BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF015B03

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAC98299.1|  LEXYL2                                                 160   2e-42   Solanum lycopersicum
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   5e-42   
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    159   2e-41   Solanum tuberosum [potatoes]
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    156   1e-40   Nicotiana tomentosiformis
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    156   2e-40   Nicotiana sylvestris
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   3e-40   Solanum tuberosum [potatoes]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      153   2e-39   Solanum lycopersicum
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    151   9e-39   Sesamum indicum [beniseed]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    151   9e-39   Nicotiana tomentosiformis
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                     149   2e-38   Eucalyptus grandis [rose gum]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    150   2e-38   Nicotiana sylvestris
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   5e-38   Sesamum indicum [beniseed]
emb|CAN78858.1|  hypothetical protein VITISV_030325                     147   1e-37   Vitis vinifera
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    148   1e-37   
emb|CBI20072.3|  unnamed protein product                                143   1e-37   Vitis vinifera
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    147   3e-37   Sesamum indicum [beniseed]
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         147   3e-37   Jatropha curcas
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    147   4e-37   Eucalyptus grandis [rose gum]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    146   7e-37   Fragaria vesca subsp. vesca
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             146   7e-37   Prunus persica
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    145   1e-36   Prunus mume [ume]
emb|CDO97479.1|  unnamed protein product                                144   2e-36   Coffea canephora [robusta coffee]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    145   2e-36   Fragaria vesca subsp. vesca
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    144   2e-36   Eucalyptus grandis [rose gum]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    144   4e-36   
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                143   6e-36   Erythranthe guttata [common monkey flower]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    143   9e-36   
gb|KJB31997.1|  hypothetical protein B456_005G218000                    141   1e-35   Gossypium raimondii
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                142   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    142   2e-35   Fragaria vesca subsp. vesca
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    142   2e-35   Vitis vinifera
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    141   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    140   6e-35   Vitis vinifera
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    140   7e-35   Eucalyptus grandis [rose gum]
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    140   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   1e-34   
ref|XP_002298197.2|  beta-glucosidase family protein                    139   1e-34   
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   2e-34   Populus euphratica
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                    138   2e-34   Eucalyptus grandis [rose gum]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                139   2e-34   Erythranthe guttata [common monkey flower]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                139   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   2e-34   Elaeis guineensis
ref|XP_007043027.1|  Beta-D-xylosidase 4                                139   2e-34   
gb|KJB31996.1|  hypothetical protein B456_005G218000                    137   3e-34   Gossypium raimondii
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   3e-34   Eucalyptus grandis [rose gum]
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   3e-34   Citrus sinensis [apfelsine]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    138   4e-34   Eucalyptus grandis [rose gum]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             138   5e-34   Citrus clementina [clementine]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           138   6e-34   Gossypium arboreum [tree cotton]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    137   1e-33   Gossypium raimondii
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        137   2e-33   Medicago truncatula
ref|XP_002303181.1|  beta-glucosidase family protein                    136   3e-33   
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              135   3e-33   Populus tremula x Populus alba [gray poplar]
ref|XP_009407358.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   3e-33   
gb|ACL53913.1|  unknown                                                 132   4e-33   Zea mays [maize]
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                135   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010068199.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    133   5e-33   Eucalyptus grandis [rose gum]
gb|AFW59618.1|  putative O-Glycosyl hydrolase superfamily protein       132   7e-33   
ref|NP_001146416.1|  uncharacterized protein LOC100279996               132   9e-33   
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   1e-32   Nelumbo nucifera [Indian lotus]
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           133   1e-32   Glycine soja [wild soybean]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   2e-32   Populus euphratica
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...    133   2e-32   Zea mays [maize]
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    134   2e-32   Populus euphratica
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           132   2e-32   Glycine soja [wild soybean]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    133   2e-32   
dbj|BAK03439.1|  predicted protein                                      132   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      133   3e-32   Morus notabilis
dbj|BAJ90315.1|  predicted protein                                      133   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90420.1|  predicted protein                                      133   3e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    132   4e-32   
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   4e-32   Cicer arietinum [garbanzo]
ref|XP_002513707.1|  Beta-glucosidase, putative                         132   6e-32   Ricinus communis
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          132   6e-32   Sorghum bicolor [broomcorn]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   6e-32   
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    132   7e-32   Medicago sativa subsp. x varia
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   8e-32   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    132   1e-31   
ref|NP_001054038.1|  Os04g0640700                                       131   1e-31   
dbj|BAD94522.1|  beta-xylosidase - like protein                         127   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|EEE61783.1|  hypothetical protein OsJ_16354                          131   1e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03635.1|  OSJNBb0003B01.27                                       131   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     131   2e-31   
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    130   3e-31   Nelumbo nucifera [Indian lotus]
dbj|BAK01582.1|  predicted protein                                      130   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    129   5e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    129   7e-31   Hordeum vulgare [barley]
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                129   8e-31   
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           128   9e-31   Glycine soja [wild soybean]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             129   1e-30   Phaseolus vulgaris [French bean]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    128   2e-30   Glycine max [soybeans]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             127   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   3e-30   Glycine max [soybeans]
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                127   3e-30   Brachypodium distachyon [annual false brome]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             127   4e-30   Eutrema salsugineum [saltwater cress]
ref|NP_196535.1|  beta-xylosidase 3                                     127   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                127   4e-30   Brassica rapa
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     126   8e-30   Setaria italica
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     125   1e-29   Camelina sativa [gold-of-pleasure]
emb|CDX97115.1|  BnaC09g45100D                                          125   1e-29   
dbj|BAD94481.1|  beta-xylosidase                                        123   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                125   1e-29   Brassica rapa
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    125   2e-29   Glycine max [soybeans]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          125   2e-29   Amborella trichopoda
emb|CBI40687.3|  unnamed protein product                                124   3e-29   Vitis vinifera
emb|CDY35825.1|  BnaC09g37570D                                          124   3e-29   Brassica napus [oilseed rape]
emb|CDY31313.1|  BnaA02g34280D                                          124   3e-29   Brassica napus [oilseed rape]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    124   4e-29   Medicago truncatula
gb|KCW63060.1|  hypothetical protein EUGRSUZ_G00652                     122   4e-29   Eucalyptus grandis [rose gum]
ref|XP_002866623.1|  beta-xylosidase 4                                  124   5e-29   Arabidopsis lyrata subsp. lyrata
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    124   5e-29   Medicago sativa subsp. x varia
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    124   5e-29   Cicer arietinum [garbanzo]
ref|NP_201262.1|  beta-D-xylosidase 4                                   124   7e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01780.1|  BnaC06g28200D                                          123   7e-29   
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             123   9e-29   Phaseolus vulgaris [French bean]
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    123   9e-29   Arabis alpina [alpine rockcress]
emb|CDX69892.1|  BnaA10g22410D                                          123   1e-28   
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     123   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                123   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002873418.1|  beta-xylosidase 3                                  121   4e-28   Arabidopsis lyrata subsp. lyrata
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    121   4e-28   Arabis alpina [alpine rockcress]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                121   5e-28   Camelina sativa [gold-of-pleasure]
emb|CDY18705.1|  BnaA09g06900D                                          120   8e-28   Brassica napus [oilseed rape]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                120   8e-28   Brassica rapa
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           120   1e-27   Gossypium arboreum [tree cotton]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    120   1e-27   Gossypium raimondii
emb|CDY46812.1|  BnaC02g43200D                                          120   1e-27   Brassica napus [oilseed rape]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             120   1e-27   Capsella rubella
emb|CDX81229.1|  BnaC09g06400D                                          118   7e-27   
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     117   8e-27   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          117   8e-27   Brassica napus [oilseed rape]
emb|CDY51290.1|  BnaA06g23560D                                          117   9e-27   Brassica napus [oilseed rape]
emb|CAB89360.1|  beta-glucosidase-like protein                          114   1e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            117   1e-26   Raphanus sativus
emb|CDX96113.1|  BnaA07g26180D                                          117   1e-26   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     117   2e-26   Tarenaya hassleriana [spider flower]
ref|NP_196532.2|  Glycosyl hydrolase family protein                     114   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ACH60354.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           107   3e-26   Pseudotsuga menziesii
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                115   3e-26   Brassica rapa
gb|EPS65933.1|  hypothetical protein M569_08842                         115   6e-26   Genlisea aurea
gb|ACH60351.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           105   3e-25   Pseudotsuga menziesii
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                110   4e-24   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                106   6e-23   Camelina sativa [gold-of-pleasure]
gb|AFG54601.1|  hypothetical protein 0_6952_01                        99.4    9e-23   Pinus taeda
gb|AFG54595.1|  hypothetical protein 0_6952_01                        99.4    9e-23   Pinus taeda
gb|AFG54602.1|  hypothetical protein 0_6952_01                        99.0    1e-22   Pinus taeda
gb|AFG54596.1|  hypothetical protein 0_6952_01                        96.3    1e-21   Pinus taeda
emb|CDY21595.1|  BnaC09g46970D                                          101   4e-21   Brassica napus [oilseed rape]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              101   4e-21   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase            99.8    1e-20   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase            99.8    2e-20   
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase            99.8    2e-20   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor             98.6    3e-20   Malus domestica [apple tree]
emb|CDP17082.1|  unnamed protein product                              92.8    1e-19   Coffea canephora [robusta coffee]
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase            97.1    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase            96.7    2e-19   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                   96.7    2e-19   Eucalyptus grandis [rose gum]
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative           95.9    3e-19   
dbj|BAF79669.1|  beta-D-xylosidase                                    95.1    6e-19   Pyrus pyrifolia [sha li]
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2       94.7    7e-19   Pyrus x bretschneideri [bai li]
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase      94.7    7e-19   Pyrus pyrifolia [sha li]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                          94.0    1e-18   Glycine soja [wild soybean]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like     94.0    1e-18   Glycine max [soybeans]
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like     93.6    2e-18   Solanum tuberosum [potatoes]
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg           93.2    3e-18   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120        92.8    3e-18   Amborella trichopoda
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2          92.8    4e-18   Nelumbo nucifera [Indian lotus]
emb|CDO98788.1|  unnamed protein product                              92.4    4e-18   Coffea canephora [robusta coffee]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2          92.4    4e-18   Nicotiana tomentosiformis
ref|XP_002316021.1|  beta-D-xylosidase family protein                 92.4    5e-18   Populus trichocarpa [western balsam poplar]
gb|KDO71842.1|  hypothetical protein CISIN_1g0062242mg                89.7    6e-18   Citrus sinensis [apfelsine]
gb|ABK96385.1|  unknown                                               89.4    6e-18   Populus trichocarpa x Populus deltoides
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg           92.0    7e-18   Citrus clementina [clementine]
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                     92.0    7e-18   Solanum lycopersicum
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase            91.7    1e-17   Populus euphratica
gb|AEW09080.1|  hypothetical protein CL3618Contig1_02                 84.7    1e-17   Pinus lambertiana
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2          91.3    1e-17   Populus euphratica
gb|KDO71849.1|  hypothetical protein CISIN_1g0062242mg                89.4    1e-17   Citrus sinensis [apfelsine]
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase            91.3    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010094323.1|  Beta-D-xylosidase 1                              90.9    1e-17   Morus notabilis
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg              90.9    1e-17   Erythranthe guttata [common monkey flower]
gb|KDO71844.1|  hypothetical protein CISIN_1g0062242mg                89.7    2e-17   Citrus sinensis [apfelsine]
gb|KDO71843.1|  hypothetical protein CISIN_1g0062242mg                89.7    2e-17   Citrus sinensis [apfelsine]
gb|KDO71845.1|  hypothetical protein CISIN_1g0062242mg                89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2          90.5    2e-17   Nicotiana sylvestris
ref|XP_010652235.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  90.1    2e-17   Vitis vinifera
gb|KJB38535.1|  hypothetical protein B456_006G259500                  90.1    3e-17   Gossypium raimondii
gb|KJB49844.1|  hypothetical protein B456_008G140600                  90.1    3e-17   Gossypium raimondii
gb|AEW09079.1|  hypothetical protein CL3618Contig1_02                 83.2    3e-17   Pinus radiata
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase            89.7    4e-17   Populus euphratica
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  89.7    4e-17   Vitis vinifera
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    5e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    5e-17   Glycine max [soybeans]
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    5e-17   Camelina sativa [gold-of-pleasure]
gb|KDO87030.1|  hypothetical protein CISIN_1g0041901mg                89.0    5e-17   Citrus sinensis [apfelsine]
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    6e-17   Sesamum indicum [beniseed]
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2          89.4    6e-17   Brassica rapa
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2          89.0    7e-17   Populus euphratica
ref|XP_006306830.1|  hypothetical protein CARUB_v10008371mg           88.6    7e-17   
emb|CDX89954.1|  BnaA10g01280D                                        89.0    8e-17   
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g           89.0    8e-17   
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2          88.6    9e-17   Populus euphratica
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222           88.6    1e-16   
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                     88.6    1e-16   Gossypium arboreum [tree cotton]
emb|CDY15255.1|  BnaC05g01340D                                        88.2    1e-16   Brassica napus [oilseed rape]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2          88.2    1e-16   Camelina sativa [gold-of-pleasure]
gb|KHG28205.1|  putative beta-D-xylosidase 2 -like protein            87.4    1e-16   Gossypium arboreum [tree cotton]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like              87.8    2e-16   Cucumis sativus [cucumbers]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg           87.4    2e-16   Eutrema salsugineum [saltwater cress]
gb|ADV41671.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.4    2e-16   Actinidia deliciosa var. deliciosa
ref|XP_010087253.1|  putative beta-D-xylosidase 2                     87.4    2e-16   Morus notabilis
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase            87.4    2e-16   Prunus mume [ume]
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase            87.4    3e-16   Vitis vinifera
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.4    3e-16   Prunus salicina [Japanese plum]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase         87.4    3e-16   Prunus salicina [Japanese plum]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg           87.0    3e-16   Capsella rubella
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein            87.0    3e-16   Gossypium arboreum [tree cotton]
gb|KJB72795.1|  hypothetical protein B456_011G198200                  87.0    3e-16   Gossypium raimondii
gb|KDP28242.1|  hypothetical protein JCGZ_14013                       87.0    3e-16   Jatropha curcas
gb|AFG60329.1|  hypothetical protein CL3618Contig1_02                 80.5    4e-16   Pinus taeda
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2          86.7    4e-16   Sesamum indicum [beniseed]
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                     86.7    5e-16   
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g           86.3    6e-16   
ref|XP_010313018.1|  PREDICTED: slArf/Xyl1 protein isoform X1         85.9    6e-16   Solanum lycopersicum
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                   85.9    7e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  85.9    7e-16   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  85.9    7e-16   
ref|NP_563659.1|  probable beta-D-xylosidase 2                        85.9    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg           85.9    8e-16   Prunus persica
gb|AAG10624.1|AC022521_2  Similar to xylosidase                       85.9    8e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09457.1|  hypothetical protein B456_001G143600                  85.9    8e-16   Gossypium raimondii
