose isomerase [Gemmata obscuriglobus]
Length=437

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 120/173 (69%), Gaps = 3/173 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+ H+  HE+E A ING+LG+IDAN GDP  GWDTDQFP D+     VML V
Sbjct  265  NVETNHATLAKHTMGHELEYASINGMLGSIDANRGDPLLGWDTDQFPTDLYLTAQVMLIV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +  GG+  GG NFDAK+RR+S +  D+F AHIGGMD  A GL+ AA + +DG LK++V+K
Sbjct  325  LNQGGIGSGGMNFDAKVRRDSFEPIDLFHAHIGGMDAFAHGLKIAAAMRKDGVLKDMVKK  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG--EPKVPSAKQELAEMILQSAL  160
            RY S+DS +GA IE GK  FE LE   L+ G  EP V S +QEL E I+   L
Sbjct  385  RYASWDSGVGADIEAGKVKFEELEAYMLKKGEAEPNV-SGRQELIENIINRYL  436



>ref|WP_041604097.1| xylose isomerase [Histophilus somni]
Length=439

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 114/172 (66%), Gaps = 1/172 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  +
Sbjct  266  NIEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  
Sbjct  326  LKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDN  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  160
            RY  +D ELG  I  GKA  E L K     G  PK  S +QE  E ++ S L
Sbjct  386  RYAGWDQELGQKILNGKASLEDLAKIVETQGLAPKPVSGQQEYLENLVNSYL  437



>ref|WP_038506942.1| xylose isomerase [Cellulophaga lytica]
 gb|AIM61890.1| xylose isomerase [Cellulophaga lytica]
Length=441

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE++ A   G+LG+IDAN GD Q GWDTDQFP ++ E T  ML  
Sbjct  271  NIEVNHATLAQHTFQHELQVAANEGMLGSIDANRGDYQNGWDTDQFPNNIQETTEAMLVF  330

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K+GGL  GG NFDAK+RR STD+ED+F+AHIGG DT AR L +A K+I   +  EL +K
Sbjct  331  LKSGGLQGGGVNFDAKIRRNSTDLEDVFLAHIGGADTFARALLTADKIITSSAYDELRKK  390

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS  G   E GK + + L K ALE GE  + S KQEL E I+   +
Sbjct  391  RYASFDSGKGKDFEDGKLNLQDLHKIALENGELDLISGKQELFENIINQYI  441



>ref|WP_034646410.1| xylose isomerase [Cellulophaga geojensis]
 gb|EWH12674.1| xylose isomerase [Cellulophaga geojensis KL-A]
Length=441

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+ H+  HE++ A   G+LG+IDAN GD Q GWDTDQFP ++ E T  ML  
Sbjct  271  NIEVNHATLAQHTFQHELQVAANEGMLGSIDANRGDYQNGWDTDQFPNNIQETTEAMLVF  330

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K+GGL  GG NFDAK+RR STD+ED+F+AHIGG DT AR L +A K+I   +  EL +K
Sbjct  331  LKSGGLQGGGVNFDAKIRRNSTDLEDVFLAHIGGADTFARALLTADKIITSSAYDELRKK  390

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS  G   E GK + + L K ALE GE  + S KQEL E I+   +
Sbjct  391  RYASFDSGKGKDFEDGKLNLQDLHKIALENGELDLISGKQELFENIINQYI  441



>gb|ABI24864.1| D-xylose isomerase [Haemophilus somnus 129PT]
Length=441

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 114/172 (66%), Gaps = 1/172 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TA   G+ G+IDAN GDPQ GWDTDQFP  V E TL M  +
Sbjct  268  NIEANHATLAGHTFQHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEI  327

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GGFNFDAK+RR+STD  D+F AHIG MD LA  L+ AAK+IED +L+++V  
Sbjct  328  LKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDN  387

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMILQSAL  160
            RY  +D ELG  I  GKA  E L K     G  PK  S +QE  E ++ S L
Sbjct  388  RYAGWDQELGQKILNGKASLEDLAKIVETQGLAPKPVSGQQEYLENLVNSYL  439



>ref|WP_034748529.1| xylose isomerase [Bacillus wakoensis]
 dbj|GAE27371.1| xylose isomerase [Bacillus wakoensis JCM 9140]
Length=440

