BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015B15

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797250.1|  PREDICTED: high mobility group B protein 7-like    174   4e-50   Nicotiana sylvestris
ref|XP_011070479.1|  PREDICTED: high mobility group B protein 7-like    174   5e-50   Sesamum indicum [beniseed]
ref|XP_009630975.1|  PREDICTED: high mobility group B protein 7-like    173   1e-49   Nicotiana tomentosiformis
ref|XP_006360847.1|  PREDICTED: high mobility group B protein 7-like    167   2e-47   Solanum tuberosum [potatoes]
ref|XP_004236870.1|  PREDICTED: high mobility group B protein 7         166   4e-47   Solanum lycopersicum
ref|XP_011031229.1|  PREDICTED: high mobility group B protein 7-like    157   1e-43   Populus euphratica
ref|XP_002310906.2|  hypothetical protein POPTR_0007s15320g             155   5e-43   Populus trichocarpa [western balsam poplar]
gb|ABK93630.1|  unknown                                                 155   8e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010103584.1|  High mobility group B protein 7                    154   1e-42   Morus notabilis
ref|XP_007043200.1|  High-mobility group box 6                          154   2e-42   
ref|XP_004150195.1|  PREDICTED: high mobility group B protein 7-like    154   3e-42   Cucumis sativus [cucumbers]
ref|XP_010248937.1|  PREDICTED: high mobility group B protein 7-like    153   4e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002267697.2|  PREDICTED: high mobility group B protein 7         152   6e-42   
ref|XP_008389062.1|  PREDICTED: high mobility group B protein 7-like    153   8e-42   
gb|EYU35548.1|  hypothetical protein MIMGU_mgv1a012961mg                153   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_007224613.1|  hypothetical protein PRUPE_ppa026912mg             150   3e-41   
emb|CDP16974.1|  unnamed protein product                                150   6e-41   Coffea canephora [robusta coffee]
ref|XP_006448478.1|  hypothetical protein CICLE_v10016587mg             150   8e-41   Citrus clementina [clementine]
ref|XP_006468697.1|  PREDICTED: high mobility group B protein 7-like    150   8e-41   
ref|XP_008221094.1|  PREDICTED: high mobility group B protein 7-like    150   8e-41   Prunus mume [ume]
gb|KDO77000.1|  hypothetical protein CISIN_1g026850mg                   150   1e-40   Citrus sinensis [apfelsine]
gb|KDO77003.1|  hypothetical protein CISIN_1g026850mg                   149   2e-40   Citrus sinensis [apfelsine]
ref|XP_009351762.1|  PREDICTED: high mobility group B protein 7-l...    149   2e-40   
ref|XP_009351760.1|  PREDICTED: high mobility group B protein 7-l...    149   2e-40   
ref|XP_004497256.1|  PREDICTED: high mobility group B protein 7-l...    148   3e-40   Cicer arietinum [garbanzo]
ref|XP_008810905.1|  PREDICTED: high mobility group B protein 7-like    148   3e-40   Phoenix dactylifera
ref|XP_004497257.1|  PREDICTED: high mobility group B protein 7-l...    148   3e-40   Cicer arietinum [garbanzo]
gb|KJB49541.1|  hypothetical protein B456_008G147700                    149   3e-40   Gossypium raimondii
gb|KHG07657.1|  High mobility group B 7 -like protein                   147   9e-40   Gossypium arboreum [tree cotton]
ref|XP_010034169.1|  PREDICTED: high mobility group B protein 7         147   2e-39   Eucalyptus grandis [rose gum]
gb|KDP40471.1|  hypothetical protein JCGZ_24470                         145   6e-39   Jatropha curcas
ref|XP_010546256.1|  PREDICTED: high mobility group B protein 7         145   7e-39   Tarenaya hassleriana [spider flower]
ref|XP_002513135.1|  DNA-binding protein MNB1B, putative                144   1e-38   Ricinus communis
gb|KEH44448.1|  high mobility group (HMG)-box protein                   144   1e-38   Medicago truncatula
ref|XP_004297711.1|  PREDICTED: high mobility group B protein 7-like    144   3e-38   Fragaria vesca subsp. vesca
ref|NP_001236719.1|  uncharacterized protein LOC100306558               143   3e-38   Glycine max [soybeans]
ref|XP_008802830.1|  PREDICTED: high mobility group B protein 7-like    142   3e-38   Phoenix dactylifera
gb|KHN37346.1|  High mobility group B protein 7                         143   4e-38   Glycine soja [wild soybean]
gb|AFK37944.1|  unknown                                                 142   4e-38   Lotus japonicus
ref|XP_010940378.1|  PREDICTED: high mobility group B protein 7-like    142   5e-38   Elaeis guineensis
gb|KHN23128.1|  High mobility group B protein 7                         142   7e-38   Glycine soja [wild soybean]
gb|ACG31059.1|  HMG1/2-like protein                                     142   9e-38   Zea mays [maize]
ref|XP_007142737.1|  hypothetical protein PHAVU_007G012700g             141   1e-37   Phaseolus vulgaris [French bean]
ref|XP_003536758.1|  PREDICTED: high mobility group B protein 7-like    141   2e-37   Glycine max [soybeans]
gb|EPS72473.1|  hypothetical protein M569_02286                         140   2e-37   Genlisea aurea
emb|CDY64875.1|  BnaCnng45460D                                          142   2e-37   Brassica napus [oilseed rape]
ref|XP_002444850.1|  hypothetical protein SORBIDRAFT_07g000230          141   2e-37   Sorghum bicolor [broomcorn]
ref|XP_009385984.1|  PREDICTED: high mobility group B protein 7-like    139   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004972392.1|  PREDICTED: high mobility group B protein 7-l...    140   9e-37   Setaria italica
ref|XP_006288568.1|  hypothetical protein CARUB_v10001858mg             140   9e-37   Capsella rubella
ref|XP_008677776.1|  PREDICTED: nucleosome/chromatin assembly fac...    141   1e-36   
gb|KJB49542.1|  hypothetical protein B456_008G147700                    136   3e-36   Gossypium raimondii
ref|XP_010421142.1|  PREDICTED: high mobility group B protein 7-l...    138   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010454621.1|  PREDICTED: high mobility group B protein 7-like    138   7e-36   Camelina sativa [gold-of-pleasure]
gb|KFK27649.1|  hypothetical protein AALP_AA8G410700                    138   9e-36   Arabis alpina [alpine rockcress]
ref|XP_006848664.1|  hypothetical protein AMTR_s00171p00070550          136   2e-35   Amborella trichopoda
emb|CDY46957.1|  BnaA02g32890D                                          137   2e-35   Brassica napus [oilseed rape]
emb|CDY16851.1|  BnaA09g05310D                                          136   3e-35   Brassica napus [oilseed rape]
ref|XP_009141528.1|  PREDICTED: high mobility group B protein 7-like    136   4e-35   Brassica rapa
emb|CDY40795.1|  BnaC02g41640D                                          135   6e-35   Brassica napus [oilseed rape]
ref|XP_010493464.1|  PREDICTED: high mobility group B protein 7-like    135   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006394608.1|  hypothetical protein EUTSA_v10004817mg             135   8e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009130114.1|  PREDICTED: high mobility group B protein 7-l...    135   9e-35   Brassica rapa
gb|EAZ05273.1|  hypothetical protein OsI_27476                          134   1e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001060758.1|  Os08g0101100                                       133   2e-34   
ref|XP_006659014.1|  PREDICTED: high mobility group B protein 7-like    130   2e-33   Oryza brachyantha
ref|XP_010688617.1|  PREDICTED: high mobility group B protein 7         129   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004972391.1|  PREDICTED: high mobility group B protein 7-l...    127   2e-31   
ref|XP_002874129.1|  hypothetical protein ARALYDRAFT_910356             124   3e-31   
ref|NP_568431.1|  high-mobility group B6 protein                        124   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573245.1|  PREDICTED: high mobility group B protein 7-like    124   1e-30   Brachypodium distachyon [annual false brome]
gb|EMS56844.1|  High mobility group B protein 7                         123   2e-30   Triticum urartu
dbj|BAK07893.1|  predicted protein                                      122   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009130115.1|  PREDICTED: high mobility group B protein 7-l...    121   7e-30   Brassica rapa
ref|XP_008465567.1|  PREDICTED: high mobility group B protein 7         117   1e-28   Cucumis melo [Oriental melon]
gb|ABK23898.1|  unknown                                                 117   5e-28   Picea sitchensis
ref|XP_008340418.1|  PREDICTED: high mobility group B protein 7-l...    109   4e-25   Malus domestica [apple tree]
ref|XP_002873936.1|  hypothetical protein ARALYDRAFT_488801             106   4e-24   
ref|XP_008340417.1|  PREDICTED: high mobility group B protein 7-l...    100   1e-21   Malus domestica [apple tree]
ref|XP_006574164.1|  PREDICTED: high mobility group B protein 7-like  98.2    2e-21   
gb|KHM99982.1|  High mobility group B protein 7                       95.9    5e-21   Glycine soja [wild soybean]
ref|NP_001105076.1|  nucleosome/chromatin assembly factor D           84.7    1e-16   
gb|EYU41881.1|  hypothetical protein MIMGU_mgv1a015087mg              84.0    2e-16   Erythranthe guttata [common monkey flower]
emb|CAJ38371.1|  HMG-protein                                          83.2    7e-16   Plantago major [cart-track plant]
ref|XP_010421143.1|  PREDICTED: high mobility group B protein 7-l...  82.0    1e-15   
ref|NP_001190371.1|  high-mobility group B6 protein                   81.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232565.1|  PREDICTED: HMG1/2-like protein                   80.9    2e-15   Solanum lycopersicum
ref|XP_010262835.1|  PREDICTED: high mobility group B protein 1-like  81.3    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006340837.1|  PREDICTED: HMG1/2-like protein-like              80.9    2e-15   Solanum tuberosum [potatoes]
emb|CAA05365.1|  high mobility group protein                          80.9    2e-15   Solanum tuberosum [potatoes]
gb|EPS72658.1|  hypothetical protein M569_02099                       81.6    2e-15   Genlisea aurea
gb|AFW65042.1|  hypothetical protein ZEAMMB73_846021                  80.1    2e-15   
ref|XP_007046509.1|  High mobility group B4, putative                 80.5    2e-15   Theobroma cacao [chocolate]
ref|XP_010692886.1|  PREDICTED: HMG1/2-like protein isoform X2        79.7    4e-15   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP21129.1|  unnamed protein product                              79.7    4e-15   Coffea canephora [robusta coffee]
ref|XP_008243826.1|  PREDICTED: high mobility group B protein 1-l...  80.5    4e-15   Prunus mume [ume]
ref|XP_009420828.1|  PREDICTED: DNA-binding protein MNB1B-like        80.1    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387918.1|  PREDICTED: DNA-binding protein MNB1B-like is...  79.7    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387916.1|  PREDICTED: HMG1/2-like protein isoform X4        79.7    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010692885.1|  PREDICTED: high mobility group B protein 3-l...  79.7    5e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006833354.1|  hypothetical protein AMTR_s00109p00094550        79.0    5e-15   Amborella trichopoda
ref|XP_011094996.1|  PREDICTED: high mobility group B protein 1       80.1    5e-15   Sesamum indicum [beniseed]
ref|XP_009387915.1|  PREDICTED: HMG1/2-like protein isoform X3        79.7    6e-15   
ref|XP_009383540.1|  PREDICTED: HMG1/2-like protein                   79.7    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387914.1|  PREDICTED: HMG1/2-like protein isoform X2        79.7    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243819.1|  PREDICTED: high mobility group B protein 1-l...  80.1    6e-15   Prunus mume [ume]
ref|XP_006576167.1|  PREDICTED: uncharacterized protein LOC100499...  79.7    6e-15   
ref|XP_006576170.1|  PREDICTED: uncharacterized protein LOC100499...  79.7    6e-15   
ref|NP_001238631.1|  uncharacterized protein LOC100499704             79.7    6e-15   
gb|KJB10395.1|  hypothetical protein B456_001G198900                  79.0    6e-15   Gossypium raimondii
gb|ADD74180.2|  high mobility group box 3 protein                     79.0    7e-15   Gossypium hirsutum [American cotton]
ref|XP_009387913.1|  PREDICTED: HMG1/2-like protein isoform X1        79.3    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246321.1|  PREDICTED: high mobility group B protein 1       79.7    7e-15   Solanum lycopersicum
gb|KCW88103.1|  hypothetical protein EUGRSUZ_A00506                   79.7    8e-15   Eucalyptus grandis [rose gum]
ref|XP_006425283.1|  hypothetical protein CICLE_v10026715mg           79.0    8e-15   Citrus clementina [clementine]
ref|XP_010028985.1|  PREDICTED: high mobility group B protein 1       79.3    9e-15   Eucalyptus grandis [rose gum]
ref|XP_010100630.1|  High mobility group B protein 1                  79.0    9e-15   Morus notabilis
ref|XP_009103331.1|  PREDICTED: high mobility group B protein 3-like  79.0    9e-15   Brassica rapa
ref|XP_007133904.1|  hypothetical protein PHAVU_010G001800g           79.3    9e-15   Phaseolus vulgaris [French bean]
gb|KDO69008.1|  hypothetical protein CISIN_1g029982mg                 78.6    9e-15   Citrus sinensis [apfelsine]
emb|CDY01357.1|  BnaA07g11300D                                        79.0    9e-15   
gb|KDO69009.1|  hypothetical protein CISIN_1g029982mg                 78.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006366341.1|  PREDICTED: high mobility group B protein 1-l...  79.3    1e-14   Solanum tuberosum [potatoes]
tpg|DAA62631.1|  TPA: hypothetical protein ZEAMMB73_230922            78.2    1e-14   
gb|AGV54591.1|  high mobility group B protein 1                       79.3    1e-14   Phaseolus vulgaris [French bean]
ref|XP_004492431.1|  PREDICTED: high mobility group B protein 1-l...  79.3    1e-14   Cicer arietinum [garbanzo]
gb|EPS64999.1|  hypothetical protein M569_09780                       79.0    1e-14   Genlisea aurea
gb|AAM93217.1|AF527616_1  nucleasome/chromatin assembly factor D ...  77.8    1e-14   Zea mays [maize]
tpg|DAA62628.1|  TPA: hypothetical protein ZEAMMB73_230922            77.8    1e-14   
tpg|DAA62629.1|  TPA: hypothetical protein ZEAMMB73_230922            77.8    1e-14   
ref|XP_003623293.1|  HMG1/2-like protein                              79.0    1e-14   Medicago truncatula
ref|XP_002980703.1|  hypothetical protein SELMODRAFT_38818            76.6    1e-14   
ref|NP_001275787.1|  group B HMG-box protein                          78.6    2e-14   Citrus sinensis [apfelsine]
ref|XP_009588564.1|  PREDICTED: high mobility group B protein 1       78.6    2e-14   Nicotiana tomentosiformis
gb|AFK49192.1|  unknown                                               78.6    2e-14   Lotus japonicus
gb|KCW88102.1|  hypothetical protein EUGRSUZ_A00506                   79.0    2e-14   Eucalyptus grandis [rose gum]
ref|XP_011074084.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-14   Sesamum indicum [beniseed]
gb|AAC50019.1|  high mobility group protein 2 HMG2                    77.8    2e-14   Ipomoea nil [qian niu]
ref|NP_001105649.1|  HMG-like nucleosome/chromatin assembly factor D  77.4    2e-14   
ref|XP_011100443.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-14   Sesamum indicum [beniseed]
ref|XP_009397968.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009773209.1|  PREDICTED: high mobility group B protein 1       78.6    2e-14   Nicotiana sylvestris
ref|XP_010923050.1|  PREDICTED: high mobility group B protein 1-like  78.2    2e-14   
ref|XP_008651871.1|  PREDICTED: HMG-like nucleosome/chromatin ass...  78.2    3e-14   
tpg|DAA40705.1|  TPA: hypothetical protein ZEAMMB73_374315            76.6    3e-14   
gb|KDO69006.1|  hypothetical protein CISIN_1g029982mg                 78.2    3e-14   Citrus sinensis [apfelsine]
ref|XP_010063137.1|  PREDICTED: high mobility group B protein 3-like  77.0    3e-14   Eucalyptus grandis [rose gum]
gb|ACR37707.1|  unknown                                               76.6    3e-14   Zea mays [maize]
ref|XP_010908531.1|  PREDICTED: high mobility group B protein 1-l...  77.4    4e-14   Elaeis guineensis
gb|EYU36574.1|  hypothetical protein MIMGU_mgv1a015928mg              77.0    4e-14   Erythranthe guttata [common monkey flower]
gb|EYU36572.1|  hypothetical protein MIMGU_mgv1a015928mg              77.0    4e-14   Erythranthe guttata [common monkey flower]
gb|KDO71476.1|  hypothetical protein CISIN_1g031973mg                 77.0    4e-14   Citrus sinensis [apfelsine]
gb|KDO69011.1|  hypothetical protein CISIN_1g029982mg                 76.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_006572804.1|  PREDICTED: uncharacterized protein LOC100305...  77.4    5e-14   Glycine max [soybeans]
tpg|DAA40704.1|  TPA: hypothetical protein ZEAMMB73_374315            76.6    5e-14   
ref|XP_008668095.1|  PREDICTED: LOC100284781 isoform X2               77.0    5e-14   Zea mays [maize]
gb|KDO69010.1|  hypothetical protein CISIN_1g029982mg                 75.9    5e-14   Citrus sinensis [apfelsine]
ref|XP_002976963.1|  hypothetical protein SELMODRAFT_175895           77.0    6e-14   Selaginella moellendorffii
ref|XP_009382744.1|  PREDICTED: DNA-binding protein MNB1B             76.6    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008668094.1|  PREDICTED: LOC100284781 isoform X1               77.0    6e-14   Zea mays [maize]
ref|XP_010109616.1|  hypothetical protein L484_015571                 77.0    6e-14   Morus notabilis
ref|XP_007026722.1|  High mobility group B1 isoform 2                 77.0    6e-14   
ref|XP_007026721.1|  High mobility group B1, putative isoform 1       77.0    6e-14   Theobroma cacao [chocolate]
ref|XP_007026725.1|  High mobility group B1 isoform 5                 77.0    6e-14   Theobroma cacao [chocolate]
ref|XP_002528104.1|  DNA-binding protein MNB1B, putative              77.0    6e-14   Ricinus communis
ref|XP_007026723.1|  High mobility group B1 isoform 3                 77.0    6e-14   
gb|KDO71478.1|  hypothetical protein CISIN_1g031973mg                 76.6    7e-14   Citrus sinensis [apfelsine]
gb|KDO71479.1|  hypothetical protein CISIN_1g031973mg                 76.3    7e-14   Citrus sinensis [apfelsine]
gb|KCW70329.1|  hypothetical protein EUGRSUZ_F03571                   75.9    7e-14   Eucalyptus grandis [rose gum]
ref|XP_006855734.1|  hypothetical protein AMTR_s00044p00160130        76.3    9e-14   Amborella trichopoda
ref|XP_009418293.1|  PREDICTED: HMG1/2-like protein                   76.3    9e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009803525.1|  PREDICTED: HMG1/2-like protein                   75.9    9e-14   Nicotiana sylvestris
gb|KHN38836.1|  HMG1/2-like protein                                   75.9    9e-14   Glycine soja [wild soybean]
ref|XP_010940219.1|  PREDICTED: DNA-binding protein MNB1B-like        76.3    1e-13   Elaeis guineensis
ref|NP_001235312.1|  uncharacterized protein LOC100499992             75.9    1e-13   Glycine max [soybeans]
emb|CDY31871.1|  BnaC07g15210D                                        76.3    1e-13   Brassica napus [oilseed rape]
ref|XP_006848200.1|  hypothetical protein AMTR_s00029p00240750        76.3    1e-13   Amborella trichopoda
ref|XP_008812347.1|  PREDICTED: DNA-binding protein MNB1B-like        75.9    1e-13   Phoenix dactylifera
gb|KDP24460.1|  hypothetical protein JCGZ_25024                       76.3    1e-13   Jatropha curcas
gb|KGN54377.1|  hypothetical protein Csa_4G309150                     76.3    1e-13   Cucumis sativus [cucumbers]
gb|AFK36965.1|  unknown                                               76.3    1e-13   Medicago truncatula
ref|XP_004148621.1|  PREDICTED: high mobility group B protein 1-like  76.3    1e-13   
ref|NP_001031075.1|  high mobility group B3 protein                   75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EMS67848.1|  HMG1/2-like protein                                   76.6    1e-13   Triticum urartu
ref|XP_004512268.1|  PREDICTED: HMG1/2-like protein-like              75.5    1e-13   Cicer arietinum [garbanzo]
ref|NP_001031074.1|  high mobility group B2 protein                   75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69148.1|  hypothetical protein M569_05619                       75.9    1e-13   Genlisea aurea
emb|CDP01791.1|  unnamed protein product                              75.9    1e-13   Coffea canephora [robusta coffee]
gb|ABK21026.1|  unknown                                               75.9    1e-13   Picea sitchensis
ref|XP_008449957.1|  PREDICTED: high mobility group B protein 1       76.3    1e-13   Cucumis melo [Oriental melon]
ref|XP_011096978.1|  PREDICTED: HMG1/2-like protein                   75.9    1e-13   Sesamum indicum [beniseed]
ref|XP_010498507.1|  PREDICTED: high mobility group B protein 2       75.5    1e-13   Camelina sativa [gold-of-pleasure]
ref|NP_001077569.1|  high mobility group B2 protein                   75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564123.1|  high mobility group B2 protein                      75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781302.1|  PREDICTED: HMG1/2-like protein                   75.9    1e-13   Phoenix dactylifera
ref|NP_564124.1|  high mobility group B3 protein                      75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001267705.1|  HMG1/2-like protein-like                         75.5    1e-13   Cucumis sativus [cucumbers]
ref|NP_001077570.1|  high mobility group B3 protein                   75.5    1e-13   
ref|XP_007205402.1|  hypothetical protein PRUPE_ppa007518mg           78.6    1e-13   
ref|NP_001151148.1|  LOC100284781                                     75.1    1e-13   Zea mays [maize]
ref|XP_010935409.1|  PREDICTED: DNA-binding protein MNB1B-like        75.1    2e-13   
ref|XP_006304292.1|  hypothetical protein CARUB_v10010586mg           75.1    2e-13   Capsella rubella
gb|ADO34793.1|  high mobility group box 2 protein                     75.1    2e-13   Gossypium hirsutum [American cotton]
gb|KJB29491.1|  hypothetical protein B456_005G114500                  75.1    2e-13   Gossypium raimondii
ref|XP_009804084.1|  PREDICTED: HMG1/2-like protein                   75.1    2e-13   Nicotiana sylvestris
sp|P40619.1|HMGL_IPONI  RecName: Full=HMG1/2-like protein             75.1    2e-13   Ipomoea nil [qian niu]
ref|XP_002316220.1|  hypothetical protein POPTR_0010s19720g           75.5    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007009011.1|  High mobility group B1 isoform 2                 75.5    2e-13   Theobroma cacao [chocolate]
ref|XP_006303878.1|  hypothetical protein CARUB_v10012681mg           74.7    2e-13   Capsella rubella
ref|XP_010477319.1|  PREDICTED: high mobility group B protein 3-like  74.7    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002270185.1|  PREDICTED: high mobility group B protein 1 i...  75.1    2e-13   Vitis vinifera
ref|XP_010253860.1|  PREDICTED: high mobility group B protein 1-l...  75.5    2e-13   Nelumbo nucifera [Indian lotus]
dbj|BAJ33881.1|  unnamed protein product                              74.7    2e-13   Eutrema halophilum
ref|XP_004500864.1|  PREDICTED: HMG1/2-like protein-like isoform X4   75.1    2e-13   Cicer arietinum [garbanzo]
ref|NP_001235556.1|  uncharacterized protein LOC100305961             75.1    2e-13   Glycine max [soybeans]
ref|XP_002890402.1|  hypothetical protein ARALYDRAFT_472304           74.7    3e-13   
ref|NP_001063869.1|  Os09g0551600                                     74.3    3e-13   
ref|XP_004500862.1|  PREDICTED: HMG1/2-like protein-like isoform X2   75.1    3e-13   
ref|XP_002269398.1|  PREDICTED: high mobility group B protein 1 i...  75.1    3e-13   Vitis vinifera
gb|ABV48883.1|  high mobility group protein B1                        75.9    3e-13   Physcomitrella patens
ref|XP_008779789.1|  PREDICTED: high mobility group B protein 1-like  73.9    3e-13   Phoenix dactylifera
ref|XP_009759477.1|  PREDICTED: HMG1/2-like protein                   74.3    3e-13   Nicotiana sylvestris
emb|CDY33643.1|  BnaC08g19430D                                        74.7    3e-13   Brassica napus [oilseed rape]
ref|XP_011035966.1|  PREDICTED: high mobility group B protein 1       75.1    3e-13   Populus euphratica
ref|XP_002279947.2|  PREDICTED: high mobility group B protein 1 i...  75.1    3e-13   Vitis vinifera
ref|XP_010654160.1|  PREDICTED: high mobility group B protein 1 i...  75.1    3e-13   Vitis vinifera
gb|ADO34794.1|  high mobility group box 4 protein                     74.7    3e-13   Gossypium hirsutum [American cotton]
ref|XP_004953412.1|  PREDICTED: HMG1/2-like protein-like              74.3    3e-13   Setaria italica