gb|ACD93208.1|  beta xylosidase                                       85.9    8e-16   Camellia sinensis [black tea]
ref|XP_007051080.1|  Beta-xylosidase 2                                85.9    9e-16   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                       85.5    1e-15   Jatropha curcas
ref|XP_002311398.2|  beta-D-xylosidase family protein                 85.5    1e-15   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2          85.1    1e-15   Cucumis melo [Oriental melon]
ref|XP_004172482.1|  PREDICTED: beta-D-xylosidase 1-like              84.7    1e-15   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2          85.1    1e-15   Tarenaya hassleriana [spider flower]
emb|CBI22910.3|  unnamed protein product                              85.1    1e-15   Vitis vinifera
dbj|BAF43576.1|  arabinofuranosidase/xylosidase homolog               82.4    2e-15   Prunus persica
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like              84.3    3e-15   Solanum tuberosum [potatoes]
ref|XP_002515300.1|  Beta-glucosidase, putative                       84.3    3e-15   Ricinus communis
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                  83.6    4e-15   Arabis alpina [alpine rockcress]
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g           83.6    4e-15   Phaseolus vulgaris [French bean]
sp|P83344.1|XYNB_PRUPE  RecName: Full=Putative beta-D-xylosidase;...  82.4    5e-15   Prunus persica
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg           83.6    5e-15   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like     83.2    6e-15   Cucumis sativus [cucumbers]
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  83.2    6e-15   
dbj|BAC41913.1|  putative beta-xylosidase                             83.2    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2          83.2    7e-15   Pyrus x bretschneideri [bai li]
emb|CAJ41429.1|  beta (1,4)-xylosidase                                82.8    7e-15   Populus tremula x Populus alba [gray poplar]
ref|NP_196618.1|  putative beta-D-xylosidase 6                        82.8    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2          82.4    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g           82.4    1e-14   Phaseolus vulgaris [French bean]
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2          82.4    1e-14   Eucalyptus grandis [rose gum]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2          82.4    1e-14   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6          82.4    1e-14   
gb|KCW58371.1|  hypothetical protein EUGRSUZ_H010551                  82.0    1e-14   Eucalyptus grandis [rose gum]
ref|XP_001784462.1|  predicted protein                                82.0    2e-14   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg           82.0    2e-14   Eutrema salsugineum [saltwater cress]
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                  81.6    2e-14   Arabis alpina [alpine rockcress]
dbj|BAJ51947.1|  putative beta-D-xylosidase                           79.0    2e-14   Glycyrrhiza uralensis [Chinese licorice]
gb|AAS17751.2|  beta xylosidase                                       81.3    2e-14   Fragaria x ananassa
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase            81.3    3e-14   Fragaria vesca subsp. vesca
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2          81.3    3e-14   Fragaria vesca subsp. vesca
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...  81.3    3e-14   Ricinus communis
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2          80.9    3e-14   Elaeis guineensis
ref|XP_003625957.1|  Beta-xylosidase                                  80.5    6e-14   Medicago truncatula
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein              80.1    7e-14   Arabidopsis lyrata subsp. lyrata
dbj|BAO45878.1|  beta-D-xylosidase                                    79.7    8e-14   Acacia mangium
emb|CDX97026.1|  BnaC09g45990D                                        79.7    8e-14   
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                   79.3    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1   79.3    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_003591420.1|  Beta xylosidase                                  79.3    1e-13   Medicago truncatula
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6          79.3    1e-13   Camelina sativa [gold-of-pleasure]
gb|KHN14659.1|  Beta-D-xylosidase 1                                   79.0    2e-13   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6          79.0    2e-13   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like              78.6    2e-13   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like              78.6    2e-13   
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6          78.6    2e-13   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg              78.2    3e-13   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase        78.2    3e-13   
emb|CDY49607.1|  BnaA09g03310D                                        77.8    4e-13   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1        77.8    4e-13   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6          77.8    5e-13   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2          77.4    5e-13   
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like              77.4    5e-13   
emb|CDX69822.1|  BnaA10g21710D                                        77.4    5e-13   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                          77.0    7e-13   
gb|KHN12900.1|  Beta-D-xylosidase 1                                   77.0    8e-13   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like     77.0    8e-13   
gb|KJB44020.1|  hypothetical protein B456_007G230000                  77.0    8e-13   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like              77.0    8e-13   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like     76.6    1e-12   
ref|XP_010442400.1|  PREDICTED: beta-D-xylosidase 1-like              76.3    1e-12   
gb|AAP83934.1|  auxin-induced beta-glucosidase                        76.3    1e-12   
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  76.3    1e-12   
ref|XP_009609889.1|  PREDICTED: putative beta-D-xylosidase            75.5    1e-12   
emb|CDX85405.1|  BnaC07g27160D                                        75.9    2e-12   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg           75.9    2e-12   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2          75.9    2e-12   
dbj|BAF02134.1|  xylosidase                                           73.2    2e-12   
emb|CDY05634.1|  BnaC02g39030D                                        75.5    3e-12   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5          75.1    3e-12   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6          75.1    3e-12   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                  75.1    3e-12   
gb|ABY48135.1|  beta-D-xylosidase                                     75.1    3e-12   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like              75.1    3e-12   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5          74.7    4e-12   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like     74.7    4e-12   
ref|XP_003612944.1|  Beta-D-xylosidase                                74.7    4e-12   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102            74.3    5e-12   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like              74.3    5e-12   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg           74.3    5e-12   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                74.3    6e-12   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                     74.3    6e-12   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  74.3    6e-12   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...  74.3    6e-12   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                       73.9    7e-12   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like     73.9    7e-12   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733           73.9    7e-12   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg           73.9    8e-12   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like     73.9    8e-12   
gb|KHN38910.1|  Putative beta-D-xylosidase 6                          73.6    8e-12   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                 73.6    9e-12   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like              73.6    9e-12   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                   73.6    9e-12   
emb|CBI25718.3|  unnamed protein product                              73.6    1e-11   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                 73.6    1e-11   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6          73.6    1e-11   
gb|KHN43468.1|  Putative beta-D-xylosidase 2                          73.6    1e-11   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like     73.6    1e-11   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg           73.6    1e-11   
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like     73.6    1e-11   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6          73.2    1e-11   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                   73.2    1e-11   
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                   73.2    1e-11   
ref|XP_002865732.1|  beta-xylosidase 1                                72.8    2e-11   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like              72.8    2e-11   
emb|CDY33913.1|  BnaA02g30740D                                        72.8    2e-11   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g           72.8    2e-11   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...  72.8    2e-11   
ref|XP_001775759.1|  predicted protein                                72.4    3e-11   
emb|CDY00033.1|  BnaC09g02680D                                        72.0    3e-11   
gb|AFK46503.1|  unknown                                               68.6    4e-11   
emb|CDO97277.1|  unnamed protein product                              72.0    4e-11   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g           71.6    4e-11   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                     71.6    4e-11   
gb|KHG29436.1|  putative beta-D-xylosidase 5 -like protein            70.9    4e-11   
dbj|BAG28345.1|  arabinofuranosidase                                  71.6    4e-11   
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6          71.6    5e-11   
ref|XP_002527213.1|  Thermostable beta-glucosidase B, putative        70.5    6e-11   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6          71.2    6e-11   
gb|AHA84291.1|  beta-D-xylosidase                                     67.8    7e-11   
ref|NP_001053392.1|  Os04g0530700                                     70.9    7e-11   
emb|CAJ86207.1|  B1011H02.4                                           70.9    7e-11   
gb|KGN48676.1|  hypothetical protein Csa_6G497270                     70.9    7e-11   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.9    8e-11   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.9    8e-11   
gb|EEE61389.1|  hypothetical protein OsJ_15562                        70.9    8e-11   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...  70.5    1e-10   
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like     70.5    1e-10   
emb|CDP20993.1|  unnamed protein product                              65.1    1e-10   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6          70.5    1e-10   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...  70.1    1e-10   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6          69.7    2e-10   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like     69.3    2e-10   
ref|XP_003594795.1|  Beta xylosidase                                  69.3    2e-10   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5          68.9    3e-10   
gb|KHN24914.1|  Putative beta-D-xylosidase 7                          68.6    3e-10   
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440        68.2    5e-10   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                68.2    5e-10   
gb|EPS60429.1|  hypothetical protein M569_14372                       68.2    5e-10   
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6          68.2    5e-10   
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140        68.2    6e-10   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like     67.8    6e-10   
ref|XP_002448225.1|  hypothetical protein SORBIDRAFT_06g023450        67.8    7e-10   
ref|XP_002527511.1|  Beta-glucosidase, putative                       67.8    7e-10   
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  67.8    7e-10   
gb|KDP44489.1|  hypothetical protein JCGZ_16322                       67.8    7e-10   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6          67.8    8e-10   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6          67.4    9e-10   
emb|CDP02677.1|  unnamed protein product                              67.4    1e-09   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg           67.0    1e-09   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                 67.0    1e-09   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g           67.0    1e-09   
ref|XP_009390582.1|  PREDICTED: probable beta-D-xylosidase 7          67.0    1e-09   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...  67.0    1e-09   
gb|KJB77632.1|  hypothetical protein B456_012G147500                  67.0    1e-09   
gb|ACG29242.1|  auxin-induced beta-glucosidase                        66.6    2e-09   
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5          66.2    2e-09   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like              66.2    2e-09   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...  66.2    2e-09   
gb|AES97966.2|  glycoside hydrolase family 3 protein                  65.9    3e-09   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                        65.9    3e-09   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg           65.9    3e-09   
emb|CAN82161.1|  hypothetical protein VITISV_035506                   65.9    3e-09   
gb|KHN26079.1|  Putative beta-D-xylosidase 7                          65.9    3e-09   
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7          65.9    3e-09   
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6          65.9    3e-09   
ref|XP_007141155.1|  hypothetical protein PHAVU_008G171800g           63.9    4e-09   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like     65.5    4e-09   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  65.1    5e-09   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like     65.1    5e-09   
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                 64.7    7e-09   
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like     64.7    7e-09   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg           64.7    7e-09   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  64.7    7e-09   
ref|XP_002885319.1|  beta-1,4-xylosidase                              64.7    8e-09   
ref|NP_001167905.1|  uncharacterized protein LOC100381616             64.3    8e-09   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...  64.7    8e-09   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like     64.7    8e-09   
tpg|DAA36709.1|  TPA: putative O-Glycosyl hydrolase superfamily p...  64.3    9e-09   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg           64.3    9e-09   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                        64.3    1e-08   
dbj|BAJ94317.1|  predicted protein                                    64.3    1e-08   
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7          63.9    1e-08   
ref|XP_010914750.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  63.5    2e-08   
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206           63.5    2e-08   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5          63.5    2e-08   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2        63.5    2e-08   
ref|XP_007035964.1|  Glycosyl hydrolase family protein                63.5    2e-08   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5          63.2    2e-08   
gb|AFI25186.1|  putative beta-D-xylosidase                            63.2    2e-08   
gb|EMS60786.1|  putative beta-D-xylosidase 6                          63.2    2e-08   
ref|XP_004976327.1|  PREDICTED: probable beta-D-xylosidase 6-like     60.8    3e-08   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400        62.8    3e-08   
emb|CBI22460.3|  unnamed protein product                              62.8    3e-08   
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg           62.4    4e-08   
ref|XP_003615006.1|  Xylan 1 4-beta-xylosidase                        62.4    4e-08   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087           62.4    4e-08   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...  62.4    4e-08   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...  62.4    4e-08   
gb|KCW55109.1|  hypothetical protein EUGRSUZ_I01067                   62.4    4e-08   
gb|EPS73741.1|  hypothetical protein M569_01013                       61.6    6e-08   
gb|KHN09132.1|  Putative beta-D-xylosidase 7                          61.6    7e-08   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5          61.6    7e-08   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like     61.6    7e-08   
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7          61.6    8e-08   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730        61.6    8e-08   
ref|XP_003580200.2|  PREDICTED: probable beta-D-xylosidase 6          61.6    8e-08   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                        61.2    1e-07   
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                61.2    1e-07   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6          61.2    1e-07   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5          61.2    1e-07   
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g           60.8    1e-07   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg           60.5    1e-07   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5          60.5    1e-07   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                       60.5    2e-07   
emb|CDY71910.1|  BnaAnng39260D                                        59.7    2e-07   
ref|XP_003592512.1|  Xylosidase                                       60.1    2e-07   
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg           60.1    2e-07   
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7          59.7    3e-07   
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like     59.7    3e-07   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5          59.7    3e-07   
gb|ADE76904.1|  unknown                                               58.9    3e-07   
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                 59.3    3e-07   
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like     59.3    4e-07   
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  59.3    4e-07   
gb|KJB59940.1|  hypothetical protein B456_009G282000                  59.3    4e-07   
gb|KJB59942.1|  hypothetical protein B456_009G282000                  59.3    4e-07   
dbj|BAB02547.1|  beta-1,4-xylosidase                                  59.3    4e-07   
ref|NP_188596.1|  putative beta-D-xylosidase 5                        59.3    4e-07   
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg           59.3    4e-07   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein            58.9    5e-07   
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7          58.9    5e-07   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g           58.5    7e-07   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876  58.9    7e-07   
ref|XP_007008778.1|  Glycosyl hydrolase family protein                58.2    8e-07   
ref|XP_006383491.1|  hypothetical protein POPTR_0005s16650g           58.2    9e-07   
ref|XP_009387061.1|  PREDICTED: probable beta-D-xylosidase 2          57.8    1e-06   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg              57.8    1e-06   
emb|CAJ65923.1|  xylan 1,4-beta-xylosidase                            57.8    1e-06   
ref|XP_008810094.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...  57.8    1e-06   
ref|XP_010546935.1|  PREDICTED: probable beta-D-xylosidase 5 isof...  57.8    1e-06   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                     57.4    2e-06   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541           57.4    2e-06   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207           57.4    2e-06   
ref|XP_008346038.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    2e-06   
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg              57.4    2e-06   
ref|XP_010546936.1|  PREDICTED: probable beta-D-xylosidase 5 isof...  57.4    2e-06   
ref|XP_009418907.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...  57.4    2e-06   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5          57.4    2e-06   
ref|XP_007018826.1|  Glycosyl hydrolase family protein                57.0    2e-06   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5          57.0    2e-06   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5          57.0    2e-06   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    2e-06   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                       57.0    2e-06   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like     57.0    2e-06   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    2e-06   
ref|XP_009373165.1|  PREDICTED: probable beta-D-xylosidase 7          57.0    2e-06   
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7          56.6    3e-06   
ref|XP_011011484.1|  PREDICTED: probable beta-D-xylosidase 7          56.6    3e-06   
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7          56.6    3e-06   
gb|EYU23225.1|  hypothetical protein MIMGU_mgv1a002689mg              56.6    3e-06   
emb|CDY58860.1|  BnaCnng33860D                                        56.6    3e-06   