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 111/171 (65%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+ TARING+LG++DAN GD   GWDTD+FP D+   TL M  +
Sbjct  264  NIEANHATLAGHTFEHELRTARINGMLGSVDANQGDTLLGWDTDEFPTDLYSTTLAMYEI  323

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IKN GL  GG NFDAK+RR S D +D+F AHI GMD  A G + A +LI+D  L   V  
Sbjct  324  IKNDGLGTGGLNFDAKVRRGSFDTDDLFHAHIAGMDAFAIGAKVAQRLIDDKVLDNFVAD  383

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SF S +G  I  GK DF  LEK ALE  E K  S +QE  + I+   L
Sbjct  384  RYSSFTSGIGLDIVEGKTDFHKLEKHALELSEVKNISGRQEYLKGIVNKYL  434



>ref|WP_007414259.1| xylose isomerase [Pedosphaera parvula]
 gb|EEF61725.1| xylose isomerase [bacterium Ellin514]
Length=437

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            N+E NHATL+GH+  HE+E A   G LG+IDAN+GDP  GWDTDQFP D+   +  ML++
Sbjct  266  NLETNHATLAGHTMQHEMEVAAAAGALGSIDANTGDPMLGWDTDQFPTDIYLTSQCMLTI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GGL  GG NFDAK+RRES +  D+F AHIGGMD  ARGL+ AA + +DG L E V++
Sbjct  326  MKMGGLTTGGVNFDAKVRRESFEPIDLFHAHIGGMDAFARGLKIAAAIRKDGRLAEFVQQ  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGE--PKVPSAKQELAEMIL  172
            RY S+DS +GA IE GK DF+ LE   L+ GE  P   S +QE+ E ++
Sbjct  386  RYSSYDSGIGAKIEKGKTDFKELEAYILKKGEAAPNT-SGRQEMLENLI  433



>ref|WP_039529996.1| xylose isomerase, partial [Xanthomonas arboricola]
 gb|KER83208.1| xylose isomerase, partial [Xanthomonas arboricola pv. celebensis]
Length=185

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 112/171 (65%), Gaps = 1/171 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATLSGHS  H+++ A   GLLG+IDAN G+PQ GWDTDQFP D+ +    ML V
Sbjct  14   NIEANHATLSGHSFEHDLQVASDAGLLGSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVV  73

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            ++ GGLAPGG NFDAK+RRES+D +D+F+AHIGGMD  ARGL  A  L+    L++   +
Sbjct  74   LRQGGLAPGGLNFDAKVRRESSDPQDLFLAHIGGMDAFARGLEVANALLTSSPLEQWRAE  133

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY SFDS  GA    G +    L K A    EPK  S +QE  E ++   L
Sbjct  134  RYASFDSGAGADFANGSSTLVDLAKYA-AGNEPKQLSGRQEAYENLINQYL  183



>ref|WP_015923669.1| xylose isomerase [Halothermothrix orenii]
 gb|ACL70700.1| xylose isomerase [Halothermothrix orenii H 168]
Length=439

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  +RING+LG++DAN GD   GWDTDQFP ++ E TL M  +
Sbjct  266  NIEANHATLAGHTFQHELHVSRINGMLGSVDANQGDLLLGWDTDQFPTNIYETTLAMYEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +KNGGL PGG NFDAK+RR S +  D+F AHI GMD  ARGL+ A KL+E G L++ + +
Sbjct  326  LKNGGLEPGGLNFDAKVRRASFEPVDLFYAHIAGMDAFARGLKVAHKLLESGELEDFISE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY+S+ + +G  I  G+  F+ LE  AL  G+    S +QEL E I+   +
Sbjct  386  RYKSYRNGIGEKIVKGEVGFKELEDYALNNGKITNVSGRQELLESIVNKYI  436



>ref|WP_006569355.1| xylose isomerase [Thermoanaerobacter siderophilus]
 gb|EIV99412.1| xylose isomerase [Thermoanaerobacter siderophilus SR4]
Length=438

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH   HE+  ARIN +LG+IDAN GD   GWDTDQFP D+   TL M  V
Sbjct  265  NIEANHATLAGHDFQHELRYARINNMLGSIDANMGDMLLGWDTDQFPTDIRMTTLAMYEV  324

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S + ED+F+ HI GMD  A+G + A KL++DG   + + +
Sbjct  325  IKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKDGVFDKFIEE  384