ref|XP_004500863.1|  PREDICTED: HMG1/2-like protein-like isoform X3   74.7    3e-13   
ref|XP_009589000.1|  PREDICTED: HMG1/2-like protein                   74.3    3e-13   Nicotiana tomentosiformis
gb|KHN38869.1|  HMG1/2-like protein                                   74.3    3e-13   Glycine soja [wild soybean]
gb|KJB29495.1|  hypothetical protein B456_005G114500                  75.5    3e-13   Gossypium raimondii
ref|XP_004500861.1|  PREDICTED: HMG1/2-like protein-like isoform X1   74.7    3e-13   
gb|KJB36899.1|  hypothetical protein B456_006G181900                  74.3    3e-13   Gossypium raimondii
gb|KJB12028.1|  hypothetical protein B456_002G263800                  74.7    4e-13   Gossypium raimondii
gb|KJB29494.1|  hypothetical protein B456_005G114500                  75.5    4e-13   Gossypium raimondii
ref|XP_003578598.1|  PREDICTED: HMG1/2-like protein                   73.9    4e-13   Brachypodium distachyon [annual false brome]
gb|AEX55234.1|  HMG transcription factor                              73.6    4e-13   Allium sativum
ref|XP_004234511.1|  PREDICTED: HMG1/2-like protein                   73.9    4e-13   Solanum lycopersicum
ref|XP_010550497.1|  PREDICTED: high mobility group B protein 4-like  74.3    4e-13   Tarenaya hassleriana [spider flower]
gb|EMT15409.1|  HMG1/2-like protein                                   73.9    4e-13   
ref|XP_006343329.1|  PREDICTED: HMG1/2-like protein-like              73.9    4e-13   Solanum tuberosum [potatoes]
gb|KJB36900.1|  hypothetical protein B456_006G181900                  74.3    4e-13   Gossypium raimondii
ref|XP_004957577.1|  PREDICTED: HMG1/2-like protein-like              73.6    4e-13   Setaria italica
gb|KJB29493.1|  hypothetical protein B456_005G114500                  75.1    4e-13   Gossypium raimondii
ref|XP_006364026.1|  PREDICTED: HMG1/2-like protein-like              73.2    4e-13   Solanum tuberosum [potatoes]
emb|CDY65900.1|  BnaCnng49050D                                        73.9    4e-13   Brassica napus [oilseed rape]
ref|XP_009590625.1|  PREDICTED: HMG1/2-like protein                   73.9    4e-13   Nicotiana tomentosiformis
ref|XP_006416372.1|  hypothetical protein EUTSA_v10009371mg           75.1    5e-13   
gb|KHG02391.1|  High mobility group B 1 -like protein                 73.9    5e-13   Gossypium arboreum [tree cotton]
ref|XP_009110216.1|  PREDICTED: high mobility group B protein 2       73.9    6e-13   Brassica rapa
ref|XP_010253859.1|  PREDICTED: high mobility group B protein 1-l...  74.7    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010477318.1|  PREDICTED: high mobility group B protein 2-like  73.6    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006660948.1|  PREDICTED: HMG1/2-like protein-like              73.2    6e-13   Oryza brachyantha
gb|KJB10396.1|  hypothetical protein B456_001G198900                  72.4    7e-13   Gossypium raimondii
ref|XP_007156239.1|  hypothetical protein PHAVU_003G270000g           73.6    7e-13   Phaseolus vulgaris [French bean]
emb|CDX96626.1|  BnaA08g21690D                                        73.6    7e-13   
ref|XP_009597873.1|  PREDICTED: HMG1/2-like protein                   73.2    7e-13   Nicotiana tomentosiformis
ref|XP_008776662.1|  PREDICTED: high mobility group B protein 1       73.9    7e-13   Phoenix dactylifera
ref|XP_009794035.1|  PREDICTED: HMG1/2-like protein                   73.2    8e-13   Nicotiana sylvestris
ref|XP_004512267.1|  PREDICTED: HMG1/2-like protein-like              74.3    8e-13   Cicer arietinum [garbanzo]
ref|XP_001766891.1|  predicted protein                                73.6    8e-13   
ref|XP_010271821.1|  PREDICTED: HMG1/2-like protein                   73.6    8e-13   Nelumbo nucifera [Indian lotus]
ref|XP_002979815.1|  hypothetical protein SELMODRAFT_18312            71.6    8e-13   
ref|XP_008452974.1|  PREDICTED: HMG1/2-like protein isoform X2        73.2    9e-13   
ref|XP_008452973.1|  PREDICTED: HMG1/2-like protein isoform X1        73.2    9e-13   Cucumis melo [Oriental melon]
ref|XP_001768855.1|  predicted protein                                72.4    9e-13   
gb|KJB57948.1|  hypothetical protein B456_009G186800                  73.2    9e-13   Gossypium raimondii
ref|XP_009149548.1|  PREDICTED: high mobility group B protein 3-like  73.2    9e-13   Brassica rapa
ref|XP_004145545.1|  PREDICTED: HMG1/2-like protein-like              73.2    9e-13   Cucumis sativus [cucumbers]
ref|XP_004287727.1|  PREDICTED: HMG1/2-like protein                   73.2    9e-13   Fragaria vesca subsp. vesca
emb|CDY29512.1|  BnaA06g14580D                                        72.8    1e-12   Brassica napus [oilseed rape]
gb|ABV48884.1|  high mobility group protein B2                        73.6    1e-12   Physcomitrella patens
ref|XP_004167972.1|  PREDICTED: high mobility group B protein 1-like  72.4    1e-12   
ref|XP_010267869.1|  PREDICTED: high mobility group B protein 3-like  73.2    1e-12   Nelumbo nucifera [Indian lotus]
gb|KHG26324.1|  High mobility group B 3 -like protein                 73.2    1e-12   Gossypium arboreum [tree cotton]
gb|AET87126.1|  high mobility group B2 protein                        72.8    1e-12   Brassica napus [oilseed rape]
ref|XP_010266190.1|  PREDICTED: HMG1/2-like protein                   73.2    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010069611.1|  PREDICTED: high mobility group B protein 3-like  72.8    1e-12   Eucalyptus grandis [rose gum]
ref|XP_007202726.1|  hypothetical protein PRUPE_ppa012972mg           72.4    1e-12   
ref|XP_007202727.1|  hypothetical protein PRUPE_ppa012972mg           72.8    1e-12   
gb|KJB57949.1|  hypothetical protein B456_009G186800                  73.6    1e-12   
gb|AIX10954.1|  high mobility group B protein                         72.8    1e-12   
ref|XP_009115889.1|  PREDICTED: high mobility group B protein 1-like  73.2    1e-12   
ref|XP_008241942.1|  PREDICTED: HMG1/2-like protein isoform X2        72.4    1e-12   
ref|XP_001777538.1|  predicted protein                                75.1    1e-12   
emb|CDP06494.1|  unnamed protein product                              73.2    1e-12   
gb|EMS48945.1|  High mobility group B protein 4                       72.4    1e-12   
ref|XP_007202584.1|  hypothetical protein PRUPE_ppa011596mg           72.0    1e-12   
emb|CDX78045.1|  BnaA09g32400D                                        73.2    2e-12   
gb|ABK25570.1|  unknown                                               72.8    2e-12   
ref|XP_009359590.1|  PREDICTED: high mobility group B protein 3-like  72.4    2e-12   
ref|XP_008361330.1|  PREDICTED: high mobility group B protein 3-like  72.4    2e-12   
ref|XP_004966522.1|  PREDICTED: DNA-binding protein MNB1B-like        72.8    2e-12   
ref|XP_002960644.1|  hypothetical protein SELMODRAFT_75453            72.0    2e-12   
ref|XP_011044288.1|  PREDICTED: high mobility group B protein 1-like  72.8    2e-12   
gb|EPS70747.1|  high mobility group family                            72.4    2e-12   
gb|ABV48885.1|  high mobility group protein B3                        72.4    2e-12   
ref|XP_002983394.1|  hypothetical protein SELMODRAFT_117986           71.6    2e-12   
dbj|BAA19156.1|  HMG-1                                                72.0    2e-12   
ref|XP_010557429.1|  PREDICTED: high mobility group B protein 4-like  72.0    2e-12   
emb|CDX80362.1|  BnaC07g30820D                                        72.4    2e-12   
ref|XP_006379628.1|  hypothetical protein POPTR_0008s06730g           72.8    2e-12   
gb|KJB78781.1|  hypothetical protein B456_013G018500                  72.0    2e-12   
gb|KHN33794.1|  HMG1/2-like protein                                   72.4    2e-12   
ref|NP_001235499.1|  uncharacterized protein LOC100305957             72.0    2e-12   
gb|KDO78132.1|  hypothetical protein CISIN_1g031573mg                 72.4    2e-12   
gb|AAM64404.1|  putative HMG protein                                  72.0    2e-12   
gb|ACG31440.1|  HMG1/2-like protein                                   72.0    2e-12   
emb|CAA74403.1|  HMG protein                                          72.0    2e-12   
emb|CBI25494.3|  unnamed protein product                              71.6    2e-12   
ref|NP_001058640.1|  Os06g0728000                                     72.0    2e-12   
ref|XP_006449662.1|  hypothetical protein CICLE_v10017037mg           71.6    2e-12   
ref|NP_001105483.1|  high mobility group protein3                     71.6    2e-12   
ref|XP_008677792.1|  PREDICTED: high mobility group protein3 isof...  71.6    2e-12   
ref|WP_039311789.1|  hypothetical protein                             70.9    3e-12   
gb|ABK22074.1|  unknown                                               72.0    3e-12   
gb|KJB78775.1|  hypothetical protein B456_013G018500                  72.0    3e-12   
gb|KJB57950.1|  hypothetical protein B456_009G186800                  72.8    3e-12   
gb|EEE70180.1|  hypothetical protein OsJ_30257                        71.6    3e-12   
ref|XP_006467496.1|  PREDICTED: high mobility group B protein 14-...  72.0    3e-12   
ref|XP_006449663.1|  hypothetical protein CICLE_v10017037mg           72.0    3e-12   
gb|EAZ10007.1|  hypothetical protein OsI_32309                        71.6    3e-12   
ref|XP_009617423.1|  PREDICTED: high mobility group B protein 3-like  72.4    3e-12   
gb|EAZ24139.1|  hypothetical protein OsJ_07880                        72.4    3e-12   
ref|XP_004151887.1|  PREDICTED: HMG1/2-like protein-like              71.6    3e-12   
gb|KJB68907.1|  hypothetical protein B456_011G042300                  72.0    3e-12   
gb|AFK36830.1|  unknown                                               72.0    3e-12   
ref|XP_010489389.1|  PREDICTED: high mobility group B protein 4-like  71.2    3e-12   
ref|XP_010649448.1|  PREDICTED: HMG1/2-like protein isoform X3        71.2    3e-12   
gb|KDO47713.1|  hypothetical protein CISIN_1g030283mg                 71.6    3e-12   
gb|KJB68904.1|  hypothetical protein B456_011G042300                  72.0    3e-12   
ref|NP_001281240.1|  HMG-like nucleosome/chromatin assembly facto...  71.6    3e-12   
gb|AFK36584.1|  unknown                                               71.6    3e-12   
ref|XP_002306429.1|  hypothetical protein POPTR_0005s10440g           71.6    3e-12   
ref|NP_001047695.1|  Os02g0670400                                     71.6    3e-12   
dbj|BAJ33706.1|  unnamed protein product                              71.6    3e-12   
gb|AAL69379.1|AF462216_1  HMG-domain containing protein               70.5    3e-12   
gb|EYU43543.1|  hypothetical protein MIMGU_mgv1a016060mg              71.2    4e-12   
ref|XP_002280084.2|  PREDICTED: HMG1/2-like protein isoform X1        71.6    4e-12   
ref|XP_010548222.1|  PREDICTED: high mobility group B protein 4-like  71.2    4e-12   
ref|XP_008363065.1|  PREDICTED: high mobility group B protein 3-like  71.2    4e-12   
gb|ACF74312.1|  high mobility group protein 1                         71.2    4e-12   
ref|XP_006298713.1|  hypothetical protein CARUB_v10014808mg           71.6    4e-12   
gb|ACN31083.1|  unknown                                               72.4    4e-12   
ref|XP_010528851.1|  PREDICTED: high mobility group B protein 1       72.0    4e-12   
ref|XP_009369803.1|  PREDICTED: high mobility group B protein 3-like  71.2    4e-12   
ref|XP_002526902.1|  DNA-binding protein MNB1B, putative              72.0    4e-12   
ref|XP_010649447.1|  PREDICTED: HMG1/2-like protein isoform X2        71.6    4e-12   
ref|XP_001780376.1|  predicted protein                                72.4    4e-12   
ref|WP_041515133.1|  hypothetical protein                             70.1    4e-12   
ref|XP_009789088.1|  PREDICTED: high mobility group B protein 14      71.6    5e-12   
gb|KJB68906.1|  hypothetical protein B456_011G042300                  70.9    5e-12   
ref|XP_009400325.1|  PREDICTED: DNA-binding protein MNB1B-like        71.2    5e-12   
gb|EEC81344.1|  hypothetical protein OsI_24530                        71.2    5e-12   
ref|XP_003612362.1|  HMG1/2-like protein                              70.9    5e-12   
gb|EYU33343.1|  hypothetical protein MIMGU_mgv1a015700mg              71.2    5e-12   
ref|NP_001167650.1|  high mobility group protein1                     71.2    5e-12   
gb|ADM47612.1|  high mobility group protein                           70.9    5e-12   
gb|KDO47712.1|  hypothetical protein CISIN_1g030283mg                 71.6    5e-12   
ref|XP_010103256.1|  HMG1/2-like protein                              70.9    5e-12   
ref|NP_001077909.1|  high mobility group B4 protein                   70.9    5e-12   
emb|CAA46876.1|  DNA-binding protein                                  71.2    5e-12   
ref|XP_006429363.1|  hypothetical protein CICLE_v10012868mg           71.6    6e-12   
ref|XP_006409283.1|  hypothetical protein EUTSA_v10022905mg           70.5    6e-12   
ref|XP_006481020.1|  PREDICTED: high mobility group B protein 1-l...  71.6    6e-12   
gb|AAK43965.1|AF370150_1  putative HMG protein                        70.5    6e-12   
ref|XP_009608356.1|  PREDICTED: high mobility group B protein 14      71.2    6e-12   
ref|XP_006656519.1|  PREDICTED: DNA-binding protein MNB1B-like        70.9    6e-12   
ref|XP_003531090.1|  PREDICTED: high mobility group B protein 14-...  70.9    6e-12   
ref|XP_008241940.1|  PREDICTED: HMG1/2-like protein                   70.9    6e-12   
ref|NP_179347.1|  high mobility group B4 protein                      70.5    6e-12   
gb|KHN25889.1|  High mobility group B protein 14                      70.9    7e-12   
emb|CAB37859.1|  unnamed protein product                              68.9    7e-12   
gb|AAF80615.1|AC069251_8  F2D10.18                                    74.7    7e-12   
emb|CDX69149.1|  BnaC01g03040D                                        70.5    7e-12   
ref|XP_007202585.1|  hypothetical protein PRUPE_ppa011596mg           70.5    7e-12   
ref|XP_002275908.1|  PREDICTED: high mobility group B protein 14      71.2    7e-12   
ref|XP_009151805.1|  PREDICTED: high mobility group B protein 4-like  70.5    7e-12   
ref|XP_008455870.1|  PREDICTED: high mobility group B protein 1-l...  70.5    8e-12   
ref|XP_007009012.1|  High mobility group B1 isoform 3                 70.9    8e-12   
ref|XP_006403872.1|  hypothetical protein EUTSA_v10010751mg           71.2    8e-12   
ref|XP_007009010.1|  High mobility group B1 isoform 1                 71.2    8e-12   
gb|AFK38905.1|  unknown                                               70.5    8e-12   
ref|XP_002272299.1|  PREDICTED: HMG1/2-like protein                   70.5    8e-12   
ref|XP_010467531.1|  PREDICTED: high mobility group B protein 4       70.1    9e-12   
ref|XP_004300537.1|  PREDICTED: HMG1/2-like protein                   70.1    9e-12   
ref|NP_001043799.2|  Os01g0666200                                     70.1    9e-12   
ref|XP_007025116.1|  HMG-box DNA-binding family protein isoform 1     70.5    9e-12   
ref|XP_010924366.1|  PREDICTED: high mobility group B protein 1 i...  70.9    1e-11   
ref|XP_008352408.1|  PREDICTED: high mobility group B protein 3-like  69.7    1e-11   
ref|XP_006469766.1|  PREDICTED: high mobility group B protein 3-like  70.1    1e-11   
gb|EAY75292.1|  hypothetical protein OsI_03182                        69.7    1e-11   
ref|NP_001236841.1|  HMG1/2-like protein                              70.1    1e-11   
ref|NP_001105075.1|  high mobility group box protein2                 69.7    1e-11   
gb|KJB14229.1|  hypothetical protein B456_002G115100                  70.1    1e-11   
gb|KJB14225.1|  hypothetical protein B456_002G115100                  69.7    1e-11   
ref|XP_010924372.1|  PREDICTED: high mobility group B protein 14 ...  69.7    1e-11   
ref|XP_002524182.1|  DNA-binding protein MNB1B, putative              70.1    1e-11   
ref|XP_002301918.1|  HMG 1 family protein                             70.1    1e-11   
ref|XP_006412087.1|  hypothetical protein EUTSA_v10026524mg           69.7    1e-11   
gb|KJB14227.1|  hypothetical protein B456_002G115100                  69.7    1e-11   
ref|NP_001237839.1|  uncharacterized protein LOC100305607             70.1    1e-11   
ref|XP_008337915.1|  PREDICTED: HMG1/2-like protein                   69.7    1e-11   
gb|ABK94286.1|  unknown                                               69.7    1e-11   
ref|XP_009359591.1|  PREDICTED: high mobility group B protein 3       69.7    1e-11   
ref|XP_007158944.1|  hypothetical protein PHAVU_002G194900g           69.7    1e-11   
gb|KJB14223.1|  hypothetical protein B456_002G115100                  69.7    1e-11   
gb|KDO54648.1|  hypothetical protein CISIN_1g044275mg                 70.1    1e-11   
ref|XP_011096536.1|  PREDICTED: high mobility group B protein 14 ...  69.7    1e-11   
gb|AFK40425.1|  unknown                                               69.7    1e-11   
ref|XP_004293597.1|  PREDICTED: high mobility group B protein 14      70.1    1e-11   
ref|XP_009150873.1|  PREDICTED: high mobility group B protein 7-like  70.1    1e-11   
gb|KDP36780.1|  hypothetical protein JCGZ_08071                       69.7    1e-11   
ref|XP_004504694.1|  PREDICTED: high mobility group B protein 14-...  68.9    1e-11   
ref|XP_003612363.1|  HMG1/2-like protein                              68.6    2e-11   
ref|XP_006581068.1|  PREDICTED: HMG-1 like protein gene isoform X1    69.7    2e-11   
ref|XP_006648924.1|  PREDICTED: HMG1/2-like protein-like              69.7    2e-11   
gb|EYU43542.1|  hypothetical protein MIMGU_mgv1a016084mg              69.3    2e-11   
ref|XP_003570053.1|  PREDICTED: HMG1/2-like protein                   69.3    2e-11   
sp|P40620.1|HMGL_VICFA  RecName: Full=HMG1/2-like protein             69.7    2e-11   
gb|KDO85125.1|  hypothetical protein CISIN_1g031906mg                 68.9    2e-11   
ref|XP_010239496.1|  PREDICTED: DNA-binding protein MNB1B             69.7    2e-11   
ref|XP_006416373.1|  hypothetical protein EUTSA_v10009970mg           71.2    2e-11   
ref|XP_010539785.1|  PREDICTED: high mobility group B protein 2-like  69.3    2e-11   
ref|XP_006386135.1|  hypothetical protein POPTR_0002s01000g           69.3    2e-11   
ref|XP_002886121.1|  hypothetical protein ARALYDRAFT_480649           69.3    2e-11   
gb|ADO34795.1|  high mobility group box 1 protein                     69.3    2e-11   
ref|XP_010052074.1|  PREDICTED: high mobility group B protein 14      69.7    2e-11   
ref|XP_008439650.1|  PREDICTED: high mobility group B protein 14      69.7    2e-11   
ref|XP_004504692.1|  PREDICTED: high mobility group B protein 14-...  69.3    2e-11   
gb|KDO85122.1|  hypothetical protein CISIN_1g031906mg                 69.3    2e-11   
ref|XP_010530997.1|  PREDICTED: high mobility group B protein 4-like  68.9    2e-11   
gb|AFK35597.1|  unknown                                               69.7    2e-11   
ref|XP_006644483.1|  PREDICTED: high mobility group B protein 14-...  68.9    2e-11   
ref|XP_011034865.1|  PREDICTED: high mobility group B protein 3-like  69.3    2e-11   
gb|ABK95882.1|  unknown                                               69.3    2e-11   
gb|AFW69593.1|  high mobility group protein1                          70.5    2e-11   
ref|XP_007202588.1|  hypothetical protein PRUPE_ppa011596mg           69.7    2e-11   
ref|XP_011022174.1|  PREDICTED: HMG1/2-like protein                   68.9    2e-11   
ref|XP_010247088.1|  PREDICTED: HMG1/2-like protein                   69.3    2e-11   
ref|XP_007202589.1|  hypothetical protein PRUPE_ppa011596mg           70.1    3e-11   
ref|XP_006435380.1|  hypothetical protein CICLE_v10002782mg           68.6    3e-11   
ref|XP_007202587.1|  hypothetical protein PRUPE_ppa011596mg           69.7    3e-11   
ref|XP_009395697.1|  PREDICTED: high mobility group B protein 14-...  68.6    3e-11   
dbj|BAB85204.1|  high mobility group box protein 2                    68.9    3e-11   
ref|XP_004134634.1|  PREDICTED: high mobility group B protein 14-...  69.3    3e-11   
emb|CDP06349.1|  unnamed protein product                              68.9    3e-11   
gb|KJB78778.1|  hypothetical protein B456_013G018500                  68.2    3e-11   
gb|KDO47714.1|  hypothetical protein CISIN_1g030283mg                 67.8    3e-11   
ref|XP_007136029.1|  hypothetical protein PHAVU_009G012000g           68.6    3e-11   
ref|XP_006435381.1|  hypothetical protein CICLE_v10002782mg           68.9    3e-11   
ref|XP_010275019.1|  PREDICTED: high mobility group B protein 14      68.9    3e-11   
ref|NP_001190062.1|  high mobility group protein B1                   68.9    3e-11   
ref|XP_010503896.1|  PREDICTED: high mobility group B protein 1-l...  69.7    3e-11   
ref|XP_009369804.1|  PREDICTED: high mobility group B protein 3-like  68.6    3e-11   
ref|XP_007136027.1|  hypothetical protein PHAVU_009G012000g           68.9    3e-11   
gb|KJB78777.1|  hypothetical protein B456_013G018500                  68.2    3e-11   
ref|XP_010426766.1|  PREDICTED: high mobility group B protein 1       69.3    3e-11   
ref|XP_010503897.1|  PREDICTED: high mobility group B protein 1-l...  69.3    3e-11   
ref|XP_009141382.1|  PREDICTED: high mobility group B protein 14      68.6    3e-11   
ref|XP_006291923.1|  hypothetical protein CARUB_v10018109mg           68.9    4e-11   
ref|XP_011041211.1|  PREDICTED: high mobility group B protein 3-like  68.6    4e-11   
ref|XP_002877829.1|  hypothetical protein ARALYDRAFT_323737           69.3    4e-11   
ref|XP_009767508.1|  PREDICTED: high mobility group B protein 3-like  68.9    4e-11   
ref|NP_190756.1|  high mobility group protein B1                      68.9    4e-11   
ref|NP_974413.1|  high mobility group protein B1                      68.9    4e-11   
ref|XP_010526845.1|  PREDICTED: high mobility group B protein 4-like  68.2    4e-11   
ref|XP_010515624.1|  PREDICTED: high mobility group B protein 1-like  68.9    5e-11   
ref|XP_010534225.1|  PREDICTED: high mobility group B protein 2-like  68.2    5e-11   
ref|XP_007218508.1|  hypothetical protein PRUPE_ppa012424mg           68.6    5e-11   
gb|ABQ53545.1|  HMG1 protein                                          68.2    5e-11   
sp|P40621.1|HMGL_WHEAT  RecName: Full=HMG1/2-like protein             68.6    5e-11   
ref|XP_009396502.1|  PREDICTED: high mobility group B protein 14-...  67.8    5e-11   
ref|XP_006435383.1|  hypothetical protein CICLE_v10002782mg           68.2    5e-11   
gb|ACF74313.1|  high mobility group protein 2                         68.6    5e-11   
emb|CDX88025.1|  BnaA06g26160D                                        68.9    5e-11   
ref|XP_002306980.2|  hypothetical protein POPTR_0005s27390g           68.6    5e-11   
ref|XP_008363066.1|  PREDICTED: high mobility group B protein 3-like  68.2    5e-11   
ref|XP_010504903.1|  PREDICTED: high mobility group B protein 14-...  68.2    5e-11   
ref|XP_010315830.1|  PREDICTED: high mobility group B protein 14 ...  68.2    5e-11   
ref|XP_010514804.1|  PREDICTED: high mobility group B protein 4-like  67.8    6e-11   
gb|EMT12582.1|  HMG1/2-like protein                                   68.2    6e-11   
ref|XP_004231731.1|  PREDICTED: high mobility group B protein 14 ...  67.8    6e-11   
gb|KHG08091.1|  High mobility group B 1 -like protein                 68.2    7e-11   
ref|XP_008373898.1|  PREDICTED: high mobility group B protein 1-l...  68.2    7e-11   
gb|KDO85124.1|  hypothetical protein CISIN_1g031906mg                 67.8    7e-11   
ref|XP_009344794.1|  PREDICTED: high mobility group B protein 1-l...  68.2    7e-11   
ref|XP_009369155.1|  PREDICTED: high mobility group B protein 1-l...  68.2    7e-11   
gb|KDO85123.1|  hypothetical protein CISIN_1g031906mg                 67.8    7e-11   
ref|XP_008369245.1|  PREDICTED: high mobility group B protein 1-like  68.2    8e-11   
ref|XP_006473803.1|  PREDICTED: high mobility group B protein 2-l...  67.8    8e-11   
ref|XP_009369156.1|  PREDICTED: high mobility group B protein 1-l...  67.8    1e-10   
ref|XP_008373908.1|  PREDICTED: high mobility group B protein 1-l...  67.8    1e-10   
ref|XP_009389194.1|  PREDICTED: HMG1/2-like protein                   67.4    1e-10   
emb|CAA54168.1|  HMG 1 protein                                        67.4    1e-10   
ref|XP_009344800.1|  PREDICTED: high mobility group B protein 1-l...  67.4    1e-10   
gb|AFW69595.1|  high mobility group protein1                          66.2    1e-10   
ref|XP_010446908.1|  PREDICTED: high mobility group B protein 5-like  67.0    1e-10   
ref|XP_004509442.1|  PREDICTED: HMG1/2-like protein-like              67.0    1e-10   