>dbj|BAC98299.1| LEXYL2 [Solanum lycopersicum]
Length=633

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GH CRSTKC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNA
Sbjct  512  IPLEEGHACRSTKCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNA  571

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+
Sbjct  572  PQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTL  631

Query  223  EI  218
             I
Sbjct  632  RI  633



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   160 bits (405),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GH CRSTKC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP++HNA
Sbjct  657  IPLEEGHACRSTKCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPPSVHNA  716

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+
Sbjct  717  PQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTL  776

Query  223  EI  218
             I
Sbjct  777  RI  778



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   159 bits (401),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GH CRSTKC+S+D+  EQ C +   DIHL V+NVG + G H+VLLF+SPP++HNA
Sbjct  657  IPLEEGHACRSTKCKSIDSVNEQGCNNLGFDIHLKVQNVGKMRGSHTVLLFTSPPSVHNA  716

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LKHSLT+
Sbjct  717  PQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLKHSLTL  776

Query  223  EI  218
             I
Sbjct  777  RI  778



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GH CRST+C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNA
Sbjct  657  IPLEEGHACRSTRCKSIDAVNEQSCSNLGFDIHLRVKNVGKMSGSHTVFLFTSPPSVHNA  716

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV
Sbjct  717  PQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTV  776

Query  223  EI  218
             I
Sbjct  777  RI  778



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GH CRST+C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP++HNA
Sbjct  658  IPLEEGHACRSTRCKSIDAVNEQSCSNLGYDIHLRVKNVGKMSGSHTVFLFTSPPSVHNA  717

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LKHSLTV
Sbjct  718  PQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLKHSLTV  777

Query  223  EI  218
             I
Sbjct  778  RI  779



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   155 bits (393),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L + H CR +KC++VDA  Q+C++   DIHL VKNVG +SG H++ LF+SPP++HNAP
Sbjct  686  LPLGEKHTCRLSKCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHTIFLFTSPPSVHNAP  745

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+P  + VV FNVDVCKHLSV DE GNRKVALG HVLHIG LKHSLTV 
Sbjct  746  KKHLLGFEKVHLTPQGEGVVKFNVDVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVR  805

Query  220  I  218
            I
Sbjct  806  I  806



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   153 bits (386),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 77/121 (64%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L + H CR +KC++VDA  Q+C++   DIHL VKNVG +SG H + LF+SPP++HNAP
Sbjct  650  LPLGEKHTCRLSKCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHIIFLFTSPPSVHNAP  709

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+P  + VV FNV+VCKHLSV DE GNRKVALG HVLHIG LKHSLTV 
Sbjct  710  KKHLLGFEKVHLTPQGEGVVKFNVNVCKHLSVHDELGNRKVALGPHVLHIGDLKHSLTVR  769

Query  220  I  218
            I
Sbjct  770  I  770



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   151 bits (382),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS+ C+S+D  + TC +   DIH+ VKNVG +SG H+V LFSSPP +HNAP+K
Sbjct  650  LEEGHVCRSSMCKSIDVVDHTCKNLGFDIHVRVKNVGHMSGSHTVFLFSSPPQVHNAPQK  709

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GFQK+ L P  + +V FNVDVCKHLSVVDE GNRKVALG H+LH+G LKHSL + +
Sbjct  710  HLLGFQKLHLEPQGEGLVRFNVDVCKHLSVVDEKGNRKVALGEHLLHVGSLKHSLNLRV  768



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   151 bits (382),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRSTKC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP
Sbjct  661  IPLEEKHTCRSTKCKSIDTVEQSCSNLGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAP  720

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+P E+ VV FNVDVCKHLS  DE GN+KVALG HVLHIG LKHS TV+
Sbjct  721  QKHLLGFEKVHLTPQEEGVVKFNVDVCKHLSGHDELGNKKVALGQHVLHIGDLKHSFTVK  780

Query  220  I  218
            I
Sbjct  781  I  781



>gb|KCW63063.1| hypothetical protein EUGRSUZ_G00654 [Eucalyptus grandis]
Length=621

 Score =   149 bits (375),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 72/119 (61%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+K
Sbjct  503  LEEGHVCRSSACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQK  562

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
            QL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  563  QLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  621



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   150 bits (379),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRSTKC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP++HNAP
Sbjct  664  IPLEEKHTCRSTKCKSIDTVEQSCSNVGFNVHLRVKNMGKISGSHTIFLFNSPPSVHNAP  723

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+  E+ VV FNVDVCKHLSV DE GN+KVALG HVLHIG LKHS TV 
Sbjct  724  QKHLLGFKKVHLTAQEEGVVKFNVDVCKHLSVHDELGNKKVALGQHVLHIGDLKHSFTVR  783

Query  220  I  218
            I
Sbjct  784  I  784



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   149 bits (376),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C+S+ C S++  EQ+C ++++D+HL VKNVG  SG H+VLLFSSPP +HNAP
Sbjct  648  IPLEEGHVCQSSTCRSINPVEQSCKNASIDVHLRVKNVGNYSGSHTVLLFSSPPQVHNAP  707

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RK L+G+QK+ L+P  + +V FN+DVCKHLS+VDE GN+KVALG ++LHIG L HSL V 
Sbjct  708  RKHLIGYQKLHLTPQAEGLVRFNIDVCKHLSIVDENGNQKVALGEYILHIGSLMHSLHVV  767

Query  220  I  218
            I
Sbjct  768  I  768



>emb|CAN78858.1| hypothetical protein VITISV_030325 [Vitis vinifera]
Length=699

 Score =   147 bits (372),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + +++ H C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P
Sbjct  579  IPIEEAHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSP  638

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V 
Sbjct  639  QKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVR  698

Query  220  I  218
            I
Sbjct  699  I  699



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   148 bits (373),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  E+ C + A DIHL VKN+G +SG H+V+LFSSPPA+H +P
Sbjct  653  IPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNMGRMSGSHTVMLFSSPPAVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV +S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V 
Sbjct  713  QKHLLGFEKVFVSAKREALVKFNVDVCKHLSVVDELGNRKVALGKHVLHVGSLKHSFSVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>emb|CBI20072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + +++GH C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P
Sbjct  213  IPIEEGHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSP  272

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV ++   + +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V 
Sbjct  273  QKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVR  332

Query  220  I  218
            I
Sbjct  333  I  333



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   147 bits (370),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C+S+ C S+DA E++C ++A+++HL VKNVG  SG H+VLLFSSPP +HNA 
Sbjct  648  IPLEEGHVCKSSTCWSIDAVERSCKNAAVNVHLRVKNVGNYSGSHTVLLFSSPPQVHNAA  707

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+K+ L+P  +  V F++DVCKHLSVVDE G RKVALG HVLH+G L HSL V 
Sbjct  708  QKHLLGFEKLHLTPQAEGQVRFDIDVCKHLSVVDENGARKVALGEHVLHVGSLTHSLNVM  767

Query  220  I  218
            I
Sbjct  768  I  768



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C+STKC SVDA ++TC + A DIHL VKN+G + G H+V LFS+PP++HN+P
Sbjct  650  VPLEEGHACQSTKCISVDAVDRTCQNLAFDIHLKVKNMGRIRGSHTVFLFSTPPSVHNSP  709

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K LV F+KV L       V F VD+CKHLSVVDE GNRK+ALG H+LH+G+LKHS+T+ 
Sbjct  710  QKHLVDFEKVSLDAQTHSTVQFKVDICKHLSVVDEFGNRKIALGEHILHVGNLKHSMTLR  769

Query  220  I  218
            I
Sbjct  770  I  770



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H AP+K
Sbjct  659  LEEGHVCRSSACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPSVHRAPQK  718

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
            QL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH+L+V+I
Sbjct  719  QLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKHALSVQI  777



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   146 bits (368),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L+Q H C S+ C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP
Sbjct  654  IPLEQDHVCHSSSCQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V 
Sbjct  714  KKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P
Sbjct  659  IPLEEGHVCHSSSCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSP  718

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V 
Sbjct  719  QKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGQHVLHVGSLKHSFSVG  778

Query  220  I  218
            I
Sbjct  779  I  779



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP++HN+P
Sbjct  659  IPLEEGHVCHSSSCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPSVHNSP  718

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V 
Sbjct  719  QKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGPHVLHVGSLKHSFSVG  778

Query  220  I  218
            I
Sbjct  779  I  779



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = -2

Query  574  LDQGHPCRSTK--CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L++GH CRS+   C+S+DA EQ+C +   +IHL V+NVGT+SG H+VLLFSSPP++HNA 
Sbjct  586  LEEGHVCRSSSSTCKSIDAVEQSCKNLGFNIHLRVRNVGTMSGSHTVLLFSSPPSVHNAA  645

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GFQK+ L+P  + +V FNVDVCKHLS+VDE GNRKVA+G HVLH G LKH+LTV 
Sbjct  646  QKHLLGFQKLHLAPQTEGLVKFNVDVCKHLSMVDELGNRKVAVGEHVLHAGDLKHTLTVR  705

Query  220  I  218
            I
Sbjct  706  I  706



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   145 bits (365),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L+Q H C S+ C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP++HNAP
Sbjct  679  IPLEQDHVCHSSSCQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPSVHNAP  738

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK +L+V 
Sbjct  739  KKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQTLSVR  798

Query  220  I  218
            I
Sbjct  799  I  799



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS+ CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H APRK
Sbjct  658  LEEGHVCRSSACESLEATNEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPRK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +  V F VDVCK L VVDE G RKVALG+H+LH+G LKH+L+V+I
Sbjct  718  HLLGFEKVFLASQSEAQVQFKVDVCKDLGVVDELGCRKVALGMHILHVGDLKHALSVQI  776



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P
Sbjct  653  IPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V 
Sbjct  713  QKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++ H CRS+ C S+DAA ++C + +A+++HL+VKNVG + G H+VLLFSSPP +H A
Sbjct  646  MDLEEDHVCRSSTCRSIDAAGRSCKNNAAIEVHLSVKNVGRMGGAHTVLLFSSPPEVHGA  705

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            PRKQL+GF+KV L P  + VV FNVDVCKHLS+VDE GNRKVALG HVLH+G+LKHSL V
Sbjct  706  PRKQLLGFEKVHLVPQGEGVVRFNVDVCKHLSLVDEKGNRKVALGEHVLHVGNLKHSLNV  765

Query  223  EI  218
             I
Sbjct  766  II  767



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  E+ C + A DIHL VKN+G++SG H+V+LFSSPPA+H +P
Sbjct  653  IPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNMGSMSGSHTVMLFSSPPAVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV +S     +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKHS +V 
Sbjct  713  QKHLLGFEKVFVSAQRVALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKHSFSVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>gb|KJB31997.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=631

 Score =   141 bits (355),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P
Sbjct  511  IPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSP  570

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV 
Sbjct  571  QKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVG  630

Query  220  I  218
            I
Sbjct  631  I  631



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAPRK
Sbjct  659  LEEGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLTGSHTVLVFSRPPRVHNAPRK  718

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
            QLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKHS  V I
Sbjct  719  QLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHSFNVTI  777



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H C S+ C+S+D  E+ C + A DIHL VKN+G + G H+VLL+SSPP++HNAP
Sbjct  679  IPLEEDHVCYSSSCQSLDVVEERCQNLAFDIHLGVKNMGKMCGSHTVLLYSSPPSVHNAP  738

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L+ +L+V 
Sbjct  739  KKHLLGFEKVFLSSQGEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLRQTLSVR  798

Query  220  I  218
            I
Sbjct  799  I  799



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + +++GH C S+KC+SVDA +++C +   DIHL V N G +SG H+V LFSSPP++HN+P
Sbjct  654  IPIEEGHSCHSSKCKSVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V 
Sbjct  714  QKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA+H +P
Sbjct  653  IPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK S +V 
Sbjct  713  QKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKRSFSVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + +++GH C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP++HN+P
Sbjct  654  IPIEEGHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV ++   + +V F VDVCK LS+VDE G +KVALGLHVLH+G LKHSL V 
Sbjct  714  QKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTQKVALGLHVLHVGSLKHSLNVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            LD+GH C S+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP++H +P+K
Sbjct  659  LDEGHICHSSACESLEAKSETCSNLVFDVHLNVKNVGRFSGSHTVFLFSSPPSVHRSPQK  718

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +  V F VDVCK LSVVDE G RKVALG HVLH+G LKH+L+V+I
Sbjct  719  HLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGGRKVALGTHVLHVGDLKHALSVQI  777



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S +C SVD A   C   A D+HL V+N G ++G H+V LFSSPPA+HNAP
Sbjct  649  IPLEEGHSCYSQRCNSVDLAGNACDGLAFDVHLRVQNSGGMAGSHTVFLFSSPPAVHNAP  708

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RK L+GF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH G LKHSL+++
Sbjct  709  RKHLLGFEKVYLGPKAAGDVVFKVDVCKDLSVVDELGNRKLALGSHVLHAGSLKHSLSLK  768

Query  220  I  218
            I
Sbjct  769  I  769



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+S+D  E+ C +   DIHL VKN G++SG H+V+LFSSPPA+H +P
Sbjct  653  IPLEEGHVCHSSSCKSLDVMEERCKNLVFDIHLGVKNAGSMSGSHTVMLFSSPPAVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L HS +V 
Sbjct  713  QKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLXHSFSVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K
Sbjct  660  LEENHVCYSSECKSVAAAEQTCQNLTFDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQK  719

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  720  HLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  778



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV A+EQTC +S  D+ L VKNVGTVSG H+VLLFSSPPA+HNAP+K
Sbjct  657  LEESHVCHSSECQSVVASEQTCQNSTFDMLLRVKNVGTVSGSHTVLLFSSPPAVHNAPQK  716

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             LVGF+KV L+      V F V++CK LS+VDE G++KVALG HVLH+G LKH L+V I
Sbjct  717  HLVGFKKVFLNAQTGRHVRFKVNICKDLSLVDELGSKKVALGEHVLHVGSLKHFLSVRI  775



>gb|KCW63062.1| hypothetical protein EUGRSUZ_G006531, partial [Eucalyptus grandis]
Length=642

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS  CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K
Sbjct  511  LEEGHVCRSLACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQK  570

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  571  HLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  629



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            ++L+ GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAP
Sbjct  653  VSLETGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V 
Sbjct  713  RKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVT  772

Query  220  I  218
            I
Sbjct  773  I  773



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            ++L+ GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP +HNAP
Sbjct  650  VSLETGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPPRVHNAP  709

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LKH   V 
Sbjct  710  RKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLKHFFNVT  769

Query  220  I  218
            I
Sbjct  770  I  770



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S +C+S+D     C + A DIHL V+N G ++G H+V LFS+PP++HN+P
Sbjct  652  IPLEEGHSCYSKRCKSIDVVGSGCENVAFDIHLRVQNTGRMAGSHTVFLFSTPPSVHNSP  711

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +KQL+GF+KV L P     VVF VDVCK LS+VDE GNRKVALG H+LH+G L HSL V 
Sbjct  712  QKQLLGFEKVYLGPQGVGNVVFKVDVCKDLSLVDELGNRKVALGSHILHVGSLMHSLKVR  771

Query  220  I  218
            +
Sbjct  772  V  772



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRS++C+SVDA EQ+C + A DIHL V+N G  SG H+V LFS+PP++HN+P
Sbjct  667  IPLEEVHVCRSSECKSVDAIEQSCKNLAFDIHLRVQNKGRNSGSHTVFLFSTPPSVHNSP  726

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RK L+GF+KV L+   + +V F VDVCK LSVVDE G+RKV+LG HVLH+G LKHSL V 
Sbjct  727  RKHLLGFEKVLLTGKSESLVRFKVDVCKDLSVVDERGSRKVSLGQHVLHVGSLKHSLNVR  786

Query  220  I  218
            I
Sbjct  787  I  787



>gb|KJB31996.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
 gb|KJB31998.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=507

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P
Sbjct  387  IPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSP  446

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV 
Sbjct  447  QKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVG  506

Query  220  I  218
            I
Sbjct  507  I  507



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS+ C+S++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K
Sbjct  658  LEEGHVCRSSACKSLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +  V F VDVCK LSVVDE G+ KVALG HVLH+G LKH+L+V+I
Sbjct  718  HLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHWKVALGTHVLHVGDLKHALSVQI  776



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P
Sbjct  653  IPLEEGHVCYSSNCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLTV 
Sbjct  713  QKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTVR  772

Query  220  I  218
            I
Sbjct  773  I  773



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS  CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K
Sbjct  658  LEEGHVCRSLACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH+L+V+I
Sbjct  718  HLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKHALSVQI  776