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKV--PSAKQELAEMILQSAL  160
            RY+S+   +GA I  GKA+F++LE+ AL    PK+   S KQEL E IL   L
Sbjct  385  RYKSYREGIGAEIVNGKANFKILEEYAL--NNPKIENKSGKQELLESILNQYL  435



>ref|WP_033847877.1| MULTISPECIES: xylose isomerase [Yersinia]
Length=439

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  266  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  326  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  386  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_025863290.1| xylose isomerase [Prolixibacter bellariivorans]
Length=441

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS  HE+  A    LLG+IDAN GD Q GWDTD+FP ++ E T  M+ +
Sbjct  271  NIEVNHATLAGHSFAHELRMATDAKLLGSIDANKGDNQNGWDTDEFPTNIYEVTEAMMEI  330

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            I+ GG   GG NFDAKLRR STD+EDIFIAH+ GMDT ARGL  A K++ +    E  +K
Sbjct  331  IQAGGFTDGGINFDAKLRRNSTDLEDIFIAHVSGMDTFARGLIIADKVLNESDYLERRKK  390

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMIL  172
            RY SFDS  GA  E GK   E L + A E GEPK  S KQEL E ++
Sbjct  391  RYASFDSGKGAEFEAGKLTLEQLREVANEVGEPKQISGKQELLEQMI  437



>ref|WP_032466856.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|KGA65859.1| xylose isomerase [Yersinia pseudotuberculosis]
Length=439

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  266  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  326  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  386  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_012230197.1| xylose isomerase [Yersinia pestis]
 sp|A9R5Q1.1|XYLA_YERPG RecName: Full=Xylose isomerase [Yersinia pestis Angola]
 gb|ABX85301.1| xylose isomerase [Yersinia pestis Angola]
 gb|AJJ82566.1| xylose isomerase [Yersinia pestis Angola]
Length=439