>ref|XP_009797250.1| PREDICTED: high mobility group B protein 7-like [Nicotiana sylvestris]
Length=203

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S   ASLKRAKDGSAFARC+ECNKDVP+ALI+FH+CSLDAKIKMNLEAQ++ + A   KK
Sbjct  24   SATAASLKRAKDGSAFARCEECNKDVPIALINFHSCSLDAKIKMNLEAQVV-ENASETKK  82

Query  533  ptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKE  354
            P  K K +STEPKAK+EKKAK+PNAPKRPPTAFFVFM+EFR+TFK  NPD KSV+ VAKE
Sbjct  83   PAAKGKEKSTEPKAKREKKAKNPNAPKRPPTAFFVFMDEFRQTFKAANPDCKSVSMVAKE  142

Query  353  GGEKWKSLTDEEKKLYID  300
            GGEKWKSLTDEEKK Y D
Sbjct  143  GGEKWKSLTDEEKKPYQD  160



>ref|XP_011070479.1| PREDICTED: high mobility group B protein 7-like [Sesamum indicum]
Length=210

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIek-paepkkkpteke  519
            LKRAKDGSAFA+C+ECNKDVPVALISFHNCSLDAKIKMNLEAQI+E      KK   EK+
Sbjct  23   LKRAKDGSAFAKCEECNKDVPVALISFHNCSLDAKIKMNLEAQIVEMPSEAKKKSAPEKK  82

Query  518  kARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKW  339
            K + TEP+ KKEKKAK+PNAPKRPPTAFFVFMEEFRK+FKE NP+ KSVA VAKEGGEKW
Sbjct  83   KTKQTEPRVKKEKKAKNPNAPKRPPTAFFVFMEEFRKSFKEANPECKSVAMVAKEGGEKW  142

Query  338  KSLTDEEKKLYID  300
            KS+TDE+KK+YID
Sbjct  143  KSMTDEDKKVYID  155



>ref|XP_009630975.1| PREDICTED: high mobility group B protein 7-like [Nicotiana tomentosiformis]
Length=223

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S   ASLKRAKDGSAFARC+ECNKDVP+ALI+FH+CSLDAKIKMNLEAQ++ + A   KK
Sbjct  24   SATAASLKRAKDGSAFARCEECNKDVPIALINFHSCSLDAKIKMNLEAQVV-ENASETKK  82

Query  533  ptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKE  354
            P  K K + TEPKAK+EKKAK+PNAPKRPPTAFFVFM+EFR+TFK  NPD KSV+TVAKE
Sbjct  83   PASKSKEKLTEPKAKREKKAKNPNAPKRPPTAFFVFMDEFRQTFKAANPDCKSVSTVAKE  142

Query  353  GGEKWKSLTDEEKKLYID  300
            GGEKWKS+TDEEKK Y D
Sbjct  143  GGEKWKSMTDEEKKPYQD  160



>ref|XP_006360847.1| PREDICTED: high mobility group B protein 7-like [Solanum tuberosum]
Length=215

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKRAKDGSAFARC+EC+KDVP+ALISFHNCSLDAKIKMNLEAQ++ +     KKP  K +
Sbjct  33   LKRAKDGSAFARCEECSKDVPIALISFHNCSLDAKIKMNLEAQVV-ENQTEVKKPAAKSR  91

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
             +STEPKAK+EKK K+PNAPKRPPTAFFVFM++FR+ FK  NPD KSV+TVAKEGGEKWK
Sbjct  92   EKSTEPKAKREKKPKNPNAPKRPPTAFFVFMDDFRQEFKAANPDCKSVSTVAKEGGEKWK  151

Query  335  SLTDEEKKLY  306
            S+TDEEKK Y
Sbjct  152  SMTDEEKKPY  161



>ref|XP_004236870.1| PREDICTED: high mobility group B protein 7 [Solanum lycopersicum]
Length=215

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptek  522
            ASLKRAKDGSAFARC+EC+KDVP+ALISFHNCSLDAKIKMNLEAQ++ +     KKP  K
Sbjct  31   ASLKRAKDGSAFARCEECSKDVPIALISFHNCSLDAKIKMNLEAQVV-ENQTEVKKPAAK  89

Query  521  ekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEK  342
             K +STEPKAK+EKK K+PNAPKRPP+AFFVFM +FR+ FK  NPD KSV+ VAKEGGEK
Sbjct  90   SKEKSTEPKAKREKKPKNPNAPKRPPSAFFVFMNDFRQEFKAANPDCKSVSMVAKEGGEK  149

Query  341  WKSLTDEEKKLY  306
            WKS+TDEEKK Y
Sbjct  150  WKSMTDEEKKPY  161



>ref|XP_011031229.1| PREDICTED: high mobility group B protein 7-like [Populus euphratica]
Length=194

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL RAKDGSAFA+C+EC KDVPVALISFH+CSLDAKIKMNLEAQ++EKP E K+KP E++
Sbjct  22   SLVRAKDGSAFAKCEECKKDVPVALISFHSCSLDAKIKMNLEAQVVEKPTEAKQKPAERK  81

Query  518  kARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
            K  STEPK KK KK K      APKRPPTAFF+FM++FRK +KE NPD K V  VAKEGG
Sbjct  82   KGSSTEPKLKKAKKEKKGRDPNAPKRPPTAFFLFMDDFRKEYKEANPDSKDVKKVAKEGG  141

Query  347  EKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +WKS+TDEEKK Y+D+AAE KAEY+KALES+NA
Sbjct  142  VRWKSMTDEEKKQYVDKAAELKAEYDKALESDNA  175



>ref|XP_002310906.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
 gb|EEE91356.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
Length=201

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL RAKDGSAF +C+EC KDVPVALISFH+CSLDAKIKMNLEAQ++EKP E K+KP E++
Sbjct  22   SLVRAKDGSAFTKCEECKKDVPVALISFHSCSLDAKIKMNLEAQVVEKPTEAKQKPAERK  81

Query  518  kARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
            K  STEPK KK KK K      A KRPPTAFF+FM++FRK +KE NPD K V  VAKEGG
Sbjct  82   KGSSTEPKLKKAKKEKKGRDPNASKRPPTAFFLFMDDFRKEYKEANPDSKDVKKVAKEGG  141

Query  347  EKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +WKS+TDEEKK Y+D+AAE KAE +KALES+NA
Sbjct  142  VRWKSMTDEEKKQYVDKAAELKAENDKALESDNA  175



>gb|ABK93630.1| unknown [Populus trichocarpa]
Length=201

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL RAKDGSAF +C+EC KDVPVALISFH+CSLDAKIKMNLEAQ++EKP E K+KP E++
Sbjct  22   SLVRAKDGSAFTKCEECKKDVPVALISFHSCSLDAKIKMNLEAQVVEKPTEAKQKPAERK  81

Query  518  kARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
            K  STEPK KK KK K      APKRPPTAFF+FM++FRK +KE NPD K V  VAKEGG
Sbjct  82   KGSSTEPKLKKAKKEKKGRDPNAPKRPPTAFFLFMDDFRKEYKEANPDSKDVKKVAKEGG  141

Query  347  EKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +WKS+TDEEKK Y+D+AAE KAE +KALES+NA
Sbjct  142  VRWKSMTDEEKKQYVDKAAELKAENDKALESDNA  175



>ref|XP_010103584.1| High mobility group B protein 7 [Morus notabilis]
 gb|EXB96361.1| High mobility group B protein 7 [Morus notabilis]
Length=209

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptek  522
            ASL R KDGSAFARC+EC+KDVPVALISFH+CSLDAKIKMNLEAQ++EKP+E  K   +K
Sbjct  26   ASLVRGKDGSAFARCEECSKDVPVALISFHSCSLDAKIKMNLEAQVVEKPSETNKPEKKK  85

Query  521  ekARSTE------pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
                STE         KK KK KDPN PKRPPTAFF+FM++FRK FKE NPD K V  VA
Sbjct  86   SS--STEPKLKKSKVEKKGKKGKDPNKPKRPPTAFFLFMDDFRKEFKEANPDSKDVKKVA  143

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KEGGEKW SL+DEEKK+Y D
Sbjct  144  KEGGEKWNSLSDEEKKVYQD  163



>ref|XP_007043200.1| High-mobility group box 6 [Theobroma cacao]
 gb|EOX99031.1| High-mobility group box 6 [Theobroma cacao]
Length=210

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 3/135 (2%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+C+ECNK VPVALIS H+CSLDAKIKMNLEAQ+IEKPAE KKKP E++K
Sbjct  28   LVRAKDGSAFAKCEECNKTVPVALISMHSCSLDAKIKMNLEAQVIEKPAEVKKKPAERKK  87

Query  515  ARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
              STE   KK KK K      APKRPPTAFF+FM++FRK++KE NPD K V  VAKEGGE
Sbjct  88   PASTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRKSYKEANPDAKGVTGVAKEGGE  147

Query  344  KWKSLTDEEKKLYID  300
            KWKS+++EEKK Y+D
Sbjct  148  KWKSMSEEEKKPYVD  162



>ref|XP_004150195.1| PREDICTED: high mobility group B protein 7-like [Cucumis sativus]
 ref|XP_004172659.1| PREDICTED: high mobility group B protein 7-like [Cucumis sativus]
Length=207

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 116/159 (73%), Gaps = 5/159 (3%)
 Frame = -3

Query  707  INASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpt  528
               SL RAKDGSAFARCDEC K VPVALIS H+CSLDAKI+MNLE+Q +EK  + KK   
Sbjct  23   TGPSLVRAKDGSAFARCDECGKSVPVALISMHSCSLDAKIRMNLESQTVEKQTQSKKPAE  82

Query  527  ekekARSTEpkakkekkakdpn-----apKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            +K  A S     K   + K        APKRPPTAFF+FM++FRK++KE NPD K V  V
Sbjct  83   KKRSASSEPKTKKSRTEKKGKKDKDPNAPKRPPTAFFIFMDDFRKSYKEANPDSKGVKEV  142

Query  362  AKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
            AKEGGEKWKS+TDEEKK Y D+AAE KAEYEKALES NA
Sbjct  143  AKEGGEKWKSMTDEEKKPYQDKAAELKAEYEKALESRNA  181



>ref|XP_010248937.1| PREDICTED: high mobility group B protein 7-like [Nelumbo nucifera]
Length=195

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptek  522
            ++LKRAKDGSAF RC+ECNKDVPV LI  H+CSLD+KIKMNL+AQ++E+  E  K   +K
Sbjct  21   STLKRAKDGSAFTRCEECNKDVPVVLIDMHSCSLDSKIKMNLDAQVVERVTEVNKPTEKK  80

Query  521  ekARSTEpkakkekkakdpna---pKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
             KA S+EPK KK KK K       PKRPPTAFFVFMEEFRK +KEE+PD K+V+ V+KE 
Sbjct  81   RKAVSSEPKTKKSKKEKKVKDPNIPKRPPTAFFVFMEEFRKVYKEEHPDNKNVSVVSKEA  140