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+ C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP++H +P
Sbjct  653  IPLEEGHVCYSSNCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPSVHKSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKHSLT+ 
Sbjct  713  QKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKHSLTIR  772

Query  220  I  218
            I
Sbjct  773  I  773



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P
Sbjct  659  IPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSP  718

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV 
Sbjct  719  QKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVR  778

Query  220  I  218
            I
Sbjct  779  I  779



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP++HN+P
Sbjct  659  IPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVHNSP  718

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKHSLTV 
Sbjct  719  QKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKHSLTVG  778

Query  220  I  218
            I
Sbjct  779  I  779



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 69/119 (58%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP+K
Sbjct  657  LAEDHECRSLECKSLDVADEHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAPQK  716

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V I
Sbjct  717  HLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVRI  775



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV A+EQTC +S  D+ L VKN GT+SG H+V LFSSPPA+HN+P+K
Sbjct  655  LEESHVCHSSECQSVVASEQTCQNSTFDMLLRVKNEGTISGSHTVFLFSSPPAVHNSPQK  714

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             LVGF+KV L+      V F VD+CK LSVVDE G++KVALG HVLH+G LKH L+V I
Sbjct  715  HLVGFEKVFLNAQTGRHVRFKVDICKDLSVVDELGSKKVALGEHVLHVGSLKHFLSVRI  773



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP++HN+P+K
Sbjct  641  LEENHVCYSSECKSVAAAEQTCQN--FDVHLRIKNTGTTSGSHTVFLFSTPPSVHNSPQK  698

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHS+TV I
Sbjct  699  HLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSMTVRI  757



>ref|XP_009407358.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVD-AAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L++GHPC S  C S+D A    C+    D+HL V+N G ++G H+VLLF++PPA+HNA
Sbjct  502  ITLEEGHPCYSEGCNSLDLAGSAHCSGLQFDVHLKVQNSGGMAGSHTVLLFNTPPAVHNA  561

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            PRKQLVGF+KV L PNE + V F VD C+ LSV DE+GN KV LG HVLH+G + H+LT+
Sbjct  562  PRKQLVGFEKVFLEPNESKNVAFQVDACRDLSVADESGNWKVPLGSHVLHVGDVTHTLTL  621

Query  223  EI  218
             I
Sbjct  622  SI  623



>gb|ACL53913.1| unknown [Zea mays]
 gb|ACN36701.1| unknown [Zea mays]
 gb|AFW59617.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=405

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP
Sbjct  285  LQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAP  344

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  345  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLG  404

Query  220  I  218
            +
Sbjct  405  V  405



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S +C+SVD A   C     D+HL V+N G  +G H+V LFS+PPA+H AP
Sbjct  650  IPLEEGHSCDSRQCKSVDLAGTGCNDLGFDVHLRVRNSGNRAGSHTVFLFSTPPAVHGAP  709

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            RK LVGF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH+G LKHSL+++
Sbjct  710  RKHLVGFEKVFLGPKAVGQVVFKVDVCKDLSVVDELGNRKLALGSHVLHVGSLKHSLSLK  769

Query  220  I  218
            +
Sbjct  770  V  770



>ref|XP_010068199.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2, partial [Eucalyptus grandis]
Length=531

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH CRS   +S++A  +TC++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP
Sbjct  393  MPLEEGHVCRSL-AKSLEAIGKTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAP  451

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L+   +  + F V+VCK LS+VDE G+RKVALG HVLHIG LKH+L+++
Sbjct  452  QKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKHALSMQ  511

Query  220  I  218
            I
Sbjct  512  I  512



>gb|AFW59618.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=475

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP
Sbjct  355  LQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAP  414

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  415  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLG  474

Query  220  I  218
            +
Sbjct  475  V  475



>ref|NP_001146416.1| uncharacterized protein LOC100279996 [Zea mays]
 gb|ACN32073.1| unknown [Zea mays]
Length=507

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP
Sbjct  387  LQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAP  446

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  447  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLG  506

Query  220  I  218
            +
Sbjct  507  V  507



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH CRS KC+S+   E+ C + A +IHL V+N+G +SG H+V LFS+PP++HNAP K
Sbjct  655  LEEGHICRSQKCKSIHLEEEGCRNLAFEIHLRVRNMGRMSGSHTVFLFSTPPSVHNAPNK  714

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   + +V FNVDVCK LSVVDE G RKVALG HVLH+G LKHSL + I
Sbjct  715  HLLGFEKVFLTSQNEALVKFNVDVCKDLSVVDELGRRKVALGSHVLHVGSLKHSLNIRI  773



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K
Sbjct  530  LAEDHECRSSECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQK  589

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  590  HLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  648



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K
Sbjct  658  LEENHVCYSSECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  718  HLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>ref|XP_008661823.1| PREDICTED: uncharacterized protein LOC100279996 isoform X2 [Zea 
mays]
Length=653

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP
Sbjct  533  LQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAP  592

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  593  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLG  652

Query  220  I  218
            +
Sbjct  653  V  653



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++ H C S++C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP++HN+P+K
Sbjct  658  LEENHVCYSSECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPSVHNSPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKHSLTV I
Sbjct  718  HLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKHSLTVRI  776



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score =   132 bits (333),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K
Sbjct  530  LAEDHVCRSSECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQK  589

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  590  HLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  648



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S +C+SVD     C ++A DIHL V+N G ++G H+V LFS+PP++HN+P
Sbjct  653  IPLEEGHSCYSKRCKSVDLVGSRCQNAAFDIHLRVQNPGRMAGSHTVFLFSTPPSVHNSP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+K+ L P     VVFNVDVCK LS+VDE GNR VALG HVLH+G LKHSL V 
Sbjct  713  QKHLLGFEKIYLGPKXVGYVVFNVDVCKDLSLVDELGNRMVALGSHVLHVGSLKHSLRVR  772

Query  220  I  218
            +
Sbjct  773  V  773



>dbj|BAK03439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   132 bits (333),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP
Sbjct  574  MRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAP  633

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + 
Sbjct  634  AKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELR  693

Query  220  I  218
            +
Sbjct  694  V  694



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAA--EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
              LD+ + CR+++C +++    E TC + A DIHL VKNVGT  G H+V LFSSPP++HN
Sbjct  656  FPLDEANACRTSRCTTLNVGDHEHTCQNLAFDIHLRVKNVGTSGGTHTVFLFSSPPSVHN  715

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            +PRK L+GF+KV L    + +V F V++CK LSVVDE G RKVALG H+LH+G LKHSL+
Sbjct  716  SPRKHLLGFEKVSLKAQSESLVKFTVNICKDLSVVDEVGTRKVALGHHLLHVGDLKHSLS  775

Query  226  VEI  218
            V I
Sbjct  776  VRI  778



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP
Sbjct  655  MRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAP  714

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + 
Sbjct  715  AKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELR  774

Query  220  I  218
            +
Sbjct  775  V  775



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP
Sbjct  655  MRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAP  714

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + 
Sbjct  715  AKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELR  774

Query  220  I  218
            +
Sbjct  775  V  775



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA+HNAP
Sbjct  653  LQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPAVHNAP  712

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  713  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLG  772

Query  220  I  218
            +
Sbjct  773  V  773



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   132 bits (333),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS +C+S+D A++ C + A DIHL+ KN+G +S  H+VLLF SPP +HNAP+K
Sbjct  657  LAENHECRSLECKSLDVADEHCQNLAFDIHLSAKNMGKMSSSHTVLLFFSPPNVHNAPQK  716

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV+L+   + +V F VDVCK LSVVDE G RKV LG H+LH+G+LK+ L+V I
Sbjct  717  HLLGFEKVQLAGKSEALVKFKVDVCKDLSVVDEVGKRKVPLGEHMLHVGNLKYPLSVRI  775



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRST-KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            + L+  H CRS+ KC SVDA EQ C   A +I L V+N+G V G H+V LF +PP++HN+
Sbjct  656  IPLEDDHVCRSSSKCISVDAGEQNCQGLAFNIDLKVRNIGKVRGTHTVFLFFTPPSVHNS  715

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P+K LV F+KV L      +V F VDVCKHLSVVDE G+RKVALG HVLH+G+L+HSLTV
Sbjct  716  PQKHLVDFEKVSLDAKTYGMVSFKVDVCKHLSVVDEFGSRKVALGGHVLHVGNLEHSLTV  775

Query  223  EI  218
             I
Sbjct  776  RI  777



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L +GH C + +C SV+A    C   A D+HL V+N G +SG H+V LFSSPPA+HNAP
Sbjct  647  LQLAEGHTCLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGDMSGAHTVFLFSSPPAVHNAP  706

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L++ 
Sbjct  707  AKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGNHTLHVGDLKHTLSLG  766

Query  220  I  218
            +
Sbjct  767  V  767



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P
Sbjct  662  IPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSP  721

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V+
Sbjct  722  QKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVK  781

Query  220  I  218
            +
Sbjct  782  V  782



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + H CRS +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP +HNAP
Sbjct  654  VPLAEDHECRSLECKSLDVADKHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPNVHNAP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKHSL+V 
Sbjct  714  QKHLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKHSLSVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P
Sbjct  671  IPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSP  730

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V 
Sbjct  731  QKHLLGFEKVSLGRGREMVVRFKVDVCKDLSVTDEVGSRKVALGLHILHVGTLKHSLNVR  790

Query  220  I  218
            +
Sbjct  791  V  791



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP++HN+P
Sbjct  689  IPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPSVHNSP  748

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKHSL V+
Sbjct  749  QKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKHSLNVK  808

Query  220  I  218
            +
Sbjct  809  V  809



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K
Sbjct  647  LAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAK  706

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  707  HLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  765



>dbj|BAD94522.1| beta-xylosidase - like protein [Arabidopsis thaliana]
Length=287

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S  ++HLNVKN G  +G H+V LF++ P 
Sbjct  162  LSLDENHPCRSSECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLFTTSPQ  221

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+G LKH
Sbjct  222  VHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHVGSLKH  281

Query  235  SLTVEI  218
            SL + +
Sbjct  282  SLNISV  287



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K
Sbjct  653  LAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAK  712

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  713  HLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  771



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP++H+AP K
Sbjct  721  LAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPSVHSAPAK  780

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  781  HLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  839



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP+ HNAP
Sbjct  850  MQLAEDHPCRAEECASVEAASDHCEDLAFDVKLRVRNAGEVAGAHSVLLFSSPPSAHNAP  909

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + 
Sbjct  910  AKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELR  969

Query  220  I  218
            +
Sbjct  970  V  970



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L++GH C S +C+S+D  E +C + A  IHL V+N+G  SG H+VLLF++PP++HNAP+K
Sbjct  653  LEEGHICHSQRCKSIDLFEGSCQNLAFKIHLRVRNMGRRSGSHTVLLFNTPPSVHNAPKK  712

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L+   +E+V FNVDVCK LSVVDE G+RKVALG HVL +G LKHSL ++I
Sbjct  713  HLLGFKKVFLTAQSEELVKFNVDVCKDLSVVDELGSRKVALGSHVLQVGSLKHSLNIKI  771



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP  HNAP
Sbjct  589  MRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAP  648

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LKH++ + 
Sbjct  649  AKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLKHTVELR  708

Query  220  I  218
            +
Sbjct  709  V  709



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   129 bits (325),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H C ++ C+S+DA  + C +   D+HL V+N G + G H+V LFSSPP++HN+P+K
Sbjct  659  LQEEHVCHTSTCKSIDALGEHCKNLGFDVHLKVRNNGAMEGRHTVFLFSSPPSVHNSPKK  718

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+ F+KV L    + + VF VD C+HLSVVDE GNRKVALG+H LHIG++KHS  V I
Sbjct  719  NLIAFEKVFLHGKTEGMTVFKVDACEHLSVVDEEGNRKVALGVHQLHIGNMKHSFNVRI  777



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   129 bits (324),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L + H CR+ +C SV+AA   C   ALD+ L V+N G V+G HSVLLFSSPP  HNAP
Sbjct  657  MRLAEDHLCRAEECASVEAAGDHCDDLALDVKLQVRNAGEVAGAHSVLLFSSPPPAHNAP  716

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K LVGF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH G LKH++ + 
Sbjct  717  AKHLVGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHDGDLKHTVELR  776

Query  220  I  218
            +
Sbjct  777  V  777



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L +GH C +  C SV+AA + C + + D+HL V+N G V+G H+V LF+SPP++HNAP K
Sbjct  658  LAEGHACYTEHCLSVEAAGEHCENLSFDVHLRVRNAGDVAGRHTVFLFTSPPSVHNAPAK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + +
Sbjct  718  HLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKHTLNLRV  776



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   128 bits (321),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C S+  A++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K
Sbjct  530  LAEDHECRSSECMSLGVADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQK  589

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  590  HLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  648



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C+S+    + C +  +DI+L VKN G +S GH+V LFS+PPA+HNAP+K
Sbjct  655  LAEDHVCRSSECKSLVIDGELCQNLVIDINLKVKNKGNLSSGHTVFLFSTPPAVHNAPQK  714

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G+LKH L+V I
Sbjct  715  HLLGFEKVHLIGKSEALVRFKVDVCKDLSIVDELGNRKVALGQHLLHVGNLKHPLSVMI  773



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K
Sbjct  658  LAEDHECRSSECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVHNAPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH L+V +
Sbjct  718  HLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKHQLSVSV  776



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L LDQ HPCRS++C+SVD+    C +     S  ++HLNV+N G   G H+V LF++PPA
Sbjct  654  LRLDQSHPCRSSECQSVDSIGPHCENAVKGRSDFEVHLNVRNAGDREGSHTVFLFTTPPA  713

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV F VDVC+ LSVVDE G RK+ALG H+LH+G LKH
Sbjct  714  IHRSPIKHLLGFEKVRLGKNEEAVVRFKVDVCQDLSVVDEIGKRKIALGQHLLHVGSLKH  773

Query  235  SLTVEI  218
            +L + +
Sbjct  774  TLNIRV  779



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA+HNAP+K
Sbjct  647  LAEDHVCRSSECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPAVHNAPQK  706

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  707  HLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKHPLSVMI  765



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L +GH C + +C SV+AA   C   A ++ L V N G ++G H+VLLFSSPPA+HNAP
Sbjct  654  MQLAEGHACHTKECASVEAAGDHCEGMAFEVRLRVHNTGEMAGAHTVLLFSSPPAVHNAP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+K+ L P +  V  F VDVCK LSVVDE GNRKVALG H LH+G LKH+L + 
Sbjct  714  AKHLLGFEKLNLEPGQAGVAAFKVDVCKDLSVVDELGNRKVALGGHTLHVGDLKHTLNLG  773

Query  220  I  218
            +
Sbjct  774  V  774



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S  ++ LNVKN G   G H+V LF++PPA
Sbjct  654  LSLDKSHPCRSSECQSLDAIGPHCENADEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPA  713

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV FNVDVCK LSVVDE G RK+ALG H+LH+G LKH
Sbjct  714  IHGSPIKHLLGFEKVRLGKNEEAVVRFNVDVCKDLSVVDEIGTRKIALGHHLLHVGSLKH  773

Query  235  SLTVEI  218
            SL + +
Sbjct  774  SLNITV  779



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/126 (51%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L L++ H CRS++C+S+DA    C       SA ++H+ V+N G   G H+V LF++PPA
Sbjct  655  LRLEENHVCRSSECQSLDAIGPHCENAVSGGSAFEVHIKVRNGGDREGIHTVFLFTTPPA  714