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  266  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  326  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  386  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_002209593.1| MULTISPECIES: xylose isomerase [Yersinia]
 ref|YP_654034.1| xylose isomerase [Yersinia pestis Antiqua]
 ref|YP_649612.1| xylose isomerase [Yersinia pestis Nepal516]
 ref|YP_002348901.1| xylose isomerase [Yersinia pestis CO92]
 sp|Q8Z9Z1.1|XYLA_YERPE RecName: Full=Xylose isomerase [Yersinia pestis]
 sp|Q663Y3.1|XYLA_YERPS RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis IP 
32953]
 sp|Q1CDB8.1|XYLA_YERPN RecName: Full=Xylose isomerase [Yersinia pestis Nepal516]
 sp|Q1C0D3.1|XYLA_YERPA RecName: Full=Xylose isomerase [Yersinia pestis Antiqua]
 sp|A4TS63.1|XYLA_YERPP RecName: Full=Xylose isomerase [Yersinia pestis Pestoides F]
 sp|A7FP68.1|XYLA_YERP3 RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis IP 
31758]
 sp|B2K7D2.1|XYLA_YERPB RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 sp|B1JH40.1|XYLA_YERPY RecName: Full=Xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|AAM87601.1|AE014007_5 D-xylose isomerase [Yersinia pestis KIM10+]
 gb|AAS63561.1| xylose isomerase [Yersinia pestis biovar Microtus str. 91001]
 emb|CAH23129.1| xylose isomerase [Yersinia pseudotuberculosis IP 32953]
 gb|ABG20012.1| D-xylose isomerase [Yersinia pestis Nepal516]
 gb|ABG16089.1| D-xylose isomerase [Yersinia pestis Antiqua]
 emb|CAL22614.1| xylose isomerase [Yersinia pestis CO92]
 gb|ABP42125.1| D-xylose isomerase [Yersinia pestis Pestoides F]
 gb|EDM40499.1| xylose isomerase [Yersinia pestis CA88-4125]
 gb|ABS49160.1| xylose isomerase [Yersinia pseudotuberculosis IP 31758]
 gb|EDR33700.1| xylose isomerase [Yersinia pestis biovar Orientalis str. IP275]
 gb|EDR38307.1| xylose isomerase [Yersinia pestis biovar Orientalis str. F1991016]
 gb|EDR43750.1| xylose isomerase [Yersinia pestis biovar Antiqua str. E1979001]
 gb|EDR50018.1| xylose isomerase [Yersinia pestis biovar Antiqua str. B42003004]
 gb|EDR57228.1| xylose isomerase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gb|EDR60427.1| xylose isomerase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gb|EDR65090.1| xylose isomerase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gb|ACA66370.1| xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|ACC91054.1| xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 gb|EEO74586.1| D-xylose isomerase [Yersinia pestis Nepal516]
 gb|EEO83219.1| D-xylose isomerase [Yersinia pestis biovar Orientalis str. India 
195]
 gb|EEO86156.1| D-xylose isomerase [Yersinia pestis biovar Orientalis str. PEXU2]
 gb|EEO92697.1| D-xylose isomerase [Yersinia pestis Pestoides A]
 gb|ACY60456.1| xylose isomerase [Yersinia pestis D106004]
 gb|ACY64227.1| xylose isomerase [Yersinia pestis D182038]
 gb|EFA47585.1| xylose isomerase [Yersinia pestis KIM D27]
 gb|ADW00936.1| D-xylose isomerase [Yersinia pestis biovar Medievalis str. Harbin 
35]
 gb|AEL71794.1| xylose isomerase [Yersinia pestis A1122]
 gb|EIQ83290.1| xylose isomerase [Yersinia pestis PY-01]
 gb|EIQ83366.1| xylose isomerase [Yersinia pestis PY-02]
 gb|EIQ83458.1| xylose isomerase [Yersinia pestis PY-03]
 gb|EIQ96581.1| xylose isomerase [Yersinia pestis PY-04]
 gb|EIQ97867.1| xylose isomerase [Yersinia pestis PY-05]
 gb|EIR00942.1| xylose isomerase [Yersinia pestis PY-06]
 gb|EIR12092.1| xylose isomerase [Yersinia pestis PY-07]
 gb|EIR12163.1| xylose isomerase [Yersinia pestis PY-08]
 gb|EIR13602.1| xylose isomerase [Yersinia pestis PY-09]
 gb|EIR26348.1| xylose isomerase [Yersinia pestis PY-10]
 gb|EIR26950.1| xylose isomerase [Yersinia pestis PY-11]
 gb|EIR28175.1| xylose isomerase [Yersinia pestis PY-12]
 gb|EIR40744.1| xylose isomerase [Yersinia pestis PY-13]
 gb|EIR41848.1| xylose isomerase [Yersinia pestis PY-14]
 gb|EIR41920.1| xylose isomerase [Yersinia pestis PY-15]
 gb|EIR55112.1| xylose isomerase [Yersinia pestis PY-16]
 gb|EIR59432.1| xylose isomerase [Yersinia pestis PY-25]
 gb|EIR65819.1| xylose isomerase [Yersinia pestis PY-19]
 gb|EIR69624.1| xylose isomerase [Yersinia pestis PY-29]