Query  350  GEKWKSLTDEEKKLYID  300
            GEKWKS++DEEKK Y+D
Sbjct  141  GEKWKSMSDEEKKPYLD  157



>ref|XP_002267697.2| PREDICTED: high mobility group B protein 7 [Vitis vinifera]
 emb|CAN61363.1| hypothetical protein VITISV_034306 [Vitis vinifera]
 emb|CBI35359.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptek  522
            +SLKRA+DGSAF RC+EC KDVPV LI  H+CSL+AKIK+NLEAQ++EK  + KKKP EK
Sbjct  15   SSLKRARDGSAFIRCEECKKDVPVVLIDMHSCSLEAKIKLNLEAQVVEKVTDVKKKPAEK  74

Query  521  ekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
            + A +TEPK KK ++ +       PKRPPTAFF+FM++FRK +KE NPD K+V+ VAKEG
Sbjct  75   KNATTTEPKPKKSRRLRKVKDPNMPKRPPTAFFLFMDDFRKEYKESNPDSKNVSVVAKEG  134

Query  350  GEKWKSLTDEEKKLYID  300
            GEKWKS+TDEEKK Y+D
Sbjct  135  GEKWKSMTDEEKKPYVD  151



>ref|XP_008389062.1| PREDICTED: high mobility group B protein 7-like [Malus domestica]
Length=217

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S +  SL R KDGSAFARC+ECNKDVPVALIS H+CSLDAKIK+NL+AQ++EKP E K+K
Sbjct  28   STVPPSLVRGKDGSAFARCEECNKDVPVALISMHSCSLDAKIKLNLKAQVVEKPPEVKRK  87

Query  533  ptekekARSTEpkakkekkakdpn----apKRPPTAFFVFMEEFRKTFKEENPDIKSVAT  366
                 K  +T     K  K    +    APKRP TAFF+FM++FRK++KE NPD K V  
Sbjct  88   LPADRKRSTTTTSQPKTSKRAKKDKDPNAPKRPLTAFFLFMDDFRKSYKEANPDSKGVKM  147

Query  365  VAKEGGEKWKSLTDEEKKLYID  300
            VAKEGGEKWKS+TDEEKK Y+D
Sbjct  148  VAKEGGEKWKSMTDEEKKPYVD  169



>gb|EYU35548.1| hypothetical protein MIMGU_mgv1a012961mg [Erythranthe guttata]
Length=234

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkk-  537
            S    +LKRA+DGSAFA+C+ECNKDVPVALISFHNCSLDAKIKMNLE+Q++E  +E KK 
Sbjct  25   SATTMALKRARDGSAFAKCEECNKDVPVALISFHNCSLDAKIKMNLESQVVEMASEAKKK  84

Query  536  -kptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
              P +++  ++    +KK KKAKDPNAPKRP TAFF+FME+FRK+FKE NPD K  + VA
Sbjct  85   PAPQKRKANQTQSTSSKKTKKAKDPNAPKRPATAFFIFMEDFRKSFKEANPDNKRGSEVA  144

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KEGGEKWKSLT+EE+++Y D
Sbjct  145  KEGGEKWKSLTEEERQVYRD  164



>ref|XP_007224613.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
 gb|EMJ25812.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
Length=197

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL R KDGSAFARC+ECNK+VPVALIS H+CSLDAKIK++L +Q++E+  E  KK   + 
Sbjct  16   SLVRGKDGSAFARCEECNKNVPVALISMHSCSLDAKIKLHLSSQVVERQPEANKKSPTER  75

Query  518  kARST-EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEK  342
            K  +T EPK+K+ KK KDPNAPKRP TAFF+FM++FRK+FKE NPD K V TVAKEGGEK
Sbjct  76   KRSTTSEPKSKRAKKDKDPNAPKRPLTAFFLFMDDFRKSFKEANPDSKLVKTVAKEGGEK  135

Query  341  WKSLTDEEKKLYID  300
            WKS+TDEEKK Y+D
Sbjct  136  WKSMTDEEKKPYVD  149



>emb|CDP16974.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  704  NASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpte  525
            +++L RAKDGSAF +C ECNKDV VALIS H+CS +AKIKMNLEAQ++EK AE KKKP E
Sbjct  35   SSTLLRAKDGSAFTKCGECNKDVAVALISMHDCSTEAKIKMNLEAQVVEKAAELKKKPAE  94

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
            K KA++ EPKAKK KKAK+PNA KRPPTAFF+FM++FRK+FKE NPD KSV+ VAKEGGE
Sbjct  95   KRKAKAAEPKAKKGKKAKNPNALKRPPTAFFIFMDDFRKSFKEANPDCKSVSVVAKEGGE  154

Query  344  KWKSLTDEEKKLYID  300
            KWKS+T+EEK+ Y+D
Sbjct  155  KWKSMTEEEKQPYVD  169



>ref|XP_006448478.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
 gb|ESR61718.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
Length=224

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae-pkk  537
            S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNLEAQ++EKPAE  KK
Sbjct  22   STSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNLEAQVVEKPAEINKK  81

Query  536  kptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            KP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +KE +PD K V  VA
Sbjct  82   KPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVA  141

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KE GEKWK++TDEEKK Y+D
Sbjct  142  KEAGEKWKNMTDEEKKPYLD  161



>ref|XP_006468697.1| PREDICTED: high mobility group B protein 7-like [Citrus sinensis]
Length=224

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae-pkk  537
            S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNLEAQ++EKPAE  KK
Sbjct  22   STSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNLEAQVVEKPAEINKK  81

Query  536  kptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            KP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +KE +PD K V  VA
Sbjct  82   KPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVA  141

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KE GEKWK++TDEEKK Y+D
Sbjct  142  KEAGEKWKNMTDEEKKPYLD  161



>ref|XP_008221094.1| PREDICTED: high mobility group B protein 7-like [Prunus mume]
Length=206

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL R KDGSAFARC+ECNK+VPVALIS H+CSLDAKIK++L +Q++E+P E  KK   + 
Sbjct  27   SLVRGKDGSAFARCEECNKNVPVALISMHSCSLDAKIKLHLSSQVVERPPEANKKSPTER  86

Query  518  kARST-EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEK  342
            K  +T EPK+KK KK KDPNAPKRP TAFF+FM++FRK+FKE NPD K V TVAKEGGEK
Sbjct  87   KRSTTSEPKSKKAKKDKDPNAPKRPLTAFFLFMDDFRKSFKEANPDSKLVKTVAKEGGEK  146

Query  341  WKSLTDEEKKLYID  300
            WKS+TDEEKK Y+D
Sbjct  147  WKSMTDEEKKPYVD  160



>gb|KDO77000.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77001.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77002.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=232

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae-pkk  537
            S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNLEAQ++EKPAE  KK
Sbjct  22   STSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNLEAQVVEKPAEINKK  81

Query  536  kptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            KP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +KE +PD K V  VA
Sbjct  82   KPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVA  141

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KE GEKWK++TDEEKK Y+D
Sbjct  142  KEAGEKWKNMTDEEKKPYLD  161



>gb|KDO77003.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=220

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae-pkk  537
            S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNLEAQ++EKPAE  KK
Sbjct  22   STSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNLEAQVVEKPAEINKK  81

Query  536  kptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            KP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +KE +PD K V  VA
Sbjct  82   KPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVA  141

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KE GEKWK++TDEEKK Y+D
Sbjct  142  KEAGEKWKNMTDEEKKPYLD  161



>ref|XP_009351762.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Pyrus 
x bretschneideri]
Length=221

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL R KDGSAFARCDECNKDVPVALI+ H+CSLDAKIK+NL+AQ++E+P E KKKP    
Sbjct  36   SLVRVKDGSAFARCDECNKDVPVALITMHSCSLDAKIKLNLKAQVVERPPELKKKPPTDR  95

Query  518  kARSTEpkakkekkakdpn----apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
            K  +T     K  K    +    APKRP TAFF+F+++FRK++KE NPD K V TV +EG
Sbjct  96   KRSTTATSHPKMSKRAKKDKDPNAPKRPLTAFFLFLDDFRKSYKEANPDSKGVKTVTREG  155

Query  350  GEKWKSLTDEEKKLYID  300
            GEKWKS+TDEEKK Y+D
Sbjct  156  GEKWKSMTDEEKKPYVD  172



>ref|XP_009351760.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009351761.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
Length=223

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae-pkkkptek  522
            SL R KDGSAFARCDECNKDVPVALI+ H+CSLDAKIK+NL+AQ++E+P E  KK PTE 
Sbjct  36   SLVRVKDGSAFARCDECNKDVPVALITMHSCSLDAKIKLNLKAQVVERPPELKKKPPTET  95

Query  521  ekARSTEpkakkekkakdpn-----apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAK  357
            E+ RST   +  +   +        APKRP TAFF+F+++FRK++KE NPD K V TV +
Sbjct  96   ERKRSTTATSHPKMSKRAKKDKDPNAPKRPLTAFFLFLDDFRKSYKEANPDSKGVKTVTR  155

Query  356  EGGEKWKSLTDEEKKLYID  300
            EGGEKWKS+TDEEKK Y+D
Sbjct  156  EGGEKWKSMTDEEKKPYVD  174



>ref|XP_004497256.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Cicer 
arietinum]
Length=202

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARC EC KDVPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK 
Sbjct  14   SRAASVLVRAKDGSAFARCAECKKDVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEVKKP  73

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K++   +   K  KEKK KDPN PKRPPTAFFVFM++FRKTFKE NPD K V  V
Sbjct  74   ERKKPKSKEPSAKRAKVGKEKKIKDPNMPKRPPTAFFVFMDDFRKTFKEANPDSKDVKRV  133

Query  362  AKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATEN  237
             KE GEKW+++TDEEKK Y+DR  E KAEYEKA+E+ NA EN
Sbjct  134  GKEAGEKWRAMTDEEKKPYLDRVVELKAEYEKAMETYNAAEN  175



>ref|XP_008810905.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=197

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpae--pkkkpte  525
            +LKRA+DGSAF RC+ CNKDVPV LI  H+CSLD+KI+M+LEAQ++EK AE     +   
Sbjct  23   TLKRARDGSAFTRCEACNKDVPVVLIDMHSCSLDSKIRMSLEAQVVEKAAEVNKPVERKR  82

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
               A   E K KKEKK+KDP APKRPPTAFF+FM++FRK +KE +PD KSVATVAKEGGE
Sbjct  83   AAPAERKERKGKKEKKSKDPKAPKRPPTAFFLFMDDFRKQYKEAHPDSKSVATVAKEGGE  142

Query  344  KWKSLTDEEKKLYID  300
            KWKS+TDEE+K Y+D
Sbjct  143  KWKSMTDEERKPYLD  157



>ref|XP_004497257.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Cicer 
arietinum]
Length=201

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARC EC KDVPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK 
Sbjct  14   SRAASVLVRAKDGSAFARCAECKKDVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEVKKP  73

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K++   +   K  KEKK KDPN PKRPPTAFFVFM++FRKTFKE NPD K V  V
Sbjct  74   ERKKPKSKEPSAKRAKVGKEKKIKDPNMPKRPPTAFFVFMDDFRKTFKEANPDSKDVKRV  133

Query  362  AKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATEN  237
             KE GEKW+++TDEEKK Y+DR  E KAEYEKA+E+ NA EN
Sbjct  134  GKEAGEKWRAMTDEEKKPYLDRVVELKAEYEKAMETYNAAEN  175



>gb|KJB49541.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=214

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+CDECNK VPVALI+ H+CSL+AKIKMNLE+Q+IEKPAE KKKP E++K
Sbjct  30   LVRAKDGSAFAKCDECNKTVPVALINMHSCSLEAKIKMNLESQVIEKPAEAKKKPAERKK  89

Query  515  ARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
              +T      K KK KK KDPNAPKRPPTAFF+FM++FRK++KE NPD K V  VAKEGG
Sbjct  90   PPTTTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRKSYKEANPDAKGVTGVAKEGG  149

Query  347  EKWKSLTDEEKKLYID  300
            EKWKS+++EEKK Y+D
Sbjct  150  EKWKSMSEEEKKCYVD  165



>gb|KHG07657.1| High mobility group B 7 -like protein [Gossypium arboreum]
Length=214

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+CDECNK VP+ALI+ H+CSL+AKIKMNLE+Q+IEKPAE KKKP E++K
Sbjct  30   LVRAKDGSAFAKCDECNKTVPMALINMHSCSLEAKIKMNLESQVIEKPAEAKKKPAERKK  89

Query  515  ARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
              +T      K KK KK KDPNAPKRPPTAFF+FM++FRK++KE NPD K V  VAKEGG
Sbjct  90   PPATTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRKSYKEANPDAKGVTGVAKEGG  149

Query  347  EKWKSLTDEEKKLYID  300
            EKWKS+++EEKK Y+D
Sbjct  150  EKWKSMSEEEKKCYVD  165



>ref|XP_010034169.1| PREDICTED: high mobility group B protein 7 [Eucalyptus grandis]
 gb|KCW50636.1| hypothetical protein EUGRSUZ_J00336 [Eucalyptus grandis]
Length=245

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 7/138 (5%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L R KDGSAFARC+ECNKDVPVALIS H+C LDAKIKMNLEAQ++ +     KK    ++
Sbjct  32   LVRGKDGSAFARCEECNKDVPVALISMHSCGLDAKIKMNLEAQVM-ERPAEAKKKPAVDR  90

Query  515  ARSTE------pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKE  354
             RS+E         KK KK KD NAPKRP TAFFVFM++FRK +KE NPD K V  VAK+
Sbjct  91   KRSSEPKAKKAKTEKKSKKGKDANAPKRPATAFFVFMDDFRKAYKEANPDSKGVKEVAKQ  150

Query  353  GGEKWKSLTDEEKKLYID  300
            GGEKWKS++DEEKK Y+D
Sbjct  151  GGEKWKSMSDEEKKPYLD  168



>gb|KDP40471.1| hypothetical protein JCGZ_24470 [Jatropha curcas]
Length=214

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 110/136 (81%), Gaps = 3/136 (2%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL RA+DGSAF RC+EC K V VALIS H+CSLDAKIKMNLE++++EKP E KKKP E++
Sbjct  21   SLIRARDGSAFTRCEECKKHVAVALISMHSCSLDAKIKMNLESKVVEKPTEVKKKPAERK  80

Query  518  kARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
            K+ STEPKAKK KK K  +    PKRPPTAFF+FM+EFRK FKE NPD K V  VAKE G
Sbjct  81   KSTSTEPKAKKAKKEKKASDPNKPKRPPTAFFIFMDEFRKLFKEANPDSKDVKKVAKEAG  140

Query  347  EKWKSLTDEEKKLYID  300
            EKWKS+T+EEKK Y+D
Sbjct  141  EKWKSMTEEEKKPYVD  156



>ref|XP_010546256.1| PREDICTED: high mobility group B protein 7 [Tarenaya hassleriana]
Length=233

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 113/141 (80%), Gaps = 7/141 (5%)
 Frame = -3

Query  704  NASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpte  525
            +++L RAKDGSAFARC+EC +DVPVALIS H+CSLDAKIKMNLEAQ++E  AEPKKKP E
Sbjct  26   SSTLLRAKDGSAFARCEECKRDVPVALISMHSCSLDAKIKMNLEAQVVELQAEPKKKPAE  85

Query  524  kekARSTEpkakk------ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            ++K  S EPK K+      EKK+   N PKRP TAFF+F+++FRKTFKEENP   SV  V
Sbjct  86   RKKPTSDEPKPKRLRKLKDEKKSSASNKPKRPLTAFFLFLDDFRKTFKEENPG-SSVKDV  144

Query  362  AKEGGEKWKSLTDEEKKLYID  300
            AK+GGEKWKS+TDEEKK Y D
Sbjct  145  AKQGGEKWKSMTDEEKKPYTD  165



>ref|XP_002513135.1| DNA-binding protein MNB1B, putative [Ricinus communis]
 gb|EEF49638.1| DNA-binding protein MNB1B, putative [Ricinus communis]
Length=196

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            S+ R KDGSAFARCDEC KDVPVALIS H+CSL+A+IKMNLEAQI+EKPAE  KKP E++
Sbjct  17   SMVRGKDGSAFARCDECKKDVPVALISMHSCSLEARIKMNLEAQIVEKPAETTKKPAERK  76

Query  518  kARSTE---pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
            K  STE    KAKK+KK  +PN PKRPPTAFF+F++EFRKTFKE NPD K V  VAKE G
Sbjct  77   KPTSTEPKAKKAKKDKKPNNPNKPKRPPTAFFIFLDEFRKTFKEANPDSKDVKRVAKEAG  136

Query  347  EKWKSLTDEEKKLYID  300
            EKWK++TDEEKK Y D
Sbjct  137  EKWKAMTDEEKKPYAD  152



>gb|KEH44448.1| high mobility group (HMG)-box protein [Medicago truncatula]
Length=210

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+CDEC KDVPVALI  HNCSL+AKIKMNLE+  +E+ AE KK   +K  
Sbjct  20   LVRAKDGSAFAKCDECKKDVPVALIDMHNCSLEAKIKMNLESHAVEQAAEVKKPERKKPN  79

Query  515  AR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
            ++   +   K  K KK KDPNAPKRPPTAFFVFM+EFRK FKE NPD K V  V KE GE
Sbjct  80   SKEPNAKRAKVGKGKKVKDPNAPKRPPTAFFVFMDEFRKIFKEANPDSKDVKRVGKEAGE  139

Query  344  KWKSLTDEEKKLYID  300
            KW+SLT+EEKK Y+D
Sbjct  140  KWRSLTEEEKKPYLD  154



>ref|XP_004297711.1| PREDICTED: high mobility group B protein 7-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (76%), Gaps = 7/140 (5%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL R KDGSAFARC+ C KDVPVA ISFH+CSLDAKI+ NLEAQ++EKP++  KKP    
Sbjct  29   SLVRGKDGSAFARCEGCKKDVPVATISFHSCSLDAKIRNNLEAQVVEKPSQVTKKPPTAG  88

Query  518  kARST-------EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            K +ST         K  K KK+KDPNAPKRP TAFF+FM +FRK++KE NPD K V  VA
Sbjct  89   KKKSTTSEPNAKRVKTDKVKKSKDPNAPKRPLTAFFLFMADFRKSYKEANPDSKDVKKVA  148

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KEGGEKWK LTDEEKK YID
Sbjct  149  KEGGEKWKLLTDEEKKPYID  168



>ref|NP_001236719.1| uncharacterized protein LOC100306558 [Glycine max]
 gb|ACU14782.1| unknown [Glycine max]
Length=209

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK 
Sbjct  15   SRAASVLVRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEAKKP  74

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K++   + + K  K KK KDPN PKRPPTAFFVF+++FRK+FKE NPD K V  V
Sbjct  75   ERKKPKSKEPMAKKAKVGKGKKVKDPNMPKRPPTAFFVFLDDFRKSFKEANPDSKDVKRV  134

Query  362  AKEGGEKWKSLTDEEKKLYID  300
             KE GEKW+S+TDEEKK Y+D
Sbjct  135  GKEAGEKWRSMTDEEKKPYLD  155



>ref|XP_008802830.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=193

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +LKRA+DGSAF RC+ CNKDVPV LI  H CSLD+KI+ +LEAQ++EK AE  K    K 
Sbjct  23   TLKRARDGSAFTRCEACNKDVPVVLIDMHICSLDSKIRTSLEAQVVEKVAEANKPAERKR  82

Query  518  kARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
             A S   E K KK KK KDP APKRPPTAFF+FM++FRK++KE +PD KSV+ VAK+GGE
Sbjct  83   AASSDQKERKGKKGKKFKDPTAPKRPPTAFFLFMDDFRKSYKEAHPDSKSVSMVAKDGGE  142

Query  344  KWKSLTDEEKKLYID  300
            KW+S++DEEKK Y+D
Sbjct  143  KWRSMSDEEKKPYVD  157



>gb|KHN37346.1| High mobility group B protein 7 [Glycine soja]
Length=200

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ +E KK 
Sbjct  15   SRAASVLLRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQASEAKKP  74

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K++   +   K +K KK KDPN PKRPPTAFF F+++FRK+FKE NPD K V  V
Sbjct  75   ERKKPKSKEPMAKRAKVEKGKKVKDPNMPKRPPTAFFAFLDDFRKSFKEANPDSKDVKRV  134

Query  362  AKEGGEKWKSLTDEEKKLYID  300
             KE GEKW+S+TDEEKK Y+D
Sbjct  135  GKEAGEKWRSMTDEEKKPYLD  155



>gb|AFK37944.1| unknown [Lotus japonicus]
Length=197

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L R++DGSAFARC+ECNK VPVALIS H+CSL+AKIKMNL+AQ+IE+  E KK 
Sbjct  14   SRAASVLVRSRDGSAFARCEECNKSVPVALISMHSCSLEAKIKMNLDAQVIEQANEAKKT  73

Query  533  ptekekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K  ++  + K  K +KAK       PKRPPTAFFVF+++FRK FKE NP  K V  V
Sbjct  74   ERKKPSSKEPKAKRAKTEKAKKVEDPNQPKRPPTAFFVFLDDFRKEFKEANPGSKDVKRV  133

Query  362  AKEGGEKWKSLTDEEKKLYID  300
             KEGGEKW+++TDEEKK Y++
Sbjct  134  GKEGGEKWRAMTDEEKKPYLE  154



>ref|XP_010940378.1| PREDICTED: high mobility group B protein 7-like [Elaeis guineensis]
Length=193