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+G LKH
Sbjct  715  VHGSPRKHLLGFEKIRLGKMEEAVVKFKVEICKDLSVVDEIGKRKIALGQHLLHVGDLKH  774

Query  235  SLTVEI  218
            SL++ I
Sbjct  775  SLSIRI  780



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S  ++HLNVKN G  +G H+V LF++ P 
Sbjct  648  LSLDENHPCRSSECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLFTTSPQ  707

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+G LKH
Sbjct  708  VHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHVGSLKH  767

Query  235  SLTVEI  218
            SL + +
Sbjct  768  SLNISV  773



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL  413
            L+L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PPA+
Sbjct  654  LSLEENHVCRSSECQSLDAFGPHCEKKAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAV  713

Query  412  HNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHS  233
            H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHS
Sbjct  714  HGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHS  773

Query  232  LTVEI  218
            L++ I
Sbjct  774  LSIRI  778



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L +GH C +  C SV+A    C   A D+HL V+N G V+G H+V LFSSPPA+HNAP
Sbjct  650  VVLAEGHACLTEHCLSVEAEGGHCDKLAFDVHLRVRNAGEVAGRHTVFLFSSPPAVHNAP  709

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+GF+KV L P +  VV F VDVC+ LSVVDE GNRKVALG H LH+G LKH++ + 
Sbjct  710  AKHLLGFEKVSLEPGQAGVVAFKVDVCRDLSVVDELGNRKVALGSHTLHVGDLKHTINLR  769

Query  220  I  218
            +
Sbjct  770  V  770



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S  ++ LNVKN G   G H+V LF++PPA
Sbjct  627  LSLDESHPCRSSECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPA  686

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+G LKH
Sbjct  687  IHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHVGSLKH  746

Query  235  SLTVEI  218
            SL + +
Sbjct  747  SLNITV  752



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S +++ LNVKN G   G H+V LF++PPA
Sbjct  654  LSLDESHPCRSSECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLFTTPPA  713

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+G LKH
Sbjct  714  IHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHVGSLKH  773

Query  235  SLTVEI  218
            SL + +
Sbjct  774  SLNITV  779



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S +++ LNVKN G   G H+V LF++PPA
Sbjct  640  LSLDESHPCRSSECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLFTTPPA  699

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+G LKH
Sbjct  700  IHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHVGSLKH  759

Query  235  SLTVEI  218
            SL + +
Sbjct  760  SLNITV  765



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L+L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P
Sbjct  576  LSLAKSHPCRTSKCQSVDAIGPYCGK-AIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSP  634

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  635  VKHLLAFEKVRLGKEEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVR  694

Query  220  I  218
            I
Sbjct  695  I  695



>dbj|BAD94481.1| beta-xylosidase [Arabidopsis thaliana]
Length=523

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V LF++PP
Sbjct  397  LGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPP  456

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+G LK
Sbjct  457  AIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHVGDLK  516

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  517  HSLSIRI  523



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L+LD+ HPCRS++C+S+DA    C       S  ++ LNVKN G   G H+V LF++PPA
Sbjct  669  LSLDESHPCRSSECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLFTTPPA  728

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+G LKH
Sbjct  729  IHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHVGSLKH  788

Query  235  SLTVEI  218
            SL + +
Sbjct  789  SLNITV  794



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   125 bits (314),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P
Sbjct  655  LGLAKSHPCRTSKCQSVDATGPYCGK-AIEVELRVRNAGEREGTETVFLFTTPPAVHRSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  714  VKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDENGKRKIALGVHVLHVGSLKYSLIVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C S+D A++ C + A DIHL VKN G +S  H VLLF +PP +HNAP+K
Sbjct  658  LAEDHECRSSECMSLDIADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVHNAPQK  717

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH L++ +
Sbjct  718  HLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKHPLSLRV  776



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            + L++GHPC ST CESV+     C +    +H+ VKNVG   GG++VLLFS+PP +HNAP
Sbjct  649  IPLEEGHPCLSTACESVELHSSKCPNLTFSLHVKVKNVGDRHGGNTVLLFSTPPRVHNAP  708

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            RK+L+GF+KV + P  +  V F V+VC+ L VVDE G++KVALG H  H+G+L HSL+V
Sbjct  709  RKRLLGFEKVHVEPRSERAVEFRVEVCEGLGVVDEFGSKKVALGSHTFHVGNLVHSLSV  767



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            SVDA +++C +   DIHL V N G +SG H+V LFSSPP++HN+P+K L+GF+KV ++  
Sbjct  646  SVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVHNSPQKHLLGFEKVFVTAK  705

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
               +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKHSL V I
Sbjct  706  AKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKHSLNVRI  751



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   124 bits (312),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L+L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P
Sbjct  655  LSLAKSHPCRTSKCQSVDAIGPYCGK-AIEVQLRVRNAGEREGTDTVFLFTTPPAVHRSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  714  VKHLLAFEKVRLGKKEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVR  773

Query  220  I  218
            I
Sbjct  774  I  774



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   124 bits (312),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL  413
            L L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PP +
Sbjct  654  LRLEENHVCRSSECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPTV  713

Query  412  HNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHS  233
            H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHS
Sbjct  714  HGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHS  773

Query  232  LTVEI  218
            L++ I
Sbjct  774  LSIRI  778



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS+KC+S+D   + C +   DIHL +KN G +S   +V LFS+PPA+HNAP+K
Sbjct  656  LAEDHVCRSSKCKSLDVVGEHCQNLVFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQK  715

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+ F+KV  +   + +V F VDVCK LSVVDE GNRKVALG H+LH+G LKH L+V I
Sbjct  716  HLLAFEKVHFTGKSEALVSFKVDVCKDLSVVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>gb|KCW63060.1| hypothetical protein EUGRSUZ_G00652 [Eucalyptus grandis]
Length=460

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -2

Query  529  DAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPned  350
            +A  +TC++ ALD+HLNVKNVG  SG H+V LFSSPP++H AP+K L+GF+KV L+   +
Sbjct  352  EAIGKTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPSVHRAPQKHLLGFEKVFLASQSE  411

Query  349  evvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
              + F V+VCK LS+VDE G+RKVALG HVLHIG LKH+L+++I
Sbjct  412  AQLQFKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKHALSMQI  455



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   124 bits (310),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L+L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V LF++PP
Sbjct  658  LSLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLFTTPP  717

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +PRK L+GF+K+RL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+G LK
Sbjct  718  AIHGSPRKHLLGFEKIRLGKMEEAVVRFKVEVCKDLSVVDEIGKRKIGLGKHLLHVGDLK  777

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  778  HSLSIRI  784



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS+KC+S+D   + C + A DIHL +KN G +S   +V LFS+PPA+HNAP+K
Sbjct  656  LAEDHVCRSSKCKSLDVVGEHCQNLAFDIHLRIKNKGKMSSSQTVFLFSTPPAVHNAPQK  715

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+ F+KV L+   + +V F VDVCK L +VDE GNRKVALG H+LH+G LKH L+V I
Sbjct  716  HLLAFEKVLLTGKSEALVSFKVDVCKDLGLVDELGNRKVALGKHMLHVGDLKHPLSVMI  774



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS +C+S+D A Q C + A DI L++KN G +S   +V LFS+PPA+HNAP+K
Sbjct  656  LSEDHVCRSLECKSLDVAGQHCQNLAFDIQLSIKNNGKMSISQTVFLFSTPPAVHNAPQK  715

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+ F+KV L    + VV F VDVCK LSVVDE GNRKVALG H+LH+G LKH L V I
Sbjct  716  HLLAFEKVHLMGKSEAVVSFKVDVCKDLSVVDEVGNRKVALGQHMLHVGDLKHPLGVRI  774



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V LF++PP
Sbjct  658  LGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPP  717

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH+G LK
Sbjct  718  AIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLHVGDLK  777

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  778  HSLSIRI  784



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   123 bits (309),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 66/121 (55%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L LD  HPCRS+KC+S+DA    C   A ++ L V+N G   G H+V +F SPPA+H +P
Sbjct  657  LGLDASHPCRSSKCQSLDAVGPYCGK-AFEVQLRVRNAGNREGSHTVFMFMSPPAVHRSP  715

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K L+ F+KVR    E  VV F VDVCK LSVVDE G RK+ALG HVLH+G LK+SL + 
Sbjct  716  VKHLLAFEKVRPGMKEKTVVRFEVDVCKDLSVVDETGKRKIALGKHVLHVGSLKYSLYIT  775

Query  220  I  218
            I
Sbjct  776  I  776



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  574  LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRK  395
            L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP +HNAP+K
Sbjct  657  LAEDHECRSSECTSLDVADEHCQNLAFDIHLGVKNLGQMSSNHVVLLFFTPPHVHNAPQK  716

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             L+ F+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+ KH ++V +
Sbjct  717  HLLAFEKVHLPGKSETQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNFKHPISVRV  775



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   123 bits (308),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            L LD  H CRS++C+S+DA    C   S  +I L V N G   G H+V LF++PPA+H +
Sbjct  651  LRLDDNHRCRSSECQSLDAIGSHCEGGSDFEIQLKVANAGDREGSHTVFLFTTPPAIHRS  710

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P K L+GF+K+RL  NE+ VV F V+VCK LSVVDE G RK+ LG HVLH+G+LKHSL +
Sbjct  711  PIKHLLGFEKIRLVKNEETVVRFKVNVCKDLSVVDETGKRKIGLGEHVLHVGNLKHSLNI  770

Query  223  EI  218
             +
Sbjct  771  RV  772



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA+H +P
Sbjct  655  LGLAKSHPCRTSKCQSVDATGPYCGK-AIEVQLRVRNAGEREGTETVFLFTTPPAVHRSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+SL V 
Sbjct  714  VKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKYSLIVR  773



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V LF++PP
Sbjct  659  LRLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFLFTTPP  718

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE GNRK++LG H+LH+G LK
Sbjct  719  AVHGSPRKHLLGFEKVRLGKMEEAVVRFKVEVCKDLSVVDEVGNRKISLGKHLLHVGDLK  778

Query  238  HSLTVEI  218
            H L++ I
Sbjct  779  HYLSIRI  785



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V L+++PP
Sbjct  650  LGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLYTTPP  709

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH+G LK
Sbjct  710  AVHGSPRKHLLGFEKVRLGKMEEAVVRFRVEVCKDLSVVDEVGKRKIGLGKHLLHVGDLK  769

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  770  HSLSIRI  776



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSA-----LDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L LD+ H CRS++C+SVDA    C ++       ++ L V+NVG   G H+V LF++PP 
Sbjct  654  LDLDENHACRSSECQSVDAIGPHCDNAVGGGLNFEVQLKVRNVGDREGSHTVFLFTTPPE  713

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +PRK L+GF+K+RL   E+ V+ FNVDVCK LSVVDE G RK+ALG ++LH+G  KH
Sbjct  714  VHGSPRKHLLGFEKIRLGEKEETVIRFNVDVCKDLSVVDEIGKRKIALGHYLLHVGSFKH  773

Query  235  SLTVEI  218
            SLT+ +
Sbjct  774  SLTISV  779



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   121 bits (303),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 62/127 (49%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C +      SA ++ + V+N G   G H+V LF++PP
Sbjct  653  LRLEENHVCRSSECQSLDAIGPHCENADSGNGSAFEVEVKVQNGGEREGIHTVFLFTTPP  712

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
             +H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+G LK
Sbjct  713  DVHGSPRKHLLGFEKIRLGKMEEAVVRFKVEICKDLSVVDEIGKRKIALGKHLLHVGDLK  772

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  773  HSLSIRI  779



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   121 bits (303),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V LF++PP
Sbjct  650  LRLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGEREGIHTVFLFTTPP  709

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
             +H +PRK L+GF+KVRL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+G LK
Sbjct  710  DVHGSPRKHLLGFEKVRLGKMEEAVVRFKVAVCKDLSVVDEVGKRKIGLGKHLLHVGDLK  769

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  770  HSLSIRI  776



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   120 bits (302),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            L L++ H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H 
Sbjct  654  LRLEENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTPPEVHG  713

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G LKHSL+
Sbjct  714  APRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLS  773

Query  226  VEI  218
            + I
Sbjct  774  IRI  776



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   120 bits (301),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            L L++ H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H 
Sbjct  654  LRLEENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTPPEVHG  713

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G LKHSL+
Sbjct  714  APRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDLKHSLS  773

Query  226  VEI  218
            + I
Sbjct  774  IRI  776



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCR-STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            + LD  H CR S  C SV+A EQ C  S   DIHL V+N     G HSVLLF +PP++HN
Sbjct  654  IPLDNDHVCRHSLDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHN  713

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            +PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L+
Sbjct  714  SPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLS  773

Query  226  VEI  218
            + I
Sbjct  774  LRI  776



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCR-STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            + LD  H CR S  C SV+A EQ C  S   DIHL V+N     G HSVLLF +PP++HN
Sbjct  654  IPLDDDHVCRHSLDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTPPSVHN  713

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            +PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ KH+L+
Sbjct  714  SPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNFKHTLS  773

Query  226  VEI  218
            + I
Sbjct  774  LRI  776



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL  413
            L L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF++PPA+
Sbjct  654  LRLEENHVCRSSECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLFTTPPAV  713

Query  412  HNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHS  233
            H +PRK L+GF+K+ L   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G LKHS
Sbjct  714  HGSPRKHLLGFEKISLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDLKHS  773

Query  232  LTVEI  218
            L++ I
Sbjct  774  LSIRI  778



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L+  H CRS++C+S++A    C        SA ++ + V+N G   G H+V LF++PP
Sbjct  658  LGLEDNHVCRSSECQSLEATGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFLFTTPP  717

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
            A+H +P+K L+GF+K+RL   E+ VV F V VCK LSVVDE G RK+ LG H+LH+G LK
Sbjct  718  AVHGSPKKHLLGFEKIRLGKMEEAVVRFKVKVCKDLSVVDEIGKRKIGLGKHLLHVGDLK  777

Query  238  HSLTVEI  218
            HSL++ I
Sbjct  778  HSLSIRI  784



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 61/123 (50%), Positives = 86/123 (70%), Gaps = 2/123 (2%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            L L + H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++PP +H 
Sbjct  654  LRLGENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGDREGIHTVFLFTTPPEVHG  713

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
            +PRK L+GF+K+RL   E+ VV F VDVCK L+VVDE G RK+ LG H+LH+G LKHSL+
Sbjct  714  SPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLNVVDEIGKRKIGLGQHLLHVGDLKHSLS  773

Query  226  VEI  218
            + I
Sbjct  774  IRI  776



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSP  422
            L+L++ H CRS++C+S+DA    C         +A ++ + V+N G   G H+V LF++P
Sbjct  664  LSLEENHVCRSSECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVFLFTTP  723

Query  421  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  242
            PA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +
Sbjct  724  PAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHVGDV  783

Query  241  KHSLTVEI  218
            KHSL++ I
Sbjct  784  KHSLSIRI  791



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   117 bits (294),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 61/128 (48%), Positives = 88/128 (69%), Gaps = 7/128 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSP  422
            L+L++ H CRS++C+S+ A    C         +A ++ + V+N G   G H+V LF++P
Sbjct  664  LSLEENHVCRSSECQSLKAIGPHCDNVVSGTGRTAFEVQIKVQNGGDREGIHTVFLFTTP  723

Query  421  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  242
            PA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +
Sbjct  724  PAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDV  783