 gb|EIR70354.1| xylose isomerase [Yersinia pestis PY-34]
 gb|EIR70784.1| xylose isomerase [Yersinia pestis PY-32]
 gb|EIR82307.1| xylose isomerase [Yersinia pestis PY-36]
 gb|EIR84992.1| xylose isomerase [Yersinia pestis PY-42]
 gb|EIR86963.1| xylose isomerase [Yersinia pestis PY-45]
 gb|EIR99013.1| xylose isomerase [Yersinia pestis PY-47]
 gb|EIR99031.1| xylose isomerase [Yersinia pestis PY-46]
 gb|EIR99393.1| xylose isomerase [Yersinia pestis PY-48]
 gb|EIS12053.1| xylose isomerase [Yersinia pestis PY-52]
 gb|EIS13455.1| xylose isomerase [Yersinia pestis PY-53]
 gb|EIS15935.1| xylose isomerase [Yersinia pestis PY-54]
 gb|EIS25359.1| xylose isomerase [Yersinia pestis PY-55]
 gb|EIS26461.1| xylose isomerase [Yersinia pestis PY-56]
 gb|EIS35596.1| xylose isomerase [Yersinia pestis PY-58]
 gb|EIS38705.1| xylose isomerase [Yersinia pestis PY-60]
 gb|EIS39249.1| xylose isomerase [Yersinia pestis PY-59]
 gb|EIS51557.1| xylose isomerase [Yersinia pestis PY-61]
 gb|EIS51928.1| xylose isomerase [Yersinia pestis PY-63]
 gb|EIS52664.1| xylose isomerase [Yersinia pestis PY-64]
 gb|EIS63440.1| xylose isomerase [Yersinia pestis PY-65]
 gb|EIS65175.1| xylose isomerase [Yersinia pestis PY-66]
 gb|EIS72332.1| xylose isomerase [Yersinia pestis PY-71]
 gb|EIS73657.1| xylose isomerase [Yersinia pestis PY-72]
 gb|EIS82786.1| xylose isomerase [Yersinia pestis PY-76]
 gb|EIS85391.1| xylose isomerase [Yersinia pestis PY-88]
 gb|EIS89108.1| xylose isomerase [Yersinia pestis PY-89]
 gb|EIS94365.1| xylose isomerase [Yersinia pestis PY-90]
 gb|EIT01007.1| xylose isomerase [Yersinia pestis PY-91]
 gb|EIT09192.1| xylose isomerase [Yersinia pestis PY-93]
 gb|EIT09500.1| xylose isomerase [Yersinia pestis PY-94]
 gb|EIT09583.1| xylose isomerase [Yersinia pestis PY-92]
 gb|EIT22087.1| xylose isomerase [Yersinia pestis PY-95]
 gb|EIT23772.1| xylose isomerase [Yersinia pestis PY-96]
 gb|EIT25332.1| xylose isomerase [Yersinia pestis PY-98]
 gb|EIT37378.1| xylose isomerase [Yersinia pestis PY-99]
 gb|EIT38231.1| xylose isomerase [Yersinia pestis PY-100]
 gb|EIT38685.1| xylose isomerase [Yersinia pestis PY-101]
 gb|EIT51676.1| xylose isomerase [Yersinia pestis PY-102]
 gb|EIT51770.1| xylose isomerase [Yersinia pestis PY-103]
 gb|EIT52667.1| xylose isomerase [Yersinia pestis PY-113]
 gb|EKS43352.1| xylose isomerase [Yersinia pestis INS]
 gb|ERP78426.1| xylose isomerase [Yersinia pestis 24H]
 gb|ERP78457.1| xylose isomerase [Yersinia pestis S3]
 gb|ERP79516.1| xylose isomerase [Yersinia pestis 113]
 gb|ERP84291.1| xylose isomerase [Yersinia pestis 9]
 gb|EXU73353.1| xylose isomerase [Yersinia pestis EV NIIEG]
 gb|KFB61373.1| xylose isomerase [Yersinia pestis subsp. pestis]
 gb|AIN12544.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|KGA52725.1| xylose isomerase [Yersinia pestis]
 gb|AJI93601.1| xylose isomerase [Yersinia pestis]
 gb|AJK08309.1| xylose isomerase [Yersinia pestis]
 gb|AJJ49856.1| xylose isomerase [Yersinia pestis]
 gb|AJJ55712.1| xylose isomerase [Yersinia pseudotuberculosis IP 32953]
 gb|AJJ00256.1| xylose isomerase [Yersinia pestis Pestoides F]
 gb|AJJ01227.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ05453.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ58237.1| xylose isomerase [Yersinia pseudotuberculosis YPIII]
 gb|AJJ65752.1| xylose isomerase [Yersinia pseudotuberculosis PB1/+]
 gb|AJJ72785.1| xylose isomerase [Yersinia pseudotuberculosis]
 gb|AJJ13104.1| xylose isomerase [Yersinia pestis]
 gb|AJJ76118.1| xylose isomerase [Yersinia pestis A1122]
 gb|AJJ33411.1| xylose isomerase [Yersinia pestis]
 gb|AJJ78027.1| xylose isomerase [Yersinia pestis Antiqua]
 gb|AJJ90104.1| xylose isomerase [Yersinia pestis CO92]
 gb|AJJ41996.1| xylose isomerase [Yersinia pestis]
 gb|AJJ42605.1| xylose isomerase [Yersinia pestis]
 gb|AJK11082.1| xylose isomerase [Yersinia pestis str. Pestoides B]
 gb|AJK14634.1| xylose isomerase [Yersinia pseudotuberculosis str. PA3606]
 gb|AJK23024.1| xylose isomerase [Yersinia pestis Pestoides G]
 gb|AJK21483.1| xylose isomerase [Yersinia pestis]
 gb|KJG87721.1| xylose isomerase [Yersinia pestis subsp. microtus bv. Ulegeica]
 gb|KJG89667.1| xylose isomerase [Yersinia pestis subsp. microtus bv. Ulegeica]
Length=439