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +LKRA+DGSAF +C+ CNKDVPV LI  H+CSLD+KI+M+LE+Q++EK A+ KK    K 
Sbjct  23   TLKRARDGSAFTKCEACNKDVPVVLIDMHSCSLDSKIRMSLESQVVEKVADVKKPVERKR  82

Query  518  kARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
             A +   E K KKE+K+KDP APKRPPTAFF+FM++FRK +KE +PD KSV+ VAKEGGE
Sbjct  83   AAPADRKERKGKKERKSKDPKAPKRPPTAFFLFMDDFRKEYKETHPDSKSVSMVAKEGGE  142

Query  344  KWKSLTDEEKKLYID  300
            KWKS+TDEE+K Y+D
Sbjct  143  KWKSMTDEERKPYVD  157



>gb|KHN23128.1| High mobility group B protein 7 [Glycine soja]
Length=209

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK 
Sbjct  15   SRAASVLVRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEAKKP  74

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K+    + + K  K KK KDPN PKRPPTAFFVF+++FRK+FKE NPD K V  V
Sbjct  75   ERKKPKSEEPMAKKAKVGKGKKVKDPNMPKRPPTAFFVFLDDFRKSFKEANPDSKDVKRV  134

Query  362  AKEGGEKWKSLTDEEKKLYID  300
             KE GEKW+S+TDEEKK Y+D
Sbjct  135  GKEAGEKWRSMTDEEKKPYLD  155



>gb|ACG31059.1| HMG1/2-like protein [Zea mays]
 gb|ACG39894.1| HMG1/2-like protein [Zea mays]
 gb|ACN31909.1| unknown [Zea mays]
 gb|AFW65041.1| HMG type nucleosome/chromatin assembly factor DNucleasome/chromatin 
assembly factor D protein NFD106 [Zea mays]
 gb|AIB05281.1| HMG transcription factor, partial [Zea mays]
Length=212

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 9/132 (7%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LEAQ++EK  E      +K  
Sbjct  22   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLEAQVVEKTVEVASADRKKSS  81

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
            A+                  KR PTAFF+FM++FRK FK  +PD KSVATVAKEGGE+WK
Sbjct  82   AKGG---------GNKDAKRKRSPTAFFLFMDDFRKEFKATHPDNKSVATVAKEGGERWK  132

Query  335  SLTDEEKKLYID  300
            S+TDEEKK YI+
Sbjct  133  SMTDEEKKPYIE  144



>ref|XP_007142737.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
 gb|ESW14731.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
Length=199

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFARCD+C K+VPV LI  HNCSL+AKIKMNL+AQ++++ AE KK   +K K
Sbjct  20   LVRAKDGSAFARCDDCKKNVPVVLIDMHNCSLEAKIKMNLDAQVVDQAAEAKKIERKKPK  79

Query  515  ARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
            ++  + K  K +K K       PKRP TAFFVF+++FRKTFKE NPD K V  V KE GE
Sbjct  80   SKEPKAKKAKTEKGKKVKDPNKPKRPATAFFVFLDDFRKTFKEANPDSKDVKRVGKEAGE  139

Query  344  KWKSLTDEEKKLYID  300
            KWKS+TDEEKK Y+D
Sbjct  140  KWKSMTDEEKKPYLD  154



>ref|XP_003536758.1| PREDICTED: high mobility group B protein 7-like [Glycine max]
Length=200

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S+  + L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK 
Sbjct  15   SRAASVLLRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEAKKP  74

Query  533  ptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
              +K K++   + + K +K KK KDPN PKRPPTAFF F+++FRK+FKE NPD K V  V
Sbjct  75   ERKKPKSKEPMAKKAKVEKVKKVKDPNMPKRPPTAFFAFLDDFRKSFKEANPDSKDVKRV  134

Query  362  AKEGGEKWKSLTDEEKKLYID  300
             KE GEKW+S+TDEEKK Y+D
Sbjct  135  GKEAGEKWRSMTDEEKKPYLD  155



>gb|EPS72473.1| hypothetical protein M569_02286, partial [Genlisea aurea]
Length=174

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKRA+DGSAF +C+ECN+ V VALI FH+C+LDAKIK +LEAQ++E  AEPKKK T ++K
Sbjct  27   LKRARDGSAFVKCEECNESVHVALIKFHDCTLDAKIKASLEAQVVEMQAEPKKKSTSEKK  86

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
              + +    KEKKA D N  KRPPTAFF+FM+EFRK+FKE NP  K VA VAKEGGEKWK
Sbjct  87   K-TAKKAEPKEKKAGDTNKRKRPPTAFFLFMDEFRKSFKEANPQCKKVAIVAKEGGEKWK  145

Query  335  SLTDEEKKLYID  300
            SLT+EEKK+Y D
Sbjct  146  SLTEEEKKVYQD  157



>emb|CDY64875.1| BnaCnng45460D [Brassica napus]
Length=240

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 106/142 (75%), Gaps = 10/142 (7%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +L RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E  AE KKKP E++
Sbjct  37   TLLRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVEMQAEAKKKPVERK  96

Query  518  kARSTE---------pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVAT  366
            K+ S E            K +K +   N  KRP TAFF+FM +FRKTFKEENP   +V  
Sbjct  97   KSTSDEPKAKRVRKAKDEKNKKSSSTSNKLKRPLTAFFIFMNDFRKTFKEENPS-SNVKD  155

Query  365  VAKEGGEKWKSLTDEEKKLYID  300
            VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  156  VAKQGGEKWKSLTEEEKKVYLD  177



>ref|XP_002444850.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
 gb|EES14345.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
Length=221

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD  I+M LEAQ++EK  E   KP E   
Sbjct  22   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDKHIRMMLEAQVVEKTVEVAAKPAE---  78

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
             R+                 KR PTAFF+FM++FRK FK  +PD KSVATVAKEGGEKWK
Sbjct  79   -RNKSSAKGHGGGGNKDAKRKRSPTAFFLFMDDFRKEFKAAHPDNKSVATVAKEGGEKWK  137

Query  335  SLTDEEKKLYID  300
            S+TDEEKK Y++
Sbjct  138  SMTDEEKKPYVE  149



>ref|XP_009385984.1| PREDICTED: high mobility group B protein 7-like [Musa acuminata 
subsp. malaccensis]
Length=199

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            ++  ++LKRA+DGSAF RC+ C KDV V LI  H+CSLD+KI+M LE+Q++EK  E KK 
Sbjct  19   AETASTLKRARDGSAFTRCEACKKDVAVVLIDMHSCSLDSKIRMTLESQVVEKAVEAKKP  78

Query  533  ptekekARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
              +K    S   E KAKK KK+KD +APKRP TAFF+FME+FRKTFKE NPD KSVA V+
Sbjct  79   VEKKRAVSSEGKERKAKKGKKSKDSSAPKRPATAFFLFMEDFRKTFKEANPDNKSVAVVS  138

Query  359  KEGGEKWKSLTDEEKKLYID  300
            KEGGEKWK+++DEEKK YI+
Sbjct  139  KEGGEKWKTMSDEEKKPYIE  158



>ref|XP_004972392.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Setaria 
italica]
Length=219

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 93/132 (70%), Gaps = 8/132 (6%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLDAKI+  LEAQ++E+  E  K    K+ 
Sbjct  23   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDAKIRETLEAQVVERTVEVTKPADRKKP  82

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
            A++          A      KR PTAFF+FM++FRK FK  NPD K+VATVAKEGGE+WK
Sbjct  83   AKAG--------AANKDGKRKRTPTAFFLFMDDFRKEFKAANPDNKNVATVAKEGGERWK  134

Query  335  SLTDEEKKLYID  300
            S+TDEEKK Y D
Sbjct  135  SMTDEEKKPYHD  146



>ref|XP_006288568.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
 gb|EOA21466.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
Length=236

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E  AE KKKP E++K
Sbjct  31   LRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQAEAKKKPAERKK  90

Query  515  ARSTE-------pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAK  357
            + S E            +K +   N PKRP TAFF+FM +FRKT+K+ENP   +V  VAK
Sbjct  91   SASDEPKPKRVRKAKDDKKSSSTSNKPKRPLTAFFIFMNDFRKTYKDENPS-SNVKDVAK  149

Query  356  EGGEKWKSLTDEEKKLYID  300
             GGEKWKSLT+EEKK+Y+D
Sbjct  150  HGGEKWKSLTEEEKKVYLD  168



>ref|XP_008677776.1| PREDICTED: nucleosome/chromatin assembly factor D isoform X1 
[Zea mays]
Length=281

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 9/132 (7%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LEAQ++EK  E      +K  
Sbjct  91   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLEAQVVEKTVEVASADRKKSS  150

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
            A+                  KR PTAFF+FM++FRK FK  +PD KSVATVAKEGGE+WK
Sbjct  151  AKGG---------GNKDAKRKRSPTAFFLFMDDFRKEFKATHPDNKSVATVAKEGGERWK  201

Query  335  SLTDEEKKLYID  300
            S+TDEEKK YI+
Sbjct  202  SMTDEEKKPYIE  213



>gb|KJB49542.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=164

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+CDECNK VPVALI+ H+CSL+AKIKMNLE+Q+IEKPAE KKKP E++K
Sbjct  30   LVRAKDGSAFAKCDECNKTVPVALINMHSCSLEAKIKMNLESQVIEKPAEAKKKPAERKK  89

Query  515  ARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGG  348
              +T      K KK KK KDPNAPKRPPTAFF+FM++FRK++KE NPD K V  VAKEGG
Sbjct  90   PPTTTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRKSYKEANPDAKGVTGVAKEGG  149

Query  347  EKWKSLTDE  321
            EKWKS+++E
Sbjct  150  EKWKSMSEE  158



>ref|XP_010421142.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Camelina 
sativa]
Length=238

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E KKKP EK+K
Sbjct  34   LRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQTEAKKKPAEKKK  93

Query  515  ARSTEpkakkekkakdpnap---KRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
            + S EPKAK+ +KAK  +     KRP TAFF+FM +FRKT+ EENP   +V  VAK GGE
Sbjct  94   STSDEPKAKRVRKAKSSSTSNKPKRPLTAFFIFMNDFRKTYSEENPS-NNVKDVAKRGGE  152

Query  344  KWKSLTDEEKKLYID  300
            KWKSL++EEKK+Y D
Sbjct  153  KWKSLSEEEKKVYTD  167



>ref|XP_010454621.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E KKK  EK+K
Sbjct  34   LRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETHTEAKKKTAEKKK  93

Query  515  ARSTEpkakkekkakdpnap---KRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
            + S EPKAK+ +KAK  +     KRP TAFF+FM +FRKT+ EENP I +V  VAK GGE
Sbjct  94   STSDEPKAKRVRKAKSSSTSNKPKRPLTAFFIFMNDFRKTYSEENPFI-NVKDVAKRGGE  152

Query  344  KWKSLTDEEKKLYID  300
            KWKSL++EEKK+Y D
Sbjct  153  KWKSLSEEEKKVYTD  167



>gb|KFK27649.1| hypothetical protein AALP_AA8G410700 [Arabis alpina]
Length=243

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAF RCDEC+K+V VALIS HNCSLDAKIK NLEAQ++E   E  KK   + K
Sbjct  35   LLRAKDGSAFVRCDECSKNVAVALISMHNCSLDAKIKENLEAQVVETQIEAAKKKPVERK  94

Query  515  ARSTE-------pkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAK  357
              +++        K K EKKA + N  KRP TAFF+FM +FRKTFKEENP   +V  VAK
Sbjct  95   KSTSDEPKAKRVRKTKDEKKASNSNKAKRPLTAFFIFMGDFRKTFKEENPG-SNVKDVAK  153

Query  356  EGGEKWKSLTDEEKKLYID  300
            +GGEKWKSL++EEKK+Y+D
Sbjct  154  QGGEKWKSLSEEEKKVYLD  172



>ref|XP_006848664.1| hypothetical protein AMTR_s00171p00070550 [Amborella trichopoda]
 gb|ERN10245.1| hypothetical protein AMTR_s00171p00070550 [Amborella trichopoda]
Length=199

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 102/145 (70%), Gaps = 10/145 (7%)
 Frame = -3

Query  704  NASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpte  525
              SLKRA+DGSAF +C+ C KDV VAL+  H+CSLDAKIKM  E+QI E+  E KK   +
Sbjct  20   TGSLKRARDGSAFMKCEACKKDVAVALVDMHSCSLDAKIKMTFESQIEERVTEIKKPVEK  79

Query  524  kekAR-------STEpkakkekkakdpn--apKRPPTAFFVFMEEFRKTFKEENP-DIKS  375
             + +        +TE      K  K+ +   PKRPPTAFFVFM+EFRKTFKEENP + KS
Sbjct  80   SKSSGSKKTSKVTTERAKTGTKGKKERDPNMPKRPPTAFFVFMDEFRKTFKEENPEEAKS  139

Query  374  VATVAKEGGEKWKSLTDEEKKLYID  300
            V+ VAKEGGEKWKSL+DEEKK Y++
Sbjct  140  VSKVAKEGGEKWKSLSDEEKKPYLE  164



>emb|CDY46957.1| BnaA02g32890D [Brassica napus]
Length=243

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+C+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E KKKP E++K
Sbjct  36   LLRAKDGSAFAKCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQTEAKKKPVERKK  95

Query  515  ARSTEpkakkekkakdpnap---------KRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            + S EPKAK+ +KAKD +           KRP TAFF+FM +FRKTFKEENPD   V  V
Sbjct  96   STSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFFIFMADFRKTFKEENPDA-GVKDV  154

Query  362  AKEGGEKWKSLTDEEKKLYID  300
            AK+GGEKWKSL +EEKK+Y+D
Sbjct  155  AKQGGEKWKSLDEEEKKVYLD  175



>emb|CDY16851.1| BnaA09g05310D [Brassica napus]
Length=240

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 110/143 (77%), Gaps = 11/143 (8%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +L RAKDGSAFARC+ C+K+V VALIS H+CSLDAKI++NLEAQ++E  AE KKKP E++
Sbjct  37   TLLRAKDGSAFARCEGCSKNVAVALISMHSCSLDAKIRVNLEAQVVEMQAEAKKKPVERK  96

Query  518  kARSTEpkak----------kekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVA  369
            K+ S EPKAK          K+  +   N PKRP TAFF+FM +FRKTFKEENP   +V 
Sbjct  97   KSTSDEPKAKRVRKAKDDKNKKGSSTTSNKPKRPLTAFFIFMNDFRKTFKEENPS-SNVK  155

Query  368  TVAKEGGEKWKSLTDEEKKLYID  300
             VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  156  DVAKQGGEKWKSLTEEEKKVYLD  178



>ref|XP_009141528.1| PREDICTED: high mobility group B protein 7-like [Brassica rapa]
Length=246

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 110/143 (77%), Gaps = 11/143 (8%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +L RAKDGSAFARC+ C+K+V VALIS H+CSLDAKI++NLEAQ++E  AE KKKP E++
Sbjct  37   TLLRAKDGSAFARCEGCSKNVAVALISMHSCSLDAKIRVNLEAQVVEMQAEAKKKPVERK  96

Query  518  kARSTEpkak----------kekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVA  369
            K+ S EPKAK          K+  +   N PKRP TAFF+FM +FRKTFKEENP   +V 
Sbjct  97   KSTSDEPKAKRVRKAKDDKNKKGSSTTSNKPKRPLTAFFIFMNDFRKTFKEENPS-SNVK  155

Query  368  TVAKEGGEKWKSLTDEEKKLYID  300
             VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  156  DVAKQGGEKWKSLTEEEKKVYLD  178



>emb|CDY40795.1| BnaC02g41640D [Brassica napus]
Length=249

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+C+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E KKKP E++K
Sbjct  36   LLRAKDGSAFAKCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQTEAKKKPAERKK  95

Query  515  ARSTEpkakk--------ekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            + S EPKAK+        +KK+   N PKRP TAFF+FM +FRKTFKEENPD   V  VA
Sbjct  96   STSDEPKAKRLRKSKDENKKKSSSSNKPKRPLTAFFIFMADFRKTFKEENPDA-GVKDVA  154

Query  359  KEGGEKWKSLTDEEKKLYID  300
            K+GGEKWKSL +EEKK+Y++
Sbjct  155  KQGGEKWKSLDEEEKKVYLE  174



>ref|XP_010493464.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 7/158 (4%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E  KK   ++K
Sbjct  32   LRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQTEAAKKKPAEKK  91

Query  515  ARST------EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKE  354
              +T      +   K +  +   N PKRP TAFF+FM +FRKT+ EEN  I +V  VAK 
Sbjct  92   KSTTSDEPKPKRVRKAKSSSSTSNKPKRPLTAFFIFMNDFRKTYSEENTSI-NVKDVAKR  150

Query  353  GGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATE  240
            GGEKWKSL++EEKK+Y D+AAE KAEY K+LE+N+A E
Sbjct  151  GGEKWKSLSEEEKKVYTDKAAELKAEYNKSLENNDADE  188



>ref|XP_006394608.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
 gb|ESQ31894.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
Length=251

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +L RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++E   E KKKP  + 
Sbjct  31   TLLRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVVETQTEAKKKPIVER  90

Query  518  kARSTEp-------kakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            K  +++        KAK  KK    N PKRP TAFF+FM +FRKTF EENP   +V  VA
Sbjct  91   KKPTSDAPKPKRLRKAKDNKKTSTSNKPKRPLTAFFIFMNDFRKTFGEENP-YSNVKDVA  149

Query  359  KEGGEKWKSLTDEEKKLYID  300
            K GGEKWKSLT+EEKK+Y+D
Sbjct  150  KLGGEKWKSLTEEEKKVYVD  169



>ref|XP_009130114.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Brassica 
rapa]
Length=243

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 10/141 (7%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+C+ CNK+V VALIS H+CSLDAKI++NLEAQ++E   E KKKP E++K
Sbjct  36   LLRAKDGSAFAKCEGCNKNVAVALISMHDCSLDAKIRVNLEAQVVETQTEAKKKPVERKK  95

Query  515  ARSTEpkakkekkakdpnap---------KRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            + S EPKAK+ +KAKD +           KRP TAFF+FM +FRKTFKEENPD   V  V
Sbjct  96   STSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFFIFMADFRKTFKEENPDA-GVKDV  154

Query  362  AKEGGEKWKSLTDEEKKLYID  300
            AK+GGEKWKSL +EEKK+Y+D
Sbjct  155  AKQGGEKWKSLDEEEKKVYLD  175



>gb|EAZ05273.1| hypothetical protein OsI_27476 [Oryza sativa Indica Group]
 gb|EAZ05282.1| hypothetical protein OsI_27485 [Oryza sativa Indica Group]
Length=204

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 89/135 (66%), Gaps = 8/135 (6%)
 Frame = -3

Query  704  NASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpte  525
            +A LKRA+DGSAF RC+ C K V V LI  HNCSLD KI+++LEAQ++E+  E       
Sbjct  18   SAVLKRARDGSAFTRCEACGKSVSVVLIDMHNCSLDDKIRISLEAQVVEQAVEVAAS---  74

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
                   +         +     KRPPTAFF+FM +FRK +K E+PD KSV+ VAKEGGE
Sbjct  75   -----KKKSGKNNNNNGEGAKKGKRPPTAFFLFMSDFRKEYKAEHPDNKSVSAVAKEGGE  129

Query  344  KWKSLTDEEKKLYID  300
            +WKS++DE+KK Y+D
Sbjct  130  RWKSMSDEDKKPYLD  144



>ref|NP_001060758.1| Os08g0101100 [Oryza sativa Japonica Group]
 dbj|BAD03552.1| putative HMG type nucleosome/chromatin assembly factor D [Oryza 
sativa Japonica Group]
 dbj|BAF22672.1| Os08g0101100 [Oryza sativa Japonica Group]
 gb|EAZ41214.1| hypothetical protein OsJ_25719 [Oryza sativa Japonica Group]
 gb|ACJ54921.1| HMG type nucleosome/chromatin assembly factor [Oryza sativa Japonica 
Group]
 dbj|BAG91665.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 89/135 (66%), Gaps = 8/135 (6%)
 Frame = -3

Query  704  NASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpte  525
            +A LKRA+DGSAF RC+ C K V V LI  HNCSLD KI+++LEAQ++E+  E       
Sbjct  18   SAVLKRARDGSAFTRCEACGKSVSVVLIDMHNCSLDDKIRISLEAQVVEQAVEVAAS---  74

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
                   +         +     KRPPTAFF+FM +FRK +K E+PD KSV+ VAKEGGE
Sbjct  75   -----KKKSGKNNNNNGEGAKKGKRPPTAFFLFMSDFRKEYKAEHPDNKSVSAVAKEGGE  129

Query  344  KWKSLTDEEKKLYID  300
            +WKS++DE+KK Y+D
Sbjct  130  RWKSMSDEDKKPYLD  144



>ref|XP_006659014.1| PREDICTED: high mobility group B protein 7-like [Oryza brachyantha]
Length=191

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 87/134 (65%), Gaps = 11/134 (8%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptek  522
            A LKRA+DGSAF RC+ C K V VALI  HNCSLD KI+M LEAQ++E+  E        
Sbjct  19   AVLKRARDGSAFTRCEACGKSVSVALIDMHNCSLDDKIRMTLEAQVVEQAVEV-------  71