Query  241  KHSLTVEI  218
            KHSL++ I
Sbjct  784  KHSLSIRI  791



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVLLFSSP  422
            L+L++ H CRS++C+S+DA    C         +A ++ + V+N G   G H+V LF++P
Sbjct  653  LSLEENHVCRSSECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVFLFTTP  712

Query  421  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  242
            PA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +
Sbjct  713  PAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLLHVGDV  772

Query  241  KHSLTVEI  218
            KHSL++ I
Sbjct  773  KHSLSIRI  780



>emb|CAB89360.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09525.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L LD+   CRS +C+S+DA    C       S  ++ L V+NVG   G  +V LF++PP 
Sbjct  286  LNLDESQSCRSPECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLFTTPPE  345

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+G LKH
Sbjct  346  VHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHVGSLKH  405

Query  235  SLTVEI  218
            S  + +
Sbjct  406  SFNISV  411



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASS-------ALDIHLNVKNVGTVSGGHSVLLFSSP  422
            L+L++ H CRS++C+S++A    C ++       A ++H+ V+N G   G H+V LF++P
Sbjct  653  LSLEENHVCRSSECQSLNAIGPHCDNAVSGTGGKAFEVHIKVQNGGDREGIHTVFLFTTP  712

Query  421  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  242
            PA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+G +
Sbjct  713  PAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHVGDV  772

Query  241  KHSLTVEI  218
            KHSL++ I
Sbjct  773  KHSLSIRI  780



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   117 bits (294),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = -2

Query  580   LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
             L LD  HPCRS+KC SVDA    C  + +++ L V N GT  G H+V LF +PPA+H +P
Sbjct  894   LGLDPSHPCRSSKCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPAVHRSP  952

Query  400   RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              K LV F+K+ L   E  VV F++DVCK LSVVDE G R++ALG +VLH+G LK+SL + 
Sbjct  953   VKHLVTFEKLLLGRTEIAVVRFDLDVCKDLSVVDETGKRQIALGEYVLHVGSLKYSLYIT  1012

Query  220   I  218
             I
Sbjct  1013  I  1013



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 90/135 (67%), Gaps = 14/135 (10%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCA------------SSALDIHLNVKNVGTVSGGHSVL  437
            L LDQ H CRS+ C+S+DA    C+            S+A ++H+ VKN G   G H+V 
Sbjct  647  LPLDQTHVCRSSDCQSLDAVGPHCSNAVADPNANASGSAAFEVHMKVKNSGEAEGTHTVF  706

Query  436  LFSSPP--ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLH  263
            LF++PP  ++  +PRK L+GF+KVRL   E++VV F ++VCK LS+VDE G RKV LG H
Sbjct  707  LFTTPPQSSVRGSPRKHLLGFEKVRLGKEEEKVVRFRIEVCKDLSLVDEFGTRKVVLGEH  766

Query  262  VLHIGHLKHSLTVEI  218
            VLH+G LKHSL+V +
Sbjct  767  VLHVGSLKHSLSVRV  781



>ref|NP_196532.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED91435.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=526

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLFSSPPA  416
            L LD+   CRS +C+S+DA    C       S  ++ L V+NVG   G  +V LF++PP 
Sbjct  401  LNLDESQSCRSPECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLFTTPPE  460

Query  415  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  236
            +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+G LKH
Sbjct  461  VHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHVGSLKH  520

Query  235  SLTVEI  218
            S  + +
Sbjct  521  SFNISV  526



>gb|ACH60354.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60358.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60359.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60360.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60362.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60368.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60370.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60371.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60373.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60374.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
macrocarpa]
Length=107

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            SV      C    LD+H++V+N G++ GGH VLLFSSPPA+H AP+K+L+GF+KV +   
Sbjct  1    SVKVENTKCEGLLLDLHMDVENTGSLDGGHVVLLFSSPPAVHAAPQKKLLGFRKVHVGAG  60

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
              E + F+VDVCK LSVVDE G +K+ALG H+LH+G +KHSL +EI
Sbjct  61   AKERLHFSVDVCKDLSVVDEIGVKKLALGSHLLHVGDVKHSLNIEI  106



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   115 bits (289),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L LD  HPCRS+KC SVDA    C  + +++ L V N GT  G H+V LF +PPA+H +P
Sbjct  655  LGLDPSHPCRSSKCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPAVHRSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             K LV F+K+ L   E  VV F +DVCK LSVVDE G R++ALG +VLH+G L +SL + 
Sbjct  714  VKHLVTFEKLLLGRTEMAVVRFELDVCKDLSVVDETGKRQIALGEYVLHVGSLTYSLYIT  773

Query  220  I  218
            I
Sbjct  774  I  774



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   115 bits (288),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = -2

Query  580  LALDQGHPCR---STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALH  410
            + LDQ HPCR   S+ C S+D+AE    +   D+ L V+N G + G H+VLLF S P +H
Sbjct  640  IPLDQKHPCRRRSSSNCTSIDSAEVCNLNLGFDLQLKVRNEGGMGGSHTVLLFVSTPRVH  699

Query  409  NAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSL  230
            +AP K+L+GF K+ L    + V  F +DVC+HLSVVDE G RK+ LG HVLH+G  KHS 
Sbjct  700  DAPEKRLLGFDKLHLGGWGEGVARFRIDVCEHLSVVDEFGKRKLGLGEHVLHVGGSKHSF  759

Query  229  TVEI  218
             V I
Sbjct  760  NVAI  763



>gb|ACH60351.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60352.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60353.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60355.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60356.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60357.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60361.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60363.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60364.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60365.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60366.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60367.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60369.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
 gb|ACH60372.1| alpha-L-arabinofuranosidase/beta-D-xylosidase, partial [Pseudotsuga 
menziesii]
Length=107

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            SV      C    LD+H++V+N G++ GGH VLLFSSPPA+H AP+K+L+GF+KV +   
Sbjct  1    SVKVENTKCEGLLLDLHIDVQNTGSLDGGHVVLLFSSPPAVHGAPQKKLLGFRKVHVGAG  60

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
              E + F+VDVCK LSVVDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  61   AKERLHFSVDVCKDLSVVDEIGVKKLALGSHLLHVGDVEHSLNIQI  106



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 86/125 (69%), Gaps = 6/125 (5%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSA------LDIHLNVKNVGTVSGGHSVLLFSSPP  419
            L L++ H C S++C+S+DA    C ++A       ++ L V N G   G H+V LF++PP
Sbjct  653  LNLEESHACLSSECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGTHTVFLFTTPP  712

Query  418  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  239
             +H +P K L+GF+KVRL  +E+ +V FNVDVCK LSVVDE G RK+ALG H+LH+G LK
Sbjct  713  EVHGSPVKHLLGFEKVRLGKSEEAMVRFNVDVCKDLSVVDEIGTRKIALGHHLLHVGSLK  772

Query  238  HSLTV  224
            HSL +
Sbjct  773  HSLNI  777



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 86/128 (67%), Gaps = 7/128 (5%)
 Frame = -2

Query  580  LALDQGHPC-RSTKCESVDAAEQTCASSA------LDIHLNVKNVGTVSGGHSVLLFSSP  422
            L L++ H C  S++C+S+DA    C ++A       ++ L V N G   G H+V LF++P
Sbjct  653  LNLEESHACLSSSECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGSHTVFLFTTP  712

Query  421  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  242
            P +H +P K L+GF+KVRL  +E+ +V F V+VCK LSVVDE G RK+ALG H+LH+G L
Sbjct  713  PEVHGSPVKHLLGFEKVRLRKSEEAMVRFKVNVCKDLSVVDEIGTRKIALGHHLLHVGSL  772

Query  241  KHSLTVEI  218
            KHSL + +
Sbjct  773  KHSLNITV  780



>gb|AFG54601.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  371
            +  C SV      C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV
Sbjct  17   NNSCTSVHVENTKCQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKV  76

Query  370  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             +     E V F++DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  77   HVGAGATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>gb|AFG54595.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54597.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54598.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54599.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54600.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54605.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54606.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54607.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54608.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54610.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  371
            +  C SV      C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV
Sbjct  17   NNSCTSVHVENTKCQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKV  76

Query  370  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             +     E V F++DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  77   HVGAGATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>gb|AFG54602.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54603.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54604.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
 gb|AFG54609.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 72/111 (65%), Gaps = 0/111 (0%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  371
            +  C SV      C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV
Sbjct  17   NNSCTSVHVENTKCQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKV  76

Query  370  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
             +     E V F +DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  77   HVGAGATERVQFGIDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>gb|AFG54596.1| hypothetical protein 0_6952_01, partial [Pinus taeda]
Length=128

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            SV      C     DIH++V N G   GGH+VLLF SPP +H +P+K L+ F+KV +   
Sbjct  22   SVHVENTKCQGLLFDIHMDVHNTGNRDGGHAVLLFFSPPTIHRSPQKSLMDFRKVHVGAG  81

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
              E V F++DVCK LS+VDE G +K+ALG H+LH+G ++HSL ++I
Sbjct  82   ATERVQFSIDVCKDLSIVDEIGVKKLALGSHILHVGDVQHSLNLQI  127



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -2

Query  580  LALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAP  401
            L L + HPCR++KC+SVDA    C  + +++ L V+N G   G  +V LF++PPA+H +P
Sbjct  655  LGLAKSHPCRTSKCQSVDATGPYCGKT-IEVELRVRNAGEREGTDTVFLFTTPPAVHRSP  713

Query  400  RKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHV  260
             K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALGL++
Sbjct  714  VKHLLAFEKVRLGKKEKAVVRFNVDVCKDLSVVDETGKRKIALGLNM  760



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LDIH++VKN GT+ G H++L+F++PPA   AP KQLVGF KV +    
Sbjct  665  VRVSHTNCDSLSLDIHVDVKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHKVHIVAGS  724

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  725  ERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LDIH+++KN GT+ G H++L+F++PPA   AP KQLVGF KV +    
Sbjct  665  VRVSYTNCDSLSLDIHVDIKNTGTMDGTHTLLVFATPPAEKWAPNKQLVGFHKVHIVAGL  724

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  725  ERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF KV +    
Sbjct  665  VRVSHINCDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHKVHIVAGS  724

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  725  ERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C S +LDIH++VKN GT+ G H++L+F +PPA   AP KQLVGF KV +    +  V   
Sbjct  672  CDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKWAPNKQLVGFHKVHIVAGSERRVRVG  731

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            V VCKHLSVVD+ G R++ LG H L IG LKH ++VE
Sbjct  732  VHVCKHLSVVDKFGIRRIPLGEHKLEIGDLKHHVSVE  768



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            +  +   C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF KV +    
Sbjct  663  IRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHKVHIVAGS  722

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLSVVDE G R++ LG H L IG L+H ++VE
Sbjct  723  ERRVRVGVQVCKHLSVVDELGIRRIPLGQHKLEIGDLQHHVSVE  766



>emb|CDP17082.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL-HNAPRKQLVGFQK  374
            S   +++      C+  ++ +H++VKNVG + G H++L+FSSPP   H AP KQLV F+K
Sbjct  76   SVSSKAIKVTHARCSRLSIGVHVDVKNVGGMDGSHTLLVFSSPPGSGHWAPHKQLVAFEK  135

Query  373  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            V +     + V   + VCK+LSVVD AG R++ +GLH LHIG + HS++++
Sbjct  136  VHVPARAQQRVFLKIHVCKYLSVVDRAGIRRIPMGLHSLHIGPITHSISLQ  186



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            + AA   C +++L IH+N++N G++ G H++L+FS+PP    +P +QL+GF+KV +S   
Sbjct  681  IRAAHVNCNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGKWSPARQLIGFEKVHVSAGS  740

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               V  +V VC+HLSVVDE G R++ +G H LH+G ++HS+T++
Sbjct  741  QRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSMTLQ  784



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            +  +   C S +LD+H+++KN GT+ G H++L+F++PP    AP KQLVGF KV +    
Sbjct  663  IRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFATPPTGKWAPNKQLVGFHKVHIVAGS  722

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLSVVD  G R++ LG H L IG L+H ++VE
Sbjct  723  ERRVRVGVQVCKHLSVVDXXGIRRIPLGQHKLEIGDLQHHVSVE  766



>gb|KCW61272.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=749

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/104 (43%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            + AA   C +++L IH+N++N G++ G H++L+FS+PP    +P +QL+GF+KV +S   
Sbjct  642  IRAAHVNCNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGKWSPARQLIGFEKVHVSAGS  701

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               V  +V VC+HLSVVDE G R++ +G H LH+G ++HS+T++
Sbjct  702  QRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSMTLQ  745



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            +V      C S +L  H++V+N GT+ G H++L+FS+PPA   +P KQL+GF +V +   
Sbjct  664  AVRVKHANCDSLSLPFHIDVQNTGTIDGTHTLLVFSTPPAGKWSPNKQLIGFHRVHVLAG  723

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              + V  N+  CKHLS+VDE G R++ +G H LHIG L+HS++++
Sbjct  724  SQQRVEINIHACKHLSIVDELGIRRIPMGAHSLHIGDLEHSISLQ  768



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    
Sbjct  663  VRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGS  722

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  723  ERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    
Sbjct  663  VRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGS  722

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  723  ERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -2

Query  532  VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPne  353
            V  +   C S +LD H+++KN GT+ G H++L+F++ PA   AP KQLVGF KV +    
Sbjct  663  VRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFATQPAGKWAPNKQLVGFHKVHIVAGS  722

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +  V   V VCKHLS+VD+ G R++ LG H L IG LKH +++E
Sbjct  723  ERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGDLKHYVSIE  766



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRL  365
            +++      C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+KV +
Sbjct  633  KAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFEKVHI  692

Query  364  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                 + V   + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  693  PAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  740



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRL  365
            +++      C   ++++H++VKNVG+  G H++L+FS+PPA   H AP KQLV F+KV +
Sbjct  656  KAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFEKVHI  715

Query  364  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                 + V   + VCK LSVVD +G R++ +GLH LHIG +KHS++++
Sbjct  716  PAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIGDVKHSVSLQ  763



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 50/122 (41%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = -2

Query  580  LALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN  407
            + +D  H   S+    +S+      C+  ++ IH++VKNVG   G H++L+FS PP    
Sbjct  644  IPIDGRHTSNSSTITNKSIRVTHTKCSKLSIQIHIDVKNVGPKDGSHTLLVFSKPPVDVW  703

Query  406  APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLT  227
             P KQLV FQKV +     + V  N+ VCK+LSVVD+AG R++++G H +HIG  KHSL+
Sbjct  704  VPHKQLVAFQKVYVPARSKQRVAINIHVCKYLSVVDKAGVRRISIGEHSIHIGDAKHSLS  763

Query  226  VE  221
            ++
Sbjct  764  LQ  765



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -2

Query  535  SVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            ++  A   C  + +L +H++VKN G ++G H++L+F+ PPA + +P KQL+GF+KV ++ 
Sbjct  656  AIRVAHTNCNDAMSLGLHVDVKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTA  715

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  716  GALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  761



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 77/122 (63%), Gaps = 3/122 (2%)
 Frame = -2

Query  574  LDQGHPC---RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            LD  H C    +  C++V  +   C+   + +H++V N+G + G H V ++S+PP  H A
Sbjct  644  LDGKHGCFRNDTVSCQAVRVSHTRCSGLFMSLHIDVNNIGPMDGSHVVFVYSTPPQGHGA  703

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            P KQLVGF+++ L  N  +   F++DVC+ LS+VD+ G +K+ +G H+  +G L HS+++
Sbjct  704  PSKQLVGFRRIHLPSNSQQQARFDIDVCRDLSIVDQFGLKKLPIGSHLFQVGELTHSVSL  763