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GHS HHE+ +A   G+ G++DAN GDPQ GWDTDQFP  V E TLVM  +
Sbjct  266  NIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENTLVMFEI  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDAK+RR+STD  D+F  HIG MDT+A  L+ AAK+IEDG L ++V K
Sbjct  326  LKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKFAAKMIEDGQLDQIVAK  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAE  181
            RY  ++SELG  I  GK   E L + A +    P+  S  QEL E
Sbjct  386  RYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQHQSGHQELLE  430



>ref|WP_012896352.1| xylose isomerase [Thermotoga naphthophila]
 gb|ADA67225.1| xylose isomerase [Thermotoga naphthophila RKU-10]
Length=444

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+  HE+  ARI G LG+IDAN GD   GWDTDQFP ++ + TL M  V
Sbjct  266  NIEANHATLAGHTFQHELRMARILGKLGSIDANQGDLLLGWDTDQFPTNIYDTTLAMYEV  325

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            IK GG   GG NFDAK+RR S  VED+FI HI GMDT A G + A KL++DG   + + +
Sbjct  326  IKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGFKIAYKLVKDGVFDKFIEE  385

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL*K  154
            +Y+SF   +G  I  GK DFE LE+  ++  + ++PS KQE  E +L S + K
Sbjct  386  KYRSFKEGIGKEIVEGKTDFEKLEEYIIDKEDIELPSGKQEYLESLLNSYIVK  438



>ref|WP_016710605.1| xylose isomerase [Pseudoalteromonas haloplanktis]
Length=439

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = -3

Query  681  MSSNIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVM  502
            +  NIE NHATL+GHS HHE+  A   G++G+IDAN GD Q GWDTDQFP DVAE TLVM
Sbjct  265  IKVNIEANHATLAGHSFHHEIAVACAEGIMGSIDANRGDMQNGWDTDQFPNDVAECTLVM  324

Query  501  LSVIKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKEL  322
              ++K+GGL  GGFNFD KLRR+S + +D+FI HIGGMDT+A+ L +AA +IE G L + 
Sbjct  325  YEILKSGGLTTGGFNFDTKLRRQSCERDDLFIGHIGGMDTMAKALLNAAAMIEGGELADF  384

Query  321  VRKRYQSFDSELGAAIEGGKADFELLEKKALEWG-EPKVPSAKQELAEMIL  172
            V KRY  +  +LG +I  G+   E L     E   +PK  S +QEL E I+
Sbjct  385  VEKRYAGWKEDLGQSILKGEQSLESLAALVHENNIDPKQVSGRQELLENIV  435



>ref|WP_018199100.1| hypothetical protein [Candidatus Hydrogenedens terephthalicus]
Length=438

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 114/171 (67%), Gaps = 0/171 (0%)
 Frame = -3

Query  672  NIECNHATLSGHSCHHEVETARINGLLGNIDANSGDPQTGWDTDQFPMDVAEATLVMLSV  493
            NIE NHATL+GH+ HHE+  A INGLLG++DAN GD   GWDTDQFP D+ + TL M  +
Sbjct  267  NIEANHATLAGHTFHHELAFAAINGLLGSVDANRGDLLLGWDTDQFPTDLYDTTLAMYII  326

Query  492  IKNGGLAPGGFNFDAKLRRESTDVEDIFIAHIGGMDTLARGLRSAAKLIEDGSLKELVRK  313
            +K GG   GG NFDA +RR+S D  D+F AHIG MD  ARGL+ A KL++D   ++ + +
Sbjct  327  LKAGGFTTGGLNFDAHVRRQSIDPIDLFYAHIGAMDAFARGLKIAEKLLKDKVFEKAIAQ  386

Query  312  RYQSFDSELGAAIEGGKADFELLEKKALEWGEPKVPSAKQELAEMILQSAL  160
            RY  ++ +LG  IE  K  F  L K A E GEPK+ S +QEL E IL   +
Sbjct  387  RYAGWNKDLGKKIESKKVSFVELAKYAEEHGEPKLQSGRQELLENILNDYI  437



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335