Query  521  ekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEK  342
                +   K  K          KRPPTAFF+F+ +FRK +K E+P  KSV+  AKEGGE+
Sbjct  72   ----TANTKKGKGDDDNKKKKGKRPPTAFFLFLADFRKEYKAEHPGNKSVSAAAKEGGER  127

Query  341  WKSLTDEEKKLYID  300
            WK+++DEEKK Y+D
Sbjct  128  WKAMSDEEKKPYLD  141



>ref|XP_010688617.1| PREDICTED: high mobility group B protein 7 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SLKRAKDGSAFARC+EC   VPVALI  H+CSL+AKIKM+L+A ++EKPAE KKK   K+
Sbjct  33   SLKRAKDGSAFARCEECKSSVPVALIDMHSCSLEAKIKMSLDATVVEKPAEVKKKAERKK  92

Query  518  kARSTEpkakkekkakdpna----pKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
             A S+E  ++ +K+          PKRP TA+FVFMEEFRK +KEE+P+ K V   AKE 
Sbjct  93   PASSSEAGSESKKRKLSKVKDPNMPKRPMTAYFVFMEEFRKVYKEEHPESKGVKEFAKEA  152

Query  350  GEKWKSLTDEEKKLY  306
            G KWK+LTDEEKK Y
Sbjct  153  GAKWKALTDEEKKPY  167



>ref|XP_004972391.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Setaria 
italica]
Length=278

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 8/125 (6%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLDAKI+  LEAQ++E+  E  K    K+ 
Sbjct  23   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDAKIRETLEAQVVERTVEVTKPADRKKP  82

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWK  336
            A++          A      KR PTAFF+FM++FRK FK  NPD K+VATVAKEGGE+WK
Sbjct  83   AKA--------GAANKDGKRKRTPTAFFLFMDDFRKEFKAANPDNKNVATVAKEGGERWK  134

Query  335  SLTDE  321
            S+TDE
Sbjct  135  SMTDE  139



>ref|XP_002874129.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50388.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 120/166 (72%), Gaps = 10/166 (6%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            +  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NLEAQ++E  AE KKK
Sbjct  23   TNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNLEAQVVETQAEAKKK  82

Query  533  ptekekARS-------TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK-EENPDIK  378
            P EK+K  S        +    ++K +   N PKRP TAFF+FM +FRKTFK E N  + 
Sbjct  83   PAEKKKTTSDGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMNDFRKTFKTEHNGSLA  142

Query  377  SVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATE  240
              A  AK GGEKWKSLT+EEKK+Y+D+AAE KAEY K+LESN+A E
Sbjct  143  KDA--AKIGGEKWKSLTEEEKKVYLDKAAELKAEYNKSLESNDADE  186



>ref|NP_568431.1| high-mobility group B6 protein [Arabidopsis thaliana]
 sp|Q8LDF9.1|HMGB7_ARATH RecName: Full=High mobility group B protein 7; AltName: Full=Nucleosome/chromatin 
assembly factor group D 07; Short=Nucleosome/chromatin 
assembly factor group D 7; AltName: Full=Protein 
NUCLEAR FUSION DEFECTIVE 7 [Arabidopsis thaliana]
 gb|AAM63233.1| unknown [Arabidopsis thaliana]
 dbj|BAC43282.1| unknown protein [Arabidopsis thaliana]
 gb|AED93164.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=241

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 104/146 (71%), Gaps = 10/146 (7%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkk  534
            S  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NLEAQ++E  AE KKK
Sbjct  23   SNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNLEAQVVETQAEAKKK  82

Query  533  ptekekARS-------TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKS  375
            P EK+K  S        +    ++K +   N PKRP TAFF+FM +FRKTFK E+    S
Sbjct  83   PAEKKKTTSDGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMSDFRKTFKSEHNG--S  140

Query  374  VAT-VAKEGGEKWKSLTDEEKKLYID  300
            +A   AK GGEKWKSLT+EEKK+Y+D
Sbjct  141  LAKDAAKIGGEKWKSLTEEEKKVYLD  166



>ref|XP_003573245.1| PREDICTED: high mobility group B protein 7-like [Brachypodium 
distachyon]
Length=218

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekp---aepkkkp  531
            A LKRA+DGSAF RC+ CNK+VPV LI  H+CSLD+KI+ +LEAQ++EK    ++P+KK 
Sbjct  17   AVLKRARDGSAFTRCEGCNKNVPVVLIDLHSCSLDSKIRTSLEAQVVEKTVEISKPEKKR  76

Query  530  tekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
                 A + +   K +  A   N  KRPPTAFF+FM++FR  FK  +PD K V+ V K  
Sbjct  77   KAPSSAAAGKGSKKGKSGAGAKNGKKRPPTAFFIFMKDFRLEFKASHPDEKGVSAVGKAA  136

Query  350  GEKWKSLTDEEKKLYID  300
            G KWK++TDEEKK Y+D
Sbjct  137  GVKWKAMTDEEKKPYLD  153



>gb|EMS56844.1| High mobility group B protein 7 [Triticum urartu]
Length=216

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekp---aepkkkpte  525
            LKRA+DGSAF RC+ CNKDV + LI  H+CSLD+KI+++LE+Q++EK     E K+K   
Sbjct  19   LKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSLESQVVEKAVEIQEKKRKAPS  78

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
                   + K+K +         KRPPTAFF+FM++FR  FK  +PD K VA V K  GE
Sbjct  79   AAAGGKGKKKSKADGDGAKKPKAKRPPTAFFLFMKDFRVEFKASHPDEKGVAAVGKAAGE  138

Query  344  KWKSLTDEEKKLYID  300
            KWKS+T+EEKK Y D
Sbjct  139  KWKSMTEEEKKPYND  153



>dbj|BAK07893.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=215

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekp---aepkkkpte  525
            LKRA+DGSAF RC+ CNKDV + LI  H+CSLD+KI+++LE+Q++EK     E K+K   
Sbjct  19   LKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSLESQVVEKAVEVQEKKRKAPP  78

Query  524  kekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGE  345
                   + K+K +         KRPPTAFF+FM++FR  FK  +PD K VA V K  GE
Sbjct  79   AAAGGKGKKKSKADGDGAKKAKAKRPPTAFFLFMKDFRVEFKTSHPDEKGVAAVGKAAGE  138

Query  344  KWKSLTDEEKKLYID  300
            KW+S+T+EEKK Y D
Sbjct  139  KWRSMTEEEKKPYND  153



>ref|XP_009130115.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Brassica 
rapa]
Length=214

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 100/131 (76%), Gaps = 10/131 (8%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            L RAKDGSAFA+C+ CNK+V VALIS H+CSLDAKI++NLEAQ++E   E KKKP E++K
Sbjct  36   LLRAKDGSAFAKCEGCNKNVAVALISMHDCSLDAKIRVNLEAQVVETQTEAKKKPVERKK  95

Query  515  ARSTEpkakkekkakdpnap---------KRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            + S EPKAK+ +KAKD +           KRP TAFF+FM +FRKTFKEENPD   V  V
Sbjct  96   STSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFFIFMADFRKTFKEENPDA-GVKDV  154

Query  362  AKEGGEKWKSL  330
            AK+GGEKWKSL
Sbjct  155  AKQGGEKWKSL  165



>ref|XP_008465567.1| PREDICTED: high mobility group B protein 7 [Cucumis melo]
Length=153

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL RAKDGSAFARCDEC K VPVALIS H+CSLDAKI+MNLEAQ +EK  + KK   +K+
Sbjct  26   SLVRAKDGSAFARCDECGKSVPVALISMHSCSLDAKIRMNLEAQTVEKQTQSKKPAEKKK  85

Query  518  kARSTEpkakkekkakdpn-----apKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
             A S     K     K        APKRPPTAFF+FM++FRK+FKE NPD K V  V+
Sbjct  86   SASSEPKAKKSRTDKKGKKDKDPNAPKRPPTAFFIFMDDFRKSFKEANPDSKGVKEVS  143



>gb|ABK23898.1| unknown [Picea sitchensis]
Length=220

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 96/137 (70%), Gaps = 4/137 (3%)
 Frame = -3

Query  701  ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA----QIIekpaepkkk  534
            A+LKRA+DGS F +CD CNK +PVAL   H+C L+ KI+ N +A    +  +    P+ K
Sbjct  23   ANLKRARDGSGFTKCDVCNKHIPVALSDMHDCQLEDKIRSNFDASKETKHADAQKPPEAK  82

Query  533  ptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKE  354
              +K+ A     K  +EKKA+DPN PK+P TAFFVFM++FRKT+KE NPD+K  A V KE
Sbjct  83   KAKKKSADEKPKKRTREKKARDPNQPKKPATAFFVFMDDFRKTYKETNPDVKGAAQVGKE  142

Query  353  GGEKWKSLTDEEKKLYI  303
            GG KWK+++DE+KK Y+
Sbjct  143  GGLKWKAMSDEDKKPYL  159



>ref|XP_008340418.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Malus 
domestica]
Length=234

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            SL R KDGSAFARCDECNKDVPVALI+ H+CSLDAKIK+NL+AQ++E+P E KKKP  + 
Sbjct  36   SLVRGKDGSAFARCDECNKDVPVALITMHSCSLDAKIKLNLKAQVVERPPEVKKKPPTET  95

Query  518  kAR------STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATV  363
            + +      S    +K+ KK KDPNAPKRP TAFF+F+++FRK++KE NPD K V  V
Sbjct  96   QRKKFTTATSQPKMSKRAKKDKDPNAPKRPLTAFFLFLDDFRKSYKEANPDSKGVKMV  153



>ref|XP_002873936.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50195.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 12/140 (9%)
 Frame = -3

Query  698  SLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkpteke  519
            +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI+    AQ++E  AE KKKP EK+
Sbjct  29   TLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIR----AQVVETQAEAKKKPAEKK  84

Query  518  kA-------RSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVA  360
            KA       +  +    ++K +   N PKRP TAFF+FM +FRKTFK E+ +       A
Sbjct  85   KATADGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMNDFRKTFKTEH-NGSFAKDAA  143

Query  359  KEGGEKWKSLTDEEKKLYID  300
            K GGEKW SLT++EKK+Y+D
Sbjct  144  KIGGEKWMSLTEDEKKVYLD  163



>ref|XP_008340417.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Malus 
domestica]
Length=238

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = -3

Query  698  SLKRAKDGSAFAR----CDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkp  531
            SL R KDGSAFAR     DECNKDVPVALI+ H+CSLDAKIK+NL+AQ++E+P E KKKP
Sbjct  36   SLVRGKDGSAFARWVWESDECNKDVPVALITMHSCSLDAKIKLNLKAQVVERPPEVKKKP  95

Query  530  tekekAR------STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVA  369
              + + +      S    +K+ KK KDPNAPKRP TAFF+F+++FRK++KE NPD K V 
Sbjct  96   PTETQRKKFTTATSQPKMSKRAKKDKDPNAPKRPLTAFFLFLDDFRKSYKEANPDSKGVK  155

Query  368  TV  363
             V
Sbjct  156  MV  157



>ref|XP_006574164.1| PREDICTED: high mobility group B protein 7-like [Glycine max]
Length=172

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = -3

Query  686  AKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekekAR-  510
            AKDGSAFA C +C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK   +K K++ 
Sbjct  24   AKDGSAFAHCYDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEAKKPERKKPKSKE  83

Query  509  --STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEG  351
              + + K  K KK KDPN PKRPPT FFVF+++FRK+FKE NPD K    V KE 
Sbjct  84   PMAKKAKVGKGKKVKDPNMPKRPPTTFFVFLDDFRKSFKEANPDSKDAKRVGKEA  138



>gb|KHM99982.1| High mobility group B protein 7 [Glycine soja]
Length=138

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -3

Query  686  AKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekekAR-  510
            AKDGSAFA C +C K+VPVALI  H+CSL+AKIKMNL+AQ++E+ AE KK   +K K++ 
Sbjct  24   AKDGSAFAHCYDCKKNVPVALIDMHSCSLEAKIKMNLDAQVVEQAAEAKKPERKKPKSKE  83

Query  509  --STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEENPDIKSVATVAK  357
              + + K  K KK KDPN PKRPPT FFVF+++FRK+FKE NPD K    V+K
Sbjct  84   PMAKKAKVGKGKKVKDPNMPKRPPTTFFVFLDDFRKSFKEANPDSKDAKRVSK  136



>ref|NP_001105076.1| nucleosome/chromatin assembly factor D [Zea mays]
 gb|AAL33652.1|AF440223_1 HMG type nucleosome/chromatin assembly factor D [Zea mays]
 gb|AAM93218.1|AF527617_1 nucleasome/chromatin assembly factor D protein NFD106 [Zea mays]
Length=154

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            R PTAFF+FM++FRK FK  +PD KSVATVAKEGGE+WKS+TDEEKK YI+
Sbjct  36   RSPTAFFLFMDDFRKEFKATHPDNKSVATVAKEGGERWKSMTDEEKKPYIE  86



>gb|EYU41881.1| hypothetical protein MIMGU_mgv1a015087mg [Erythranthe guttata]
Length=168

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKSLTD EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSLTDAEKAPY  104



>emb|CAJ38371.1| HMG-protein [Plantago major]
Length=212

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR+TFK+ENP+IK+V+ V K GGEKWKSLTD EK  Y
Sbjct  101  RPPSAFFVFLEEFRQTFKKENPNIKAVSAVGKAGGEKWKSLTDAEKAPY  149



>ref|XP_010421143.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Camelina 
sativa]
Length=170

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQII  561
            L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NLEAQ++
Sbjct  34   LRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNLEAQVV  78



>ref|NP_001190371.1| high-mobility group B6 protein [Arabidopsis thaliana]
 gb|AED93165.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=157

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  713  SQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQII  561
            S  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NLEAQ++
Sbjct  23   SNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNLEAQVV  73



>ref|XP_004232565.1| PREDICTED: HMG1/2-like protein [Solanum lycopersicum]
Length=140

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>ref|XP_010262835.1| PREDICTED: high mobility group B protein 1-like [Nelumbo nucifera]
Length=166

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKT+K+ENP++K+V+ V K GGEKWKS++D EK  Y
Sbjct  59   RPPSAFFVFLEEFRKTYKQENPNVKAVSAVGKAGGEKWKSMSDAEKAPY  107



>ref|XP_006340837.1| PREDICTED: HMG1/2-like protein-like [Solanum tuberosum]
Length=141

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>emb|CAA05365.1| high mobility group protein [Solanum tuberosum]
Length=141

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>gb|EPS72658.1| hypothetical protein M569_02099 [Genlisea aurea]
Length=175

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENPD+K+V+ V K GGEKWKS+++ EK  Y
Sbjct  58   RPPSAFFVFLEEFRKTFKKENPDVKAVSAVGKAGGEKWKSMSENEKAPY  106



>gb|AFW65042.1| hypothetical protein ZEAMMB73_846021 [Zea mays]
Length=123

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 9/91 (10%)
 Frame = -3

Query  695  LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQIIekpaepkkkptekek  516
            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LEAQ++EK  E      +K  
Sbjct  22   LKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLEAQVVEKTVEVASADRKKSS  81

Query  515  ARSTEpkakkekkakdpnapKRPPTAFFVFM  423
            A+                  KR PTAFF+FM
Sbjct  82   AKG---------GGNKDAKRKRSPTAFFLFM  103



>ref|XP_007046509.1| High mobility group B4, putative [Theobroma cacao]
 gb|EOX90666.1| High mobility group B4, putative [Theobroma cacao]
Length=145

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KEE+PD KSV+ V K GG KWKS+T++EK  Y+
Sbjct  40   RPPSAFFVFMEEFRKQYKEEHPDNKSVSAVGKAGGAKWKSMTEDEKAPYV  89



>ref|XP_010692886.1| PREDICTED: HMG1/2-like protein isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFR T+K+++P  KSVA V K GGEKWKSLTD EK  YI
Sbjct  39   RPPSAFFVFMEEFRVTYKQKHPQNKSVAAVGKAGGEKWKSLTDAEKAPYI  88



>emb|CDP21129.1| unnamed protein product [Coffea canephora]
Length=140

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKEENP+ K VA V K  G+KWKS TDEEK  Y+
Sbjct  38   RPPSAFFVFMEEFRKQFKEENPNNKLVAVVGKAAGDKWKSFTDEEKAPYV  87



>ref|XP_008243826.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Prunus 
mume]
Length=169

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K VA V K GG+KWKSL+D EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEFKKENPNVKGVAAVGKAGGDKWKSLSDAEKAPY  105



>ref|XP_009420828.1| PREDICTED: DNA-binding protein MNB1B-like [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKSL++ EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSLSEAEKAPYV  94



>ref|XP_009387918.1| PREDICTED: DNA-binding protein MNB1B-like isoform X5 [Musa acuminata 
subsp. malaccensis]
Length=141

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_009387916.1| PREDICTED: HMG1/2-like protein isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=150

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_010692885.1| PREDICTED: high mobility group B protein 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFR T+K+++P  KSVA V K GGEKWKSLTD EK  YI
Sbjct  39   RPPSAFFVFMEEFRVTYKQKHPQNKSVAAVGKAGGEKWKSLTDAEKAPYI  88



>ref|XP_006833354.1| hypothetical protein AMTR_s00109p00094550 [Amborella trichopoda]
 gb|ERM98632.1| hypothetical protein AMTR_s00109p00094550 [Amborella trichopoda]
Length=116

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AF +FM+ FR TFK+ENPD K +A V K GGEKWKS+TD+EK  YI
Sbjct  42   RPPSAFLLFMDAFRVTFKKENPDTKGIAVVGKAGGEKWKSMTDQEKASYI  91



>ref|XP_011094996.1| PREDICTED: high mobility group B protein 1 [Sesamum indicum]
 ref|XP_011094997.1| PREDICTED: high mobility group B protein 1 [Sesamum indicum]
Length=173

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEE  318
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSLTD E
Sbjct  56   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLTDAE  100



>ref|XP_009387915.1| PREDICTED: HMG1/2-like protein isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_009383540.1| PREDICTED: HMG1/2-like protein [Musa acuminata subsp. malaccensis]
Length=154

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKSL++ EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSLSEAEKAPYV  94



>ref|XP_009387914.1| PREDICTED: HMG1/2-like protein isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=156

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_008243819.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Prunus 
mume]
Length=180

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K VA V K GG+KWKSL+D EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEFKKENPNVKGVAAVGKAGGDKWKSLSDAEKAPY  105



>ref|XP_006576167.1| PREDICTED: uncharacterized protein LOC100499704 isoform X1 [Glycine 
max]
 ref|XP_006576168.1| PREDICTED: uncharacterized protein LOC100499704 isoform X2 [Glycine 
max]
 ref|XP_006576169.1| PREDICTED: uncharacterized protein LOC100499704 isoform X3 [Glycine 
max]
Length=166

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>ref|XP_006576170.1| PREDICTED: uncharacterized protein LOC100499704 isoform X4 [Glycine 
max]
Length=160

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>ref|NP_001238631.1| uncharacterized protein LOC100499704 [Glycine max]
 gb|ACU13314.1| unknown [Glycine max]
Length=166

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>gb|KJB10395.1| hypothetical protein B456_001G198900 [Gossypium raimondii]
Length=136

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE NPD +SV+ V K GGEKWKS+TD EK  Y+
Sbjct  40   RPASAFFVFMEEFRKQYKEANPDNRSVSAVGKAGGEKWKSMTDAEKAPYV  89



>gb|ADD74180.2| high mobility group box 3 protein [Gossypium hirsutum]
Length=139

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE NPD +SV+ V K GGEKWKS+TD EK  Y+
Sbjct  40   RPASAFFVFMEEFRKQYKEANPDNRSVSAVGKAGGEKWKSMTDAEKAPYV  89



>ref|XP_009387913.1| PREDICTED: HMG1/2-like protein isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=157

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_004246321.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325790.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325791.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325792.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
Length=176

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSAAEKSPY  103



>gb|KCW88103.1| hypothetical protein EUGRSUZ_A00506 [Eucalyptus grandis]
Length=171

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSMSQAEKAPY  103



>ref|XP_006425283.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006425284.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006425285.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006467079.1| PREDICTED: HMG1/2-like protein-like [Citrus sinensis]
 gb|ESR38523.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 gb|ESR38524.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 gb|ESR38525.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
Length=147

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRK FKE +P+ KSVATV K  GEKWKS++D+EK  +++
Sbjct  42   RPPSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSDDEKAPFVE  92



>ref|XP_010028985.1| PREDICTED: high mobility group B protein 1 [Eucalyptus grandis]
 gb|KCW88104.1| hypothetical protein EUGRSUZ_A00506 [Eucalyptus grandis]
Length=172

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSMSQAEKAPY  103



>ref|XP_010100630.1| High mobility group B protein 1 [Morus notabilis]
 gb|EXB83378.1| High mobility group B protein 1 [Morus notabilis]
Length=145

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFRK++KE  PD+KSVA V K GGEKWKS++D +K  Y++
Sbjct  44   RPASAFFVFMEEFRKSYKENYPDVKSVAVVGKAGGEKWKSMSDADKAPYVE  94



>ref|XP_009103331.1| PREDICTED: high mobility group B protein 3-like [Brassica rapa]
Length=141

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+PD KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPASAFFVFMEDFRQTYKKEHPDNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_007133904.1| hypothetical protein PHAVU_010G001800g [Phaseolus vulgaris]
 gb|ESW05898.1| hypothetical protein PHAVU_010G001800g [Phaseolus vulgaris]
Length=172