Query  223  EI  218
            ++
Sbjct  764  QL  765



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 48/110 (44%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP-ALHNAPRKQLVGFQK  374
            ST  +++      C   ++ +H++VKN G+  G HS+L+FSSPP A H  P+KQLV F+K
Sbjct  655  STSGKAIKVTHAKCDGLSVVLHVDVKNAGSKDGSHSLLVFSSPPPAEHWVPQKQLVAFEK  714

Query  373  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            V L     + V   + +CK LSVVD+ G R++ LG HVLHIG++ HS+ +
Sbjct  715  VHLPAGSQQRVQITIHLCKFLSVVDKLGIRRIPLGQHVLHIGNIHHSIVL  764



>emb|CDO98788.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            ++V  +   C +  L +H +V+NVG   G HS+L+FS+PPA   AP KQLV F+KV +  
Sbjct  657  DAVRVSHSNCDAMKLGMHFDVQNVGERDGSHSLLVFSTPPAGKWAPAKQLVAFEKVHVLA  716

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + +  + D CKHLSVVD  G R++ +G+H L IG L+H++T++
Sbjct  717  GAQQRISVHFDACKHLSVVDRFGIRRIPMGVHSLQIGDLEHAITLQ  762



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = -2

Query  547  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  368
            T  +++      C+  ++ +H++VKNVG+  G  ++L+FS PP    AP KQLV FQKV 
Sbjct  656  TTSKAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPIGLWAPHKQLVAFQKVH  715

Query  367  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +     + V  N+ VCK+LSVVD+AG R++ +G H LHIG  KHSL+++
Sbjct  716  VPAGSLQRVAINIHVCKYLSVVDKAGVRRIPIGEHSLHIGDAKHSLSLQ  764



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  562  HPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQL  389
            H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL
Sbjct  645  HVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQL  704

Query  388  VGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+IG LKHS++++
Sbjct  705  IGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISLQ  760



>gb|KDO71842.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=369

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  499  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  320
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  269  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  328

Query  319  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  329  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  361



>gb|ABK96385.1| unknown [Populus trichocarpa x Populus deltoides]
Length=343

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -2

Query  562  HPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQL  389
            H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL
Sbjct  220  HVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQL  279

Query  388  VGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            +GF+KV L     + V  ++ VCKHLSVVD  G R++  G H L+IG LKHS++++
Sbjct  280  IGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPNGEHYLYIGDLKHSISLQ  335



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +++      C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV +  
Sbjct  656  KAIKVTHAKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKVHVPA  715

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
               + V  N+ VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  716  GAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  760



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +S+      C+  ++ IH++VKNVG   G H++L+FS PP     P KQLV FQKV +  
Sbjct  660  KSIRVTHAKCSKISVQIHVDVKNVGPKDGSHTLLVFSKPPVDIWVPHKQLVAFQKVYVPA  719

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V  N+ VCK+LSVVD AG R++ +G H +HIG  KHSL+++
Sbjct  720  RSKQRVAINIHVCKYLSVVDRAGVRRIPIGEHSIHIGDAKHSLSLQ  765



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/115 (43%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  562  HPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQL  389
            H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSPP    + +KQL
Sbjct  644  HVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSPPGGKWSTQKQL  703

Query  388  VGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            +GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+IG LKHS+++
Sbjct  704  IGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDLKHSISL  758



>gb|AEW09080.1| hypothetical protein CL3618Contig1_02, partial [Pinus lambertiana]
Length=86

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  484  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  305
            + V NVG   GGH + LFSSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSRHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  304  VDEAGNRKVALGLHVLHIGHLKHSLT  227
            VD+ G RK+ +G H+LHIG L+HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDLQHSVS  86



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +++      C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+KV ++ 
Sbjct  656  KAIRVTHARCNKLSLGMQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAA  715

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V  N+ VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  716  GTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>gb|KDO71849.1| hypothetical protein CISIN_1g0062242mg [Citrus sinensis]
Length=415

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -2

Query  550  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  374
            +    ++  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+K
Sbjct  297  TISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKK  356

Query  373  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            V ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  357  VHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  407



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            ++V      C   ++ +H++VKN G + G HS+L+FS PP    AP KQLV F+KV +  
Sbjct  662  KAVRVTHAKCDGLSVVVHVDVKNTGPMDGAHSLLVFSEPPTGQWAPSKQLVAFEKVHVPA  721

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              ++ V   +  CKHLSVVD  G R++ +G H LHIG +KHS++++
Sbjct  722  GTEQRVEVKIHACKHLSVVDRFGIRRIPMGEHSLHIGDVKHSVSLQ  767



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            ++V      C S +L IH++V+N G   G H++L+FS+PP    A  KQLVGFQKV L+ 
Sbjct  669  KAVRVTHTDCNSLSLRIHIDVENNGPTDGTHTLLIFSTPPTHKWAAHKQLVGFQKVHLAA  728

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  221
               + V+  V VCKHLS+VD+ G R++ +G H LHIG  LKHS++ +
Sbjct  729  GSRQRVILGVHVCKHLSIVDQFGIRRIPMGEHTLHIGDDLKHSISFQ  775



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            +V      C   +L + ++VKN G+  G H++L+F+SPP    AP KQLV F+KVR++  
Sbjct  644  AVRVTHARCKGLSLSVGMDVKNTGSRDGSHTLLVFASPPGGGWAPHKQLVAFEKVRVAAG  703

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              E V   + VCK LSVVD AG R++ +G+H LHIG +KHS++++
Sbjct  704  GQERVAVRIHVCKFLSVVDGAGIRRIPMGVHALHIGGVKHSVSLQ  748



>gb|KDO71844.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=485

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  499  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  320
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  385  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  444

Query  319  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  445  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  477



>gb|KDO71843.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=476

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -2

Query  550  STKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQK  374
            +    ++  A   C  + +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+K
Sbjct  358  TISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKK  417

Query  373  VRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            V ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  418  VHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  468



>gb|KDO71845.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71846.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71847.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71848.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=486

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = -2

Query  499  ALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVC  320
            +L +H+++KN G ++G H++L+F+ PPA + +P KQL+GF+KV ++    + V  ++ VC
Sbjct  386  SLGLHVDIKNTGDMAGTHTLLVFAKPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVC  445

Query  319  KHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            KHLSVVD+ G R++ +G H LHIG LKHS++++
Sbjct  446  KHLSVVDKFGIRRIPMGEHSLHIGDLKHSISLQ  478



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 0/115 (0%)
 Frame = -2

Query  565  GHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  386
            G    +T  +++      C+  ++ +H++VKNVG+  G  ++L+FS PP     P KQLV
Sbjct  647  GRHASNTTSKAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPVGLWVPHKQLV  706

Query  385  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             FQKV +     + V  N+ VCK+LSVVD AG R++ +G H LHIG  KH+L+++
Sbjct  707  AFQKVYVPAGSLQRVTINIHVCKYLSVVDRAGVRRIPIGEHSLHIGDAKHTLSLQ  761



>ref|XP_010652235.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Vitis vinifera]
Length=626

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  565  GHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  386
            GH   +   +++      C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV
Sbjct  503  GHHNTTVSGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLV  562

Query  385  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  563  AFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  617



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA-LHNAPRKQLVGFQKVRLS  362
            +++      C S +L +H++V+N+G + G H++LLFS PPA +  +P KQL+ F +V + 
Sbjct  660  KAIRVKHTNCDSLSLPLHIDVENIGNMDGTHTLLLFSEPPAAVKWSPNKQLISFHRVHVI  719

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                + V  NV  CKHLSVVDE G R++ +G H L+IG LKHS++++
Sbjct  720  AGSKQRVKINVHACKHLSVVDEFGIRRIPMGQHSLYIGDLKHSISLQ  766



>gb|KJB49844.1| hypothetical protein B456_008G140600 [Gossypium raimondii]
Length=774

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   ++ + +NVKN G+  G H++L+FS+PPA H AP KQLV F KV +    ++ V  +
Sbjct  669  CNKLSVGLQVNVKNTGSKDGTHTMLVFSTPPAGHWAPSKQLVAFAKVYVPARSEQQVGIS  728

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  729  IHVCKFLSVVDRSGVRRIPIGLHRIHIGDVKHSVSLE  765



>gb|AEW09079.1| hypothetical protein CL3618Contig1_02, partial [Pinus radiata]
Length=86

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  484  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  305
            + V NVG   GGH + LFSSPP+ H+AP+KQL+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSKHHAPKKQLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  304  VDEAGNRKVALGLHVLHIGHLKHSLT  227
            VD+ G RK+ +G H+LHIG ++HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDVQHSVS  86



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            S+  +   C    L +H++VKN G + G H++L+FSSPP    +  K+L+GF+KV L   
Sbjct  656  SIRVSHANCEPLVLGVHIDVKNAGDMDGTHTLLVFSSPPEGKWSTNKKLIGFEKVHLVAG  715

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              + V  ++ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  716  SKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  760



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  565  GHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLV  386
            GH   +   +++      C   ++ +HL+VKNVG   G H++L+FS PPA H AP KQLV
Sbjct  645  GHHNTTVSGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGHWAPHKQLV  704

Query  385  GFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH ++++
Sbjct  705  AFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKHLVSLQ  759



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  371
            S   +++      C   +L +H++VKN G+  G H++L+FS PPA   AP+KQLV F++V
Sbjct  647  SASGKAIRVTHARCGQLSLMVHVDVKNEGSKDGAHTLLVFSRPPAGKWAPQKQLVAFERV  706

Query  370  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             L     + V  ++ VCK+LSVVD++G R++ LG H +HIG+ +HS++++
Sbjct  707  HLPAGSQQRVRVHIHVCKYLSVVDKSGIRRIPLGDHHIHIGNARHSISLK  756



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRL  365
            +++      C   ++ + ++VKNVG+  G H++L+FS+PPA   H AP KQLV FQK+ +
Sbjct  655  KAIKVTHARCGKLSISLQVDVKNVGSKDGTHTLLVFSAPPAGNGHWAPHKQLVAFQKLHI  714

Query  364  SPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                 + V  N+ VCK LSVVD +G R+V +GLH LHIG +KH ++++
Sbjct  715  PSKAQQRVNVNIHVCKLLSVVDRSGTRRVPMGLHSLHIGDVKHYVSLQ  762



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  655  KSVRVTHARCDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  714

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG  +H+++++
Sbjct  715  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDERHTVSLQ  760



>gb|KDO87030.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
 gb|KDO87031.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
Length=544

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C    L + ++VKNVG+  G H++L+FS+PPA H AP KQLV F+KV +     + V  N
Sbjct  439  CNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHWAPHKQLVAFEKVHVPAGAQQRVGIN  498

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            + VCK+LSVVD +G R++ LG H +HIG  KHS+++
Sbjct  499  IHVCKYLSVVDRSGTRRIPLGEHNIHIGGTKHSVSL  534



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            S+      C   AL +H++VKN G+  G H++L+FSSPP    AP+KQLV F+KV +   
Sbjct  678  SIRVNHAKCERLALRVHVDVKNTGSRDGSHTLLVFSSPPGGDWAPQKQLVAFEKVSVRAG  737

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              + +  ++ VCK+LSVVD  G R++ +G H LHIG  +H++++E
Sbjct  738  GQQRIGVSIRVCKYLSVVDRFGVRRIPMGEHGLHIGDARHAVSLE  782



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H+++KNVGT  G H++L+FS+PP+   APRKQLV F +V ++ 
Sbjct  653  KSVRVTHARCNRLSLGVHVDIKNVGTRDGTHTMLVFSAPPSGEWAPRKQLVAFTRVHVAA  712

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E++ V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  713  GENKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  758



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +++      C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++ 
Sbjct  656  KAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEKVHVTA  715

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                 V  NV VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  716  GTQRRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>ref|XP_006306830.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39728.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=625

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  511  KSVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  570

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  571  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  616



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H+++KNVGT  G H++L+FS+PP    APRKQLV F +V ++ 
Sbjct  653  KSVRVTHARCNRLSLGVHVDIKNVGTRDGTHTMLVFSAPPGGEWAPRKQLVAFTRVHVAA  712

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E++ V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  713  GENKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  758



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +++      C   +  + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++ 
Sbjct  656  KAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHWAPLKQLVAFEKVHVAA  715

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V  NV VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  716  GTQQRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGDVKHSVSLQ  761



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   +L + ++VKN+G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  665  CNKLSLGVQVDVKNIGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAAGTQQRVGIN  724

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  725  IHVCKSLSVVDASGIRRIPMGEHSLHIGDVKHSVSLQ  761



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +S+      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  649  KSIRVTHARCNRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  708

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  709  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  754



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLVGFQKVRLSPnedevvvf  335
            C S +   H++V+N G + G H++L+FS+PPA    +P KQL+GF +V +     + V  
Sbjct  667  CDSLSSLFHIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLIGFHRVHVVAGSKQRVKI  726

Query  334  nvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            N+  CKHLSVVDE G R++ +G H LHIG LKHS++++
Sbjct  727  NIHACKHLSVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H+++KNVG+  G H++L+FS+PP+   APRKQLV F +V ++ 
Sbjct  648  KSVRVTHARCNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPSGEWAPRKQLVAFTRVHVAT  707

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  708  GESKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDESHTVSLQ  753



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  655  KSVRVTHARCDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  714

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG  +H+++++
Sbjct  715  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDERHTVSLQ  760



>gb|KHG28205.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=529

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   ++ + +NVKN G+  G H++L+FS PPA H AP KQLV F KV +    ++ V  +
Sbjct  424  CNKLSVGLQVNVKNTGSKDGTHTILVFSIPPAGHWAPSKQLVAFAKVYVLARSEQQVGIS  483

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++ +GLH +HIG +KHS+++E
Sbjct  484  IHVCKFLSVVDRSGVRRIPIGLHHIHIGDVKHSVSLE  520



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  535  SVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L  
Sbjct  657  TVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVHLIA  716

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V   + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  717  GSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  762



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H+++KNVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  652  KSVRVTHARCNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAA  711

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  712  GEMKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDETHTVSLQ  757



>gb|ADV41671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Actinidia deliciosa 
var. deliciosa]
Length=634

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  362
            ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++
Sbjct  520  KAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIA  579

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  580  AGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  626



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPAL--HNAPRKQLVGFQKVRLSPnedevvv  338
            C   +L +H++VKNVG+  G H++L+FS+PP    H AP KQLV FQKVR++    + V 
Sbjct  672  CNRLSLGLHVDVKNVGSRDGSHTLLVFSTPPTENGHWAPLKQLVAFQKVRVAAGSQQRVR  731

Query  337  fnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             ++ VCK+LSVVD +G R++ +G H +HIG  +HS++++
Sbjct  732  ISIHVCKYLSVVDRSGIRRLPMGEHNIHIGDARHSVSLQ  770



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  362
            ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++
Sbjct  661  KAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIA  720

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               ++ V   V  CKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  721  AGSEKRVRIAVHACKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_002276351.1| PREDICTED: putative beta-D-xylosidase [Vitis vinifera]
Length=770

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            ++  +   C +  L  H++VKN GT+ G H++LLFS+PP    +P K+L+ F+KV +   
Sbjct  657  AIRISHANCNTQPLGFHIDVKNTGTMDGSHTLLLFSTPPPGTWSPNKRLLAFEKVHVGAG  716

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              E V F+V VCKHLSVVD  G  ++ +G H  HIG LKHS++++
Sbjct  717  SQERVRFDVHVCKHLSVVDHFGIHRIPMGEHHFHIGDLKHSISLQ  761