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPNVKAVSAVGKAGGEKWKSLSSAEKAPY  104



>gb|KDO69008.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=129

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>emb|CDY01357.1| BnaA07g11300D [Brassica napus]
Length=141

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+PD KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPASAFFVFMEDFRQTYKKEHPDNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>gb|KDO69009.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=130

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>ref|XP_006366341.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366342.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Solanum 
tuberosum]
Length=175

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSAAEKAPY  103



>tpg|DAA62631.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=119

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>gb|AGV54591.1| high mobility group B protein 1 [Phaseolus vulgaris]
Length=167

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPNVKAVSAVGKAGGEKWKSLSSAEKAPY  104



>ref|XP_004492431.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004492432.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Cicer 
arietinum]
Length=173

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP +K+V+ V K GGEKWKSLT  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPTVKAVSAVGKAGGEKWKSLTKAEKAPY  104



>gb|EPS64999.1| hypothetical protein M569_09780, partial [Genlisea aurea]
Length=152

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWKSL+D EK  YI
Sbjct  47   RPASAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGDKWKSLSDAEKAPYI  96



>gb|AAM93217.1|AF527616_1 nucleasome/chromatin assembly factor D protein NFD101 [Zea mays]
 emb|CAA70045.1| HMGd1 [Zea mays]
 gb|ACF83373.1| unknown [Zea mays]
 tpg|DAA62630.1| TPA: HMG-like nucleosome/chromatin assembly factor D [Zea mays]
 gb|AIB04960.1| HMG transcription factor, partial [Zea mays]
Length=126

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>tpg|DAA62628.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=118

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>tpg|DAA62629.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=123

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>ref|XP_003623293.1| HMG1/2-like protein [Medicago truncatula]
 gb|AES79511.1| high mobility group (HMG)-box protein [Medicago truncatula]
 gb|AFK43669.1| unknown [Medicago truncatula]
Length=170

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+E+FRKTFK ENP++K+V+ V K GGEKWKSLT  EK  Y
Sbjct  53   RPPSAFFVFLEDFRKTFKAENPNVKAVSAVGKAGGEKWKSLTKAEKAPY  101



>ref|XP_002980703.1| hypothetical protein SELMODRAFT_38818, partial [Selaginella moellendorffii]
 gb|EFJ18354.1| hypothetical protein SELMODRAFT_38818, partial [Selaginella moellendorffii]
Length=83

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP TAFFVF+EE+RKTFK+++P+IK VA V K GG+ WK LT+EEKK Y D
Sbjct  13   RPATAFFVFLEEYRKTFKDKHPNIKGVAAVGKAGGDAWKRLTEEEKKPYHD  63



>ref|NP_001275787.1| group B HMG-box protein [Citrus sinensis]
 ref|XP_006435721.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 ref|XP_006435722.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 ref|XP_006486328.1| PREDICTED: high mobility group B protein 1 [Citrus sinensis]
 gb|AEV43366.1| group B HMG-box protein [Citrus sinensis]
 gb|ESR48961.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 gb|ESR48962.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 gb|KDO69007.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=165

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>ref|XP_009588564.1| PREDICTED: high mobility group B protein 1 [Nicotiana tomentosiformis]
 ref|XP_009588565.1| PREDICTED: high mobility group B protein 1 [Nicotiana tomentosiformis]
Length=172

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKS++  EK  Y
Sbjct  54   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSMSAAEKAPY  102



>gb|AFK49192.1| unknown [Lotus japonicus]
Length=173

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+E+FRKTFK ENP++K V+ V K GGEKWKSLT  EK  Y
Sbjct  52   RPPSAFFVFLEDFRKTFKAENPNVKGVSAVGKAGGEKWKSLTKAEKAPY  100



>gb|KCW88102.1| hypothetical protein EUGRSUZ_A00506 [Eucalyptus grandis]
Length=189

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSMSQAEKAPY  103



>ref|XP_011074084.1| PREDICTED: HMG1/2-like protein [Sesamum indicum]
Length=140

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRK +KE++P+ KSVA V K GG+KWKSL+DEEK  ++
Sbjct  38   RPPSAFFVFMEDFRKQYKEKHPNNKSVAAVGKAGGDKWKSLSDEEKAPFV  87



>gb|AAC50019.1| high mobility group protein 2 HMG2 [Ipomoea nil]
Length=146

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRKT+KE++P+ KSVA V K GG+KWK LTD EK  +I
Sbjct  38   RPPSAFFVFMEDFRKTYKEKHPNNKSVAAVGKAGGDKWKQLTDAEKAPFI  87



>ref|NP_001105649.1| HMG-like nucleosome/chromatin assembly factor D [Zea mays]
 gb|AAL33650.1|AF440221_1 HMG-like nucleosome/chromatin assembly factor D [Zea mays]
Length=126

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSLIGKAGGDKWKSLSDAEKAPYV  79



>ref|XP_011100443.1| PREDICTED: HMG1/2-like protein [Sesamum indicum]
 ref|XP_011100447.1| PREDICTED: HMG1/2-like protein [Sesamum indicum]
Length=140

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRK +KE++P+ KSVA V K GG+KWKSL+DEEK  ++
Sbjct  38   RPPSAFFVFMEDFRKQYKEKHPNNKSVAAVGKAGGDKWKSLSDEEKAPFV  87



>ref|XP_009397968.1| PREDICTED: HMG1/2-like protein [Musa acuminata subsp. malaccensis]
Length=149

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRKTFKE++PD K V+ V+K GG  WKS+++ EK  Y+D
Sbjct  46   RPPSAFFVFMEEFRKTFKEKHPDNKKVSVVSKAGGNNWKSMSEAEKAPYVD  96



>ref|XP_009773209.1| PREDICTED: high mobility group B protein 1 [Nicotiana sylvestris]
 ref|XP_009773210.1| PREDICTED: high mobility group B protein 1 [Nicotiana sylvestris]
Length=173

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSMSAAEKAPY  103



>ref|XP_010923050.1| PREDICTED: high mobility group B protein 1-like [Elaeis guineensis]
Length=164

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL+D EK  Y
Sbjct  58   RPPSAFFVFLEEFRKQYKQEHPNVKAVSVVGKAGGEKWKSLSDAEKAPY  106



>ref|XP_008651871.1| PREDICTED: HMG-like nucleosome/chromatin assembly factor D isoform 
X1 [Zea mays]
Length=173

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  77   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  126



>tpg|DAA40705.1| TPA: hypothetical protein ZEAMMB73_374315 [Zea mays]
Length=120

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  30   RPPTAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  79



>gb|KDO69006.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=184

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  77   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  122



>ref|XP_010063137.1| PREDICTED: high mobility group B protein 3-like [Eucalyptus grandis]
 gb|KCW70327.1| hypothetical protein EUGRSUZ_F03571 [Eucalyptus grandis]
 gb|KCW70328.1| hypothetical protein EUGRSUZ_F03571 [Eucalyptus grandis]
Length=142

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE++P+ KSVA V K GG+KWKSL+D+EK  YI
Sbjct  37   RPASAFFVFMEEFRKQYKEKHPNNKSVAAVGKAGGDKWKSLSDDEKAPYI  86



>gb|ACR37707.1| unknown [Zea mays]
 tpg|DAA40706.1| TPA: HMG1/2-like protein [Zea mays]
 gb|AIB05121.1| HMG transcription factor, partial [Zea mays]
Length=127

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  30   RPPTAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  79



>ref|XP_010908531.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Elaeis 
guineensis]
Length=166

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKS++D EK  Y
Sbjct  58   RPPSAFFVFLEEFRKQYKQEHPNVKAVSVVGKAGGEKWKSMSDAEKAPY  106



>gb|EYU36574.1| hypothetical protein MIMGU_mgv1a015928mg [Erythranthe guttata]
Length=139

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFME+FR+ +KE++P  KSVA V K GG+KWKSL+DEEK  Y
Sbjct  38   RPPSAFFVFMEDFRRQYKEKHPTNKSVAVVGKAGGDKWKSLSDEEKAPY  86



>gb|EYU36572.1| hypothetical protein MIMGU_mgv1a015928mg [Erythranthe guttata]
 gb|EYU36573.1| hypothetical protein MIMGU_mgv1a015928mg [Erythranthe guttata]
Length=140

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFME+FR+ +KE++P  KSVA V K GG+KWKSL+DEEK  Y
Sbjct  39   RPPSAFFVFMEDFRRQYKEKHPTNKSVAVVGKAGGDKWKSLSDEEKAPY  87



>gb|KDO71476.1| hypothetical protein CISIN_1g031973mg [Citrus sinensis]
 gb|KDO71477.1| hypothetical protein CISIN_1g031973mg [Citrus sinensis]
Length=147

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRK FKE +P+ KSVATV K  GEKWKS++++EK  +++
Sbjct  42   RPPSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVE  92



>gb|KDO69011.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
 gb|KDO69012.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=119

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTD  324
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTD  100



>ref|XP_006572804.1| PREDICTED: uncharacterized protein LOC100305961 isoform X1 [Glycine 
max]
 ref|XP_006572805.1| PREDICTED: uncharacterized protein LOC100305961 isoform X2 [Glycine 
max]
 ref|XP_006572806.1| PREDICTED: uncharacterized protein LOC100305961 isoform X3 [Glycine 
max]
 ref|XP_006572807.1| PREDICTED: uncharacterized protein LOC100305961 isoform X4 [Glycine 
max]
 gb|KHN13316.1| High mobility group B protein 1 [Glycine soja]
Length=169

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP +K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPLVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>tpg|DAA40704.1| TPA: hypothetical protein ZEAMMB73_374315 [Zea mays]
Length=140

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  50   RPPTAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  99



>ref|XP_008668095.1| PREDICTED: LOC100284781 isoform X2 [Zea mays]
Length=165

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  75   RPPTAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  124



>gb|KDO69010.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=116

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD  KK +
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAIKKEH  106



>ref|XP_002976963.1| hypothetical protein SELMODRAFT_175895 [Selaginella moellendorffii]
 gb|EFJ22073.1| hypothetical protein SELMODRAFT_175895 [Selaginella moellendorffii]
Length=156

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP TAFFVF+EE+RKTFK+++P+IK VA V K GG+ WK LT+EEKK Y D
Sbjct  57   RPATAFFVFLEEYRKTFKDKHPNIKGVAAVGKAGGDAWKRLTEEEKKPYHD  107



>ref|XP_009382744.1| PREDICTED: DNA-binding protein MNB1B [Musa acuminata subsp. malaccensis]
Length=152

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K  G+KWKSL++ EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAAGDKWKSLSEAEKAPYV  94



>ref|XP_008668094.1| PREDICTED: LOC100284781 isoform X1 [Zea mays]
Length=172

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  75   RPPTAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  124



>ref|XP_010109616.1| hypothetical protein L484_015571 [Morus notabilis]
 gb|EXC23661.1| hypothetical protein L484_015571 [Morus notabilis]
Length=175

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K+V+ V K GG+KWKSL++ EK  Y
Sbjct  57   RPPSAFFVFLEEFRKVFKKENPNVKAVSAVGKAGGDKWKSLSNAEKAPY  105



>ref|XP_007026722.1| High mobility group B1 isoform 2, partial [Theobroma cacao]
 gb|EOY07224.1| High mobility group B1 isoform 2, partial [Theobroma cacao]
Length=162

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GEKWKSL+++EK  Y
Sbjct  55   RPPSAFFVFLEEFRATFKKENPNVKAVSAVGKAAGEKWKSLSEDEKAPY  103



>ref|XP_007026721.1| High mobility group B1, putative isoform 1 [Theobroma cacao]
 ref|XP_007026724.1| High mobility group B1, putative isoform 1 [Theobroma cacao]
 gb|EOY07223.1| High mobility group B1, putative isoform 1 [Theobroma cacao]
 gb|EOY07226.1| High mobility group B1, putative isoform 1 [Theobroma cacao]
Length=172

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GEKWKSL+++EK  Y
Sbjct  55   RPPSAFFVFLEEFRATFKKENPNVKAVSAVGKAAGEKWKSLSEDEKAPY  103



>ref|XP_007026725.1| High mobility group B1 isoform 5 [Theobroma cacao]
 ref|XP_007026727.1| High mobility group B1 isoform 5 [Theobroma cacao]
 gb|EOY07227.1| High mobility group B1 isoform 5 [Theobroma cacao]
 gb|EOY07229.1| High mobility group B1 isoform 5 [Theobroma cacao]
Length=167

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GEKWKSL+++EK  Y
Sbjct  55   RPPSAFFVFLEEFRATFKKENPNVKAVSAVGKAAGEKWKSLSEDEKAPY  103



>ref|XP_002528104.1| DNA-binding protein MNB1B, putative [Ricinus communis]
 gb|EEF34283.1| DNA-binding protein MNB1B, putative [Ricinus communis]
Length=171

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP + SVA V K GG KWKS++  EK  Y
Sbjct  57   RPPSAFFVFLEEFRKTFKKENPSVTSVAAVGKAGGAKWKSMSSAEKAPY  105



>ref|XP_007026723.1| High mobility group B1 isoform 3 [Theobroma cacao]
 ref|XP_007026726.1| High mobility group B1 isoform 3 [Theobroma cacao]
 ref|XP_007026728.1| High mobility group B1 isoform 3 [Theobroma cacao]
 gb|EOY07225.1| High mobility group B1 isoform 3 [Theobroma cacao]
 gb|EOY07228.1| High mobility group B1 isoform 3 [Theobroma cacao]
 gb|EOY07230.1| High mobility group B1 isoform 3 [Theobroma cacao]
Length=177

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GEKWKSL+++EK  Y
Sbjct  55   RPPSAFFVFLEEFRATFKKENPNVKAVSAVGKAAGEKWKSLSEDEKAPY  103



>gb|KDO71478.1| hypothetical protein CISIN_1g031973mg [Citrus sinensis]
Length=150

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRK FKE +P+ KSVATV K  GEKWKS++++EK  +++
Sbjct  42   RPPSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVE  92



>gb|KDO71479.1| hypothetical protein CISIN_1g031973mg [Citrus sinensis]
Length=133

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRK FKE +P+ KSVATV K  GEKWKS++++EK  +++
Sbjct  42   RPPSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSEDEKAPFVE  92



>gb|KCW70329.1| hypothetical protein EUGRSUZ_F03571 [Eucalyptus grandis]
Length=134

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE++P+ KSVA V K GG+KWKSL+D+EK  YI
Sbjct  29   RPASAFFVFMEEFRKQYKEKHPNNKSVAAVGKAGGDKWKSLSDDEKAPYI  78



>ref|XP_006855734.1| hypothetical protein AMTR_s00044p00160130 [Amborella trichopoda]
 gb|ERN17201.1| hypothetical protein AMTR_s00044p00160130 [Amborella trichopoda]
Length=156

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRKTFKE++P+ KSVA V K GG+KWKSL++ EK  Y+
Sbjct  50   RPASAFFVFMEEFRKTFKEKHPNNKSVAAVGKAGGDKWKSLSEAEKAPYV  99



>ref|XP_009418293.1| PREDICTED: HMG1/2-like protein [Musa acuminata subsp. malaccensis]
Length=154

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKSL++ EK  Y+
Sbjct  45   RPASAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSLSEAEKAPYV  94



>ref|XP_009803525.1| PREDICTED: HMG1/2-like protein [Nicotiana sylvestris]
Length=141

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+ WK L+D EK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGDAWKKLSDAEKAPY  86



>gb|KHN38836.1| HMG1/2-like protein [Glycine soja]
Length=139

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFM EFR+ FK+E+P+ KSVA V K GGEKWKSL+D EK  ++
Sbjct  39   RPPSAFFVFMSEFREQFKKEHPNNKSVAVVGKAGGEKWKSLSDAEKAPFV  88



>ref|XP_010940219.1| PREDICTED: DNA-binding protein MNB1B-like [Elaeis guineensis]
Length=153

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKE+NP+ K V+ V K GG+KWKSL++ EK  Y+
Sbjct  46   RPPSAFFVFMEEFRKQFKEKNPNNKLVSVVGKAGGDKWKSLSEAEKAPYV  95



>ref|NP_001235312.1| uncharacterized protein LOC100499992 [Glycine max]
 gb|ACU14530.1| unknown [Glycine max]
Length=139

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFM EFR+ FK+E+P+ KSVA V K GGEKWKSL+D EK  ++
Sbjct  39   RPPSAFFVFMSEFREQFKKEHPNNKSVAVVGKAGGEKWKSLSDAEKAPFV  88



>emb|CDY31871.1| BnaC07g15210D [Brassica napus]
Length=163

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPASAFFVFMEDFRQTYKKEHPSNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_006848200.1| hypothetical protein AMTR_s00029p00240750 [Amborella trichopoda]
 gb|ERN09781.1| hypothetical protein AMTR_s00029p00240750 [Amborella trichopoda]
Length=167

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +KEE+P++K+V+ V K GGEKWKS++D EK
Sbjct  58   RPPSAFFVFLEEFRKIYKEEHPNVKAVSAVGKAGGEKWKSMSDAEK  103



>ref|XP_008812347.1| PREDICTED: DNA-binding protein MNB1B-like [Phoenix dactylifera]
Length=153

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKE+NP+ K V+ V K GG+KWKSL++ EK  Y+
Sbjct  46   RPPSAFFVFMEEFRKQFKEKNPNNKLVSVVGKAGGDKWKSLSEAEKAPYV  95



>gb|KDP24460.1| hypothetical protein JCGZ_25024 [Jatropha curcas]
Length=175

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP + +V+ V K GGEKWKS++  EK  Y
Sbjct  58   RPPSAFFVFLEEFRKTFKKENPHVTAVSAVGKAGGEKWKSMSPAEKAPY  106



>gb|KGN54377.1| hypothetical protein Csa_4G309150 [Cucumis sativus]
Length=169

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEYKRENPNVKAVSAVGKAGGEKWKSLSHAEKAPY  105



>gb|AFK36965.1| unknown [Medicago truncatula]
Length=170

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+E+FRKTFK ENP++K+V+ V K GG KWKSLT  EK  Y
Sbjct  53   RPPSAFFVFLEDFRKTFKAENPNVKAVSAVGKAGGGKWKSLTKAEKAPY  101



>ref|XP_004148621.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus]
Length=169

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEYKRENPNVKAVSAVGKAGGEKWKSLSHAEKAPY  105



>ref|NP_001031075.1| high mobility group B3 protein [Arabidopsis thaliana]
 gb|AEE30010.1| high mobility group B3 protein [Arabidopsis thaliana]
Length=147

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR T+KEE+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>gb|EMS67848.1| HMG1/2-like protein [Triticum urartu]
Length=190

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFM+ FRK +KE++PD+K V+ + K GGEKWKSL+D EK  Y
Sbjct  30   RPPSAFFVFMDTFRKEYKEKHPDVKQVSVIGKAGGEKWKSLSDAEKAPY  78



>ref|XP_004512268.1| PREDICTED: HMG1/2-like protein-like [Cicer arietinum]
Length=142

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFM EFR+TFK+ENPD KSVA V K GG++WKS++D +K  ++
Sbjct  40   RPPSAFFVFMSEFRETFKKENPDNKSVAVVGKAGGKEWKSMSDADKAPFV  89



>ref|NP_001031074.1| high mobility group B2 protein [Arabidopsis thaliana]
 ref|XP_002890401.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66660.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30007.1| high mobility group B2 protein [Arabidopsis thaliana]
Length=142

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+TFK+ENP  KSVATV K  G+KWKSL+D EK  Y+
Sbjct  40   RPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYV  89



>gb|EPS69148.1| hypothetical protein M569_05619, partial [Genlisea aurea]
Length=152

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRKT+KE++P+ KSVA V K GGEKWKS++  EK  Y+
Sbjct  47   RPASAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGEKWKSMSAAEKAPYV  96



>emb|CDP01791.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE++P+ KSVA V K GG+KWKS++D EK  YI
Sbjct  41   RPASAFFVFMEEFRKQYKEKHPNNKSVAAVGKAGGDKWKSMSDAEKAPYI  90



>gb|ABK21026.1| unknown [Picea sitchensis]
 gb|ABK22556.1| unknown [Picea sitchensis]
 gb|ABK22606.1| unknown [Picea sitchensis]
 gb|ABK22657.1| unknown [Picea sitchensis]
 gb|ABK22712.1| unknown [Picea sitchensis]
 gb|ABK26144.1| unknown [Picea sitchensis]
 gb|ABR16881.1| unknown [Picea sitchensis]
 gb|ACN40016.1| unknown [Picea sitchensis]
 gb|ACN40332.1| unknown [Picea sitchensis]
 gb|ACN41070.1| unknown [Picea sitchensis]
Length=157

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FRKT+KE+NP++KSV+ V K GG+KWKS+++ +K  Y+
Sbjct  54   RPASAFFVFMEDFRKTYKEKNPNVKSVSVVGKAGGDKWKSMSEADKAPYV  103



>ref|XP_008449957.1| PREDICTED: high mobility group B protein 1 [Cucumis melo]
 ref|XP_008449965.1| PREDICTED: high mobility group B protein 1 [Cucumis melo]
Length=170

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEYKRENPNVKAVSAVGKAGGEKWKSLSHAEKAPY  105



>ref|XP_011096978.1| PREDICTED: HMG1/2-like protein [Sesamum indicum]
Length=153

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWKSL++ EK  Y+
Sbjct  46   RPASAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGDKWKSLSEAEKAPYV  95



>ref|XP_010498507.1| PREDICTED: high mobility group B protein 2 [Camelina sativa]
 ref|XP_010459761.1| PREDICTED: high mobility group B protein 2 [Camelina sativa]
Length=144

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+TFK+ENP  KSVATV K  G+KWKSL+D EK  Y+
Sbjct  40   RPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYV  89



>ref|NP_001077569.1| high mobility group B2 protein [Arabidopsis thaliana]
 gb|AEE30008.1| high mobility group B2 protein [Arabidopsis thaliana]
Length=143

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+TFK+ENP  KSVATV K  G+KWKSL+D EK  Y+
Sbjct  40   RPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYV  89



>ref|NP_564123.1| high mobility group B2 protein [Arabidopsis thaliana]
 sp|O49596.1|HMGB2_ARATH RecName: Full=High mobility group B protein 2; AltName: Full=High 
mobility group protein B 1; Short=AtHMGbeta1; Short=HMG 
beta 1; AltName: Full=Nucleosome/chromatin assembly factor 
group D 02; Short=Nucleosome/chromatin assembly factor group 
D 2 [Arabidopsis thaliana]
 gb|AAK44063.1|AF370248_1 unknown protein [Arabidopsis thaliana]
 emb|CAA74401.1| HMG protein [Arabidopsis thaliana]
 gb|AAL34238.1| unknown protein [Arabidopsis thaliana]
 gb|AAM61305.1| unknown [Arabidopsis thaliana]
 dbj|BAC43146.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH30306.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30006.1| high mobility group B2 protein [Arabidopsis thaliana]
Length=144

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+TFK+ENP  KSVATV K  G+KWKSL+D EK  Y+
Sbjct  40   RPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYV  89



>ref|XP_008781302.1| PREDICTED: HMG1/2-like protein [Phoenix dactylifera]
Length=155

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKE+NP+ K V+ V K GG+KWKSL++ EK  Y+
Sbjct  46   RPPSAFFVFMEEFRKQFKEKNPNNKLVSVVGKAGGDKWKSLSEAEKAPYV  95



>ref|NP_564124.1| high mobility group B3 protein [Arabidopsis thaliana]
 sp|P93047.1|HMGB3_ARATH RecName: Full=High mobility group B protein 3; AltName: Full=High 
mobility group protein B 2; Short=AtHMGbeta2; Short=HMG 
beta 2; AltName: Full=Nucleosome/chromatin assembly factor 
group D 03; Short=Nucleosome/chromatin assembly factor group 
D 3 [Arabidopsis thaliana]
 gb|AAL06479.1|AF411789_1 At1g20690/F2D10_15 [Arabidopsis thaliana]
 emb|CAA70691.1| HMG1 [Arabidopsis thaliana]
 emb|CAA74402.1| HMG protein [Arabidopsis thaliana]
 gb|AAM19901.1| At1g20690/F2D10_15 [Arabidopsis thaliana]
 gb|AAM61413.1| unknown [Arabidopsis thaliana]
 gb|AAM96975.1| expressed protein [Arabidopsis thaliana]
 gb|AAN15739.1| expressed protein [Arabidopsis thaliana]
 gb|AEE30009.1| high mobility group B3 protein [Arabidopsis thaliana]
Length=141

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR T+KEE+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|NP_001267705.1| HMG1/2-like protein-like [Cucumis sativus]
 ref|XP_004159740.1| PREDICTED: HMG1/2-like protein-like [Cucumis sativus]
 ref|XP_008448477.1| PREDICTED: HMG1/2-like protein [Cucumis melo]
 gb|AAY26151.1| high mobility group protein [Cucumis sativus]
Length=146

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFRK +K+E+P+ KSVA V K GG+KWKS++D EK  YI+
Sbjct  40   RPASAFFVFMEEFRKQYKKEHPNNKSVAAVGKAGGDKWKSMSDAEKAPYIN  90



>ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis thaliana]
 gb|AEE30011.1| high mobility group B3 protein [Arabidopsis thaliana]
Length=140

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR T+KEE+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_007205402.1| hypothetical protein PRUPE_ppa007518mg [Prunus persica]
 gb|EMJ06601.1| hypothetical protein PRUPE_ppa007518mg [Prunus persica]
Length=365

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K VA V K GG+KWKSL+D EK  Y
Sbjct  241  RPPSAFFVFLEEFRKEFKKENPNVKGVAAVGKAGGDKWKSLSDAEKAPY  289



>ref|NP_001151148.1| LOC100284781 [Zea mays]
 gb|ACG41782.1| HMG1/2-like protein [Zea mays]
Length=127

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPT FFVFMEEFRK +KE++P++K V+ + K GG+ WKSL+D EK  Y+
Sbjct  30   RPPTTFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDMWKSLSDAEKAPYV  79



>ref|XP_010935409.1| PREDICTED: DNA-binding protein MNB1B-like [Elaeis guineensis]
Length=147

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKE+NP+ K V+ V K GG+KWKS++D +K  Y+
Sbjct  46   RPPSAFFVFMEEFRKQFKEKNPNNKLVSVVGKAGGDKWKSMSDADKAPYV  95



>ref|XP_006304292.1| hypothetical protein CARUB_v10010586mg [Capsella rubella]
 gb|EOA37190.1| hypothetical protein CARUB_v10010586mg [Capsella rubella]
Length=144

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR++FK+ENP+ KSVATV K  G+KWKSL+D EK  Y+
Sbjct  40   RPASAFFVFMEDFRESFKKENPNNKSVATVGKAAGDKWKSLSDSEKAPYV  89



>gb|ADO34793.1| high mobility group box 2 protein [Gossypium hirsutum]
Length=146

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GG+KWKSL++ EK+ Y+D
Sbjct  41   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGDKWKSLSEAEKRPYVD  91



>gb|KJB29491.1| hypothetical protein B456_005G114500 [Gossypium raimondii]
 gb|KJB29492.1| hypothetical protein B456_005G114500 [Gossypium raimondii]
Length=147

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GG+KWKSL++ EK+ Y+D
Sbjct  41   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGDKWKSLSEAEKRPYVD  91



>ref|XP_009804084.1| PREDICTED: HMG1/2-like protein [Nicotiana sylvestris]
Length=141

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP AFFVFMEEFRKT+KE++P+ KSVA V+K GG+ WK L+D EK  Y
Sbjct  38   RPPNAFFVFMEEFRKTYKEKHPNNKSVAAVSKAGGDAWKKLSDAEKAPY  86



>sp|P40619.1|HMGL_IPONI RecName: Full=HMG1/2-like protein [Ipomoea nil]
Length=144

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRKT+KE++P+ KSVA V K GG+KWK LT  EK  +I
Sbjct  38   RPPSAFFVFMEDFRKTYKEKHPNNKSVAVVGKAGGDKWKQLTAAEKAPFI  87



>ref|XP_002316220.1| hypothetical protein POPTR_0010s19720g [Populus trichocarpa]
 gb|EEF02391.1| hypothetical protein POPTR_0010s19720g [Populus trichocarpa]
Length=176

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSAAEKAPY  106



>ref|XP_007009011.1| High mobility group B1 isoform 2 [Theobroma cacao]
 gb|EOY17821.1| High mobility group B1 isoform 2 [Theobroma cacao]
Length=165

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RP TAFFVF+EEFRK +K+E+P +K+V+ V K GGEKWKSL+D EK  Y
Sbjct  58   RPATAFFVFLEEFRKIYKQEHPKVKAVSAVGKAGGEKWKSLSDAEKAPY  106



>ref|XP_006303878.1| hypothetical protein CARUB_v10012681mg [Capsella rubella]
 ref|XP_010498508.1| PREDICTED: high mobility group B protein 3 [Camelina sativa]
 ref|XP_010459760.1| PREDICTED: high mobility group B protein 3 [Camelina sativa]
 gb|EOA36776.1| hypothetical protein CARUB_v10012681mg [Capsella rubella]
Length=141

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPSSAFFVFMEDFRETYKKEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_010477319.1| PREDICTED: high mobility group B protein 3-like [Camelina sativa]
Length=141

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPSSAFFVFMEDFRETYKKEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_002270185.1| PREDICTED: high mobility group B protein 1 isoform X2 [Vitis 
vinifera]
Length=156

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL++ +K  Y
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPY  106



>ref|XP_010253860.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=166

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKT+K+++P++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  58   RPPSAFFVFLEEFRKTYKQDHPNVKAVSAVGKAGGEKWKSLSVAEKAPY  106



>dbj|BAJ33881.1| unnamed protein product [Thellungiella halophila]
Length=141

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RP +AFFVFMEEFR+T+K+E+P+ KSVA V K GG+KWKSL+D EK  Y
Sbjct  37   RPASAFFVFMEEFRETYKKEHPNNKSVAAVGKAGGQKWKSLSDSEKAPY  85



>ref|XP_004500864.1| PREDICTED: HMG1/2-like protein-like isoform X4 [Cicer arietinum]
Length=154

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRK F +ENPD ++V+ V K  G KWKSLTD EK  Y
Sbjct  47   RPPSAFFVFMEEFRKQFNKENPDNRAVSAVGKAAGAKWKSLTDAEKAPY  95



>ref|NP_001235556.1| uncharacterized protein LOC100305961 [Glycine max]
 gb|ACU13901.1| unknown [Glycine max]
Length=169

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AF VF+EEFRKTFK ENP +K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFLVFLEEFRKTFKAENPLVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66661.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+P  KSVA V K GGEKWKSL+D EK  Y+
Sbjct  39   RPSSAFFVFMEDFRETYKKEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYV  88



>ref|NP_001063869.1| Os09g0551600 [Oryza sativa Japonica Group]
 dbj|BAD33893.1| putative HMGd1 [Oryza sativa Japonica Group]
 dbj|BAF25783.1| Os09g0551600 [Oryza sativa Japonica Group]
 gb|ACJ54922.1| HMG type nucleosome/chromatin assembly factor [Oryza sativa Japonica 
Group]
 dbj|BAG90072.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRK +KE++P++K V+ + K GG+KWKS+TD +K  ++
Sbjct  30   RPPSAFFVFMEQFRKDYKEKHPNVKQVSVIGKAGGDKWKSMTDADKAPFV  79



>ref|XP_004500862.1| PREDICTED: HMG1/2-like protein-like isoform X2 [Cicer arietinum]
Length=163

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRK F +ENPD ++V+ V K  G KWKSLTD EK  Y
Sbjct  56   RPPSAFFVFMEEFRKQFNKENPDNRAVSAVGKAAGAKWKSLTDAEKAPY  104



>ref|XP_002269398.1| PREDICTED: high mobility group B protein 1 isoform X1 [Vitis 
vinifera]
 emb|CAN83423.1| hypothetical protein VITISV_023376 [Vitis vinifera]
Length=166

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL++ +K  Y
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPY  106



>gb|ABV48883.1| high mobility group protein B1 [Physcomitrella patens]
Length=215

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+A+F+FME FRK FK  NPD+K V   AK GGEKW S+++EEK  Y+
Sbjct  139  RPPSAYFIFMETFRKEFKAANPDVKGVTASAKAGGEKWLSMSEEEKAPYV  188



>ref|XP_008779789.1| PREDICTED: high mobility group B protein 1-like [Phoenix dactylifera]
Length=110

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTD  324
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL+D
Sbjct  58   RPPSAFFVFLEEFRKQYKQEHPNVKAVSVVGKAGGEKWKSLSD  100



>ref|XP_009759477.1| PREDICTED: HMG1/2-like protein [Nicotiana sylvestris]
Length=136

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFF+FM +FRK++KE  PD KSVA V K GGEKWK++++ EK  Y+
Sbjct  43   RPPTAFFIFMADFRKSYKENFPDNKSVAVVGKAGGEKWKAMSESEKAPYV  92



>emb|CDY33643.1| BnaC08g19430D [Brassica napus]
Length=145

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+P  KSVA V K GGEKWKSL+D EK  ++
Sbjct  40   RPASAFFVFMEDFRQTYKKEHPSNKSVAAVGKAGGEKWKSLSDSEKAPFV  89



>ref|XP_011035966.1| PREDICTED: high mobility group B protein 1 [Populus euphratica]
 ref|XP_011035967.1| PREDICTED: high mobility group B protein 1 [Populus euphratica]
Length=176

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  58   RPPSAFFVFLEEFRKIYKQEHPNVKAVSAVGKAGGEKWKSLSAAEKAPY  106



>ref|XP_002279947.2| PREDICTED: high mobility group B protein 1 isoform X2 [Vitis 
vinifera]
 ref|XP_010654163.1| PREDICTED: high mobility group B protein 1 isoform X2 [Vitis 
vinifera]
 emb|CAN74566.1| hypothetical protein VITISV_023651 [Vitis vinifera]
 emb|CBI30396.3| unnamed protein product [Vitis vinifera]
Length=168

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEE  318
            RPP+AFFVF+EEFRK FK+ENP++K+V+ V K GGE+WKSL++ E
Sbjct  58   RPPSAFFVFLEEFRKVFKKENPNVKAVSAVGKAGGERWKSLSEAE  102



>ref|XP_010654160.1| PREDICTED: high mobility group B protein 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010654161.1| PREDICTED: high mobility group B protein 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010654162.1| PREDICTED: high mobility group B protein 1 isoform X1 [Vitis 
vinifera]
Length=169

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEE  318
            RPP+AFFVF+EEFRK FK+ENP++K+V+ V K GGE+WKSL++ E
Sbjct  58   RPPSAFFVFLEEFRKVFKKENPNVKAVSAVGKAGGERWKSLSEAE  102



>gb|ADO34794.1| high mobility group box 4 protein [Gossypium hirsutum]
Length=148

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GGEKWKSL+D EK  YI
Sbjct  41   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGEKWKSLSDAEKAPYI  90



>ref|XP_004953412.1| PREDICTED: HMG1/2-like protein-like [Setaria italica]
Length=142

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFM EFR+ ++ ++PD KSVA V+K  GEKW+++++EEK+ Y+D
Sbjct  35   RPPSAFFVFMSEFRQEYQAQHPDNKSVAAVSKAAGEKWRAMSEEEKQPYVD  85



>ref|XP_004500863.1| PREDICTED: HMG1/2-like protein-like isoform X3 [Cicer arietinum]
Length=162

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRK F +ENPD ++V+ V K  G KWKSLTD EK  Y
Sbjct  47   RPPSAFFVFMEEFRKQFNKENPDNRAVSAVGKAAGAKWKSLTDAEKAPY  95



>ref|XP_009589000.1| PREDICTED: HMG1/2-like protein [Nicotiana tomentosiformis]
Length=136

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPPTAFF+FM +FRK++KE  PD KSVA V K GGEKWK++++ EK  Y+
Sbjct  43   RPPTAFFIFMADFRKSYKENFPDNKSVAVVGKAGGEKWKAMSESEKAPYV  92



>gb|KHN38869.1| HMG1/2-like protein [Glycine soja]
Length=142

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFM EFR+ FK+E+P+ KSVA V K GG+KWKSL+D EK  ++
Sbjct  39   RPPSAFFVFMSEFREQFKKEHPNNKSVAVVGKAGGDKWKSLSDAEKAPFV  88



>gb|KJB29495.1| hypothetical protein B456_005G114500, partial [Gossypium raimondii]
Length=199

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GG+KWKSL++ EK+ Y+D
Sbjct  94   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGDKWKSLSEAEKRPYVD  144



>ref|XP_004500861.1| PREDICTED: HMG1/2-like protein-like isoform X1 [Cicer arietinum]
Length=171

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRK F +ENPD ++V+ V K  G KWKSLTD EK  Y
Sbjct  56   RPPSAFFVFMEEFRKQFNKENPDNRAVSAVGKAAGAKWKSLTDAEKAPY  104



>gb|KJB36899.1| hypothetical protein B456_006G181900 [Gossypium raimondii]
Length=142

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GE WKS+++EEK  Y
Sbjct  48   RPPSAFFVFLEEFRTTFKKENPNVKAVSAVGKAAGEMWKSMSEEEKGPY  96



>gb|KJB12028.1| hypothetical protein B456_002G263800 [Gossypium raimondii]
 gb|KJB12029.1| hypothetical protein B456_002G263800 [Gossypium raimondii]
Length=172

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GE WKS+++EEK  Y
Sbjct  55   RPPSAFFVFLEEFRGTFKKENPNVKAVSAVGKAAGEMWKSMSEEEKAPY  103



>gb|KJB29494.1| hypothetical protein B456_005G114500, partial [Gossypium raimondii]
Length=207

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GG+KWKSL++ EK+ Y+D
Sbjct  94   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGDKWKSLSEAEKRPYVD  144



>ref|XP_003578598.1| PREDICTED: HMG1/2-like protein [Brachypodium distachyon]
Length=128

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME FRK +KE++PD+K V+ V K GG +WKSL+D EK  ++
Sbjct  30   RPPSAFFVFMEGFRKDYKEKHPDVKQVSVVGKAGGAEWKSLSDAEKAPFV  79



>gb|AEX55234.1| HMG transcription factor [Allium sativum]
Length=115

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFME+FRK FKE+NPD K V+ V K  G+KWKSLT  EK  Y
Sbjct  4    RPPSAFFVFMEDFRKIFKEKNPDNKQVSAVGKAAGDKWKSLTAAEKAPY  52



>ref|XP_004234511.1| PREDICTED: HMG1/2-like protein [Solanum lycopersicum]
Length=139

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FRK +KE++P  KSVA V K GG+KWK LTD EK  YI
Sbjct  38   RPASAFFVFMEDFRKQYKEKHPGNKSVAAVGKAGGDKWKHLTDAEKAPYI  87



>ref|XP_010550497.1| PREDICTED: high mobility group B protein 4-like [Tarenaya hassleriana]
Length=142

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVF++EFRK F EENP  KSVA V K  G KWKS++D EK  Y+
Sbjct  36   RPPSAFFVFLDEFRKQFNEENPGNKSVAAVGKAAGNKWKSMSDAEKTPYV  85



>gb|EMT15409.1| HMG1/2-like protein [Aegilops tauschii]
Length=139

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFM EFR+ +  ENP+ KSVA V+K  GEKW++++DEEK  Y++
Sbjct  36   RPPSAFFVFMSEFRQQYNAENPNNKSVANVSKAAGEKWRAMSDEEKAPYVE  86



>ref|XP_006343329.1| PREDICTED: HMG1/2-like protein-like [Solanum tuberosum]
Length=139

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FRK +KE++P  KSVA V K GG+KWK LTD EK  YI
Sbjct  38   RPASAFFVFMEDFRKQYKEKHPGNKSVAAVGKAGGDKWKHLTDAEKAPYI  87



>gb|KJB36900.1| hypothetical protein B456_006G181900 [Gossypium raimondii]
Length=148

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GE WKS+++EEK  Y
Sbjct  48   RPPSAFFVFLEEFRTTFKKENPNVKAVSAVGKAAGEMWKSMSEEEKGPY  96



>ref|XP_004957577.1| PREDICTED: HMG1/2-like protein-like [Setaria italica]
Length=126

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL++ EK  ++
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSEAEKAPFV  79



>gb|KJB29493.1| hypothetical protein B456_005G114500, partial [Gossypium raimondii]
Length=200

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFR+ +K+E+P  KSVA V K GG+KWKSL++ EK+ Y+D
Sbjct  94   RPASAFFVFMEEFREQYKKEHPKNKSVAAVGKAGGDKWKSLSEAEKRPYVD  144



>ref|XP_006364026.1| PREDICTED: HMG1/2-like protein-like [Solanum tuberosum]
Length=108

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +A+F+FMEEFRK F+E NP IKS+A V K GG KWK ++D EK  YI
Sbjct  23   RPTSAYFIFMEEFRKQFRELNPSIKSIAVVGKAGGSKWKQMSDAEKAPYI  72



>emb|CDY65900.1| BnaCnng49050D [Brassica napus]
Length=144

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+++P+ KSVA V K GG KWKSL+D EK  Y+
Sbjct  39   RPSSAFFVFMEDFRQTYKKDHPNNKSVAAVGKAGGHKWKSLSDTEKAPYV  88



>ref|XP_009590625.1| PREDICTED: HMG1/2-like protein [Nicotiana tomentosiformis]
 gb|AAB61215.1| DNA-binding protein [Nicotiana tabacum]
Length=142

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+ WK L++ EK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGDAWKKLSEAEKAPY  86



>ref|XP_006416372.1| hypothetical protein EUTSA_v10009371mg [Eutrema salsugineum]
 gb|ESQ34725.1| hypothetical protein EUTSA_v10009371mg [Eutrema salsugineum]
Length=200

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RP +AFFVFMEEFR+T+K+E+P+ KSVA V K GG+KWKSL+D EK  Y
Sbjct  96   RPASAFFVFMEEFRETYKKEHPNNKSVAAVGKAGGQKWKSLSDSEKAPY  144



>gb|KHG02391.1| High mobility group B 1 -like protein [Gossypium arboreum]
Length=150

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR TFK+ENP++K+V+ V K  GE WKS+++EEK  Y
Sbjct  48   RPPSAFFVFLEEFRTTFKKENPNVKAVSAVGKAAGEMWKSMSEEEKGPY  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395