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  362
            ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++
Sbjct  661  KAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIA  720

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  721  AGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  362
            ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQLVGF K+ ++
Sbjct  661  KAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWAASKQLVGFHKIHIA  720

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               +  V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  721  AGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +SV      C   +L +H++V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  654  KSVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  713

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  714  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  759



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F KV +       V  N
Sbjct  671  CNKLSVGLQVDVKNTGSKEGTHTMLVFSKPPAGHWAPQKQLVAFAKVHVPARSQRRVGIN  730

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++  G+H LHIG  KHSL+++
Sbjct  731  IHVCKFLSVVDRSGVRRIPTGVHNLHIGGAKHSLSLQ  767



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/90 (47%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = -2

Query  487  HLNVKNVGTVSGGHSVLLFSSPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdVCKHL  311
            H++V+N G + G H++L+FS+PPA    +P KQL+GF +V +     + V  N+  CKHL
Sbjct  675  HIDVENTGNMDGTHTLLVFSTPPAGQKWSPNKQLIGFHRVHVIAGSKQRVKINIHACKHL  734

Query  310  SVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            SVVDE G R++ +G H LHIG LKHS++++
Sbjct  735  SVVDEFGIRRIPMGSHSLHIGDLKHSISLQ  764



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = -2

Query  565  GHPCRST-KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQL  389
            GH   +T   +++      C   +L + ++VKNVG+  G +++L++S+PPA   AP KQL
Sbjct  648  GHRGNTTISGKAIRVTHTKCNRLSLGLQVDVKNVGSKDGTYTLLVYSTPPAGLWAPHKQL  707

Query  388  VGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            V F+KV ++    + V  N+ VCK+LSVVD+ G R++ +GLH LHIG ++HS++++
Sbjct  708  VAFEKVHVAAGSQQRVGINIHVCKYLSVVDKYGIRRIPIGLHSLHIGDIEHSVSLQ  763



>gb|AFG60329.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60330.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60331.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60332.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60333.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60334.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60335.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60336.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60337.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60338.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60339.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60340.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60341.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60342.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60343.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60344.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60345.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
 gb|AFG60346.1| hypothetical protein CL3618Contig1_02, partial [Pinus taeda]
Length=86

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  484  LNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSV  305
            + V NVG   GGH + LFSSPP+ H+AP+K L+GF+K+ L     E V F ++VCK LS+
Sbjct  1    VEVSNVGRREGGHVLFLFSSPPSKHHAPKKLLLGFRKLHLQAGAMEKVHFTLNVCKDLSI  60

Query  304  VDEAGNRKVALGLHVLHIGHLKHSLT  227
            VD+ G RK+ +G H+LHIG ++HS++
Sbjct  61   VDKTGTRKLPVGSHLLHIGDIQHSVS  86



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +S+      C   +L + ++V+N G+  G H++L+FS+PP    AP KQL+ F+KV+++ 
Sbjct  657  KSIRVTHARCNRLSLVVSVDVRNTGSKDGSHTLLVFSTPPRGLGAPHKQLITFEKVKVAA  716

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               E V   + VCK+LSVVD AG R++ +G H LHIG ++H++++E
Sbjct  717  GGQERVPIKIHVCKYLSVVDGAGVRRIPMGEHALHIGDIRHAISLE  762



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            +V      C S  +D+H++VKN G + G H+VL+FS+PP       KQLV F+KV +   
Sbjct  660  TVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLVAFEKVHVVAG  717

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  221
              + V  N++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  718  AKQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  763



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   +L + ++VKN G++ G H++L++S PPA H AP KQLV F+KV ++    + V  N
Sbjct  660  CNRLSLGMQVDVKNTGSMDGTHTLLVYSRPPARHWAPHKQLVAFEKVHVAAGTQQRVGIN  719

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++ +G H LHIG +KHS++++
Sbjct  720  IHVCKSLSVVDGSGIRRIPMGEHSLHIGDVKHSVSLQ  756



>ref|XP_010313018.1| PREDICTED: slArf/Xyl1 protein isoform X1 [Solanum lycopersicum]
Length=633

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            +V      C S  +D+H++VKN G + G H+VL+FS+PP       KQLV F+KV +   
Sbjct  522  TVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVLIFSTPP--DPTETKQLVAFEKVHVVAG  579

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  221
              + V  N++ CKHLSV DE G R++ +G H +H+G HLKHS+T +
Sbjct  580  AKQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDHLKHSITFQ  625



>ref|XP_010671663.1| PREDICTED: beta-D-xylosidase 1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -2

Query  547  TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVR  368
            TKC++         +++L +H++VKN G   G H+VL+FSSPP    A  K L+GF+KV 
Sbjct  663  TKCDT---------TTSLSLHIDVKNTGEADGSHTVLVFSSPPRGAQASEKHLIGFKKVH  713

Query  367  LSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVEI  218
            +     E V  N+ VCKHLS  DE G R++ +G H LHIG  +KH L++++
Sbjct  714  VLAGSLERVRMNIHVCKHLSTADEFGIRRIQMGEHTLHIGDDIKHQLSLQV  764



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 56/122 (46%), Positives = 73/122 (60%), Gaps = 8/122 (7%)
 Frame = -2

Query  580  LALDQGHPC-RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNA  404
            L L   H C  S  C+++DA    CA++  D +       T SG   V     P A+  +
Sbjct  636  LPLPPTHSCVSSADCQTLDAVGPHCANTNADAN------ATCSGAFDVXT-PPPSAVKGS  688

Query  403  PRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            PRK L+GF+KVRL   E+ VV F V+VCK LSVVDEAG RK+ LG HVL +G+LKHSL +
Sbjct  689  PRKHLLGFEKVRLGKGEEAVVRFRVEVCKDLSVVDEAGKRKIVLGDHVLRVGNLKHSLKI  748

Query  223  EI  218
             +
Sbjct  749  RV  750



>ref|XP_008458374.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Cucumis 
melo]
Length=768

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -2

Query  535  SVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L  
Sbjct  655  AVKVSHTDCASVSDLPIQVDVKNTGTVDGSHTILVFSTAPNPIWSPEKHLIGFEKVHLMA  714

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
               + V   + VC HLS VDE G R++  G H LHIG L HS+++
Sbjct  715  GSQKRVRIGIHVCDHLSRVDEFGTRRIPTGEHKLHIGDLTHSISL  759



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +S+      C   +L +H+ V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  654  KSIRVTHARCDRLSLGVHVEVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  713

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  714  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  759



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  538  ESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLS  362
            ++V  +   C A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++
Sbjct  661  KAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIA  720

Query  361  PnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               ++ V   V VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  721  AGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  767



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +S+      C   +L +H+ V NVG+  G H++L+FS+PP    AP+KQLV F++V ++ 
Sbjct  649  KSIRVTHARCDRLSLGVHVEVTNVGSRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAV  708

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H+++++
Sbjct  709  GEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESHTVSLQ  754



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   ++ + ++VKN G+  G H++L+FS PPA H AP+KQLV F KV +       V  N
Sbjct  692  CNKLSVGLQVDVKNTGSKDGTHTMLVFSKPPAGHWAPQKQLVAFAKVLVPARSQRRVGIN  751

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++  G+H LHIG +KH L+++
Sbjct  752  IHVCKFLSVVDRSGVRRIPTGVHNLHIGGIKHPLSLQ  788



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 43/98 (44%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C +  L IH++VKN G + G H+VL+FS+PP       KQL+GF+KV +     + V  +
Sbjct  663  CDTLILGIHIDVKNTGDMDGTHTVLVFSTPPVGKWGANKQLIGFKKVHVVARGRQRVKIH  722

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVEI  218
            V VC  LSVVD+ G R++ +G H LHIG +KHS+++++
Sbjct  723  VHVCNQLSVVDQFGIRRIPIGEHSLHIGDIKHSISLQV  760



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C    + + ++VKN G+  G H++L+FS+ PA H AP+KQLV F KVR+     + +  N
Sbjct  713  CNKLTIGLQVDVKNTGSKDGTHTMLVFSTTPAGHWAPQKQLVAFAKVRVPAGAQQRIGIN  772

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + VCK LSVVD +G R++ +G+H LHIG++KHS++++
Sbjct  773  IHVCKFLSVVDGSGVRRIPIGVHNLHIGNVKHSVSLQ  809



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            ++  +   C S  L + L+VKN G+V G  ++L+FSSPP    +  KQL+GF+K+ L   
Sbjct  663  AIRVSHTNCESLLLGLDLDVKNTGSVDGTQTLLVFSSPPEGKWSSNKQLIGFEKIHLVAG  722

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              + V  N+ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  723  SQKQVRINIHVCKHLSVVDRFGIRRIPIGKHHLHIGDLKHSISLQ  767



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            S+  +   C    L +H++VKN G + G  ++L+FSSPP    +  K+L+GF+KV +   
Sbjct  659  SIRVSHANCEPLVLGVHIDVKNTGDMDGIQTLLVFSSPPEGKWSANKKLIGFEKVHIVAG  718

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
              + V  ++ VCKHLSVVD  G R++ +G H LHIG LKHS++++
Sbjct  719  SKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDLKHSISLQ  763



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  568  QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA--LHNAPRK  395
            Q H   +   +++      C   +L IH++V+N G   G H++L+FS+PPA      PRK
Sbjct  647  QTHSASTLSGKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFSTPPANGATWVPRK  706

Query  394  QLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            QLV F+K+ LS  E   +  +V +CK+LSVVD+ G R++ LG HV+HIG +KH+++++
Sbjct  707  QLVAFEKLHLSSKEKRRLQVHVHICKYLSVVDKLGVRRIPLGDHVIHIGDVKHTISLQ  764



>ref|XP_004172482.1| PREDICTED: beta-D-xylosidase 1-like, partial [Cucumis sativus]
Length=534

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  535  SVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P    +P K L+GF+KV L  
Sbjct  421  TVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVPNQTWSPEKHLIGFEKVHLIA  480

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
               + V   + VC HLS VDE G R++ +G H LHIG L HS++++
Sbjct  481  GSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLTHSISLQ  526



>ref|XP_010522822.1| PREDICTED: probable beta-D-xylosidase 2 [Tarenaya hassleriana]
Length=767

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -2

Query  538  ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSP  359
            ++V      C+  +L +H++VKNVG+  G H++L+FS+PPA   AP +QLV F++V ++ 
Sbjct  653  KAVRVTHAKCSRLSLGVHVDVKNVGSRDGTHTMLVFSAPPAGRWAPHRQLVAFERVHVAA  712

Query  358  nedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H+++++
Sbjct  713  GEKKRVPINIHVCKYLSVVDRAGVRRIPIGDHNIHIGDATHTVSLQ  758



>emb|CBI22910.3| unnamed protein product [Vitis vinifera]
Length=738

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  505  SSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvd  326
            ++ L  H++VKN GT+ G H++LLFS+PP    +P K+L+ F+KV +     E V F+V 
Sbjct  635  TTPLGFHIDVKNTGTMDGSHTLLLFSTPPPGTWSPNKRLLAFEKVHVGAGSQERVRFDVH  694

Query  325  VCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            VCKHLSVVD  G  ++ +G H  HIG LKHS++++
Sbjct  695  VCKHLSVVDHFGIHRIPMGEHHFHIGDLKHSISLQ  729



>dbj|BAF43576.1| arabinofuranosidase/xylosidase homolog [Prunus persica]
Length=349

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -2

Query  508  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  329
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++   ++ V   V
Sbjct  246  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIAAGSEKRVRIAV  305

Query  328  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  306  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  341



>ref|XP_006352077.1| PREDICTED: beta-D-xylosidase 1-like [Solanum tuberosum]
Length=773

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = -2

Query  535  SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPn  356
            +V      C S  +D+H++VKN+G + G H+VL+FS+PP       KQLV F+KV +   
Sbjct  662  TVRTIHTNCESLDIDMHIDVKNIGDMDGTHTVLIFSTPP--DPTETKQLVAFEKVHVVAG  719

Query  355  edevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-HLKHSLTVE  221
             ++ V  N++ CKHLSV DE G R++ +G H +H+G  LKHS+T +
Sbjct  720  ANQRVKINMNACKHLSVADEYGVRRIYMGEHKIHVGDDLKHSITFQ  765



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = -2

Query  550  STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKV  371
            S   +++      C   +L I ++VKNVG+  G H++L++S+PPA   +P KQLV F++V
Sbjct  650  SISGKAIRVTHTKCNKLSLGIQVDVKNVGSKDGTHTLLVYSAPPAGRWSPHKQLVAFERV  709

Query  370  RLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             +S    E V  ++ VCK LSVVD +G R++ +G H +HIG++KHS++++
Sbjct  710  HVSAGTQERVGISIHVCKLLSVVDRSGIRRIPIGEHSIHIGNVKHSVSLQ  759



>gb|KFK42620.1| hypothetical protein AALP_AA1G019000 [Arabis alpina]
Length=766

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -2

Query  511  CASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfn  332
            C   +L +H+++ NVGT  G H++L+FS+PP    AP+KQLV F++V ++  E + V  N
Sbjct  661  CNRLSLGVHVDITNVGTRDGTHTMLVFSAPPGGEWAPKKQLVAFERVHVAAGEKKRVQVN  720

Query  331  vdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTV  224
            + VCK+LSVVD AG R++ +G H +HIG   H++++
Sbjct  721  IHVCKYLSVVDRAGIRRIPIGDHGIHIGDETHTVSL  756



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = -2

Query  523  AEQTCASSALDI--HLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPned  350
            +   C    LD+  H++VKN G++ G H++L+FS PP    +  KQLV FQK+ +     
Sbjct  663  SHANCDHDTLDMEFHVDVKNDGSMDGTHTLLVFSKPPPGKWSQIKQLVNFQKIHVPAGST  722

Query  349  evvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
            + V   V VCKHLSVVD+ G R++  G H LHIG LKHS++V+
Sbjct  723  QRVTVGVHVCKHLSVVDQFGIRRIPSGEHELHIGDLKHSISVQ  765



>sp|P83344.1|XYNB_PRUPE RecName: Full=Putative beta-D-xylosidase; AltName: Full=PpAz152, 
partial [Prunus persica]
 gb|AAM00218.1|AF362990_1 beta-D-xylosidase, partial [Prunus persica]
Length=461

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -2

Query  508  ASSALDIHLNVKNVGTVSGGHSVLLFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnv  329
            A S LD+H++VKN G++ G H++L+F+SPP    A  KQL+GF K+ ++   ++ V   V
Sbjct  358  ALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKWASSKQLMGFHKIHIATGSEKRVRIAV  417

Query  328  dVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
             VCKHLSVVD  G R++ LG H L IG L H ++++
Sbjct  418  HVCKHLSVVDRFGIRRIPLGEHKLQIGDLSHHVSLQ  453



>ref|XP_006287090.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
 gb|EOA19988.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
Length=803

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -2

Query  529  DAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS-PPALHNAPRKQLVGFQKVRLSPne  353
            DA   +C S   ++ +NV N G + G H ++LFS  P  +   P KQL+GF +V +   E
Sbjct  699  DATVNSCESLRFNVQVNVSNSGEIDGSHVLMLFSKMPQVISGVPEKQLIGFDRVHVRSKE  758

Query  352  devvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSLTVE  221
                V  +D CKHL V ++ G R + LG+HVL +G L+HSL++E
Sbjct  759  MIETVLVIDPCKHLIVANDVGKRVIPLGIHVLSLGDLQHSLSLE  802



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220