BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014P14

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784283.1|  PREDICTED: DNA-directed RNA polymerase III s...    163   3e-44   Nicotiana sylvestris
ref|XP_009784284.1|  PREDICTED: DNA-directed RNA polymerase III s...    163   3e-44   Nicotiana sylvestris
ref|XP_009607009.1|  PREDICTED: DNA-directed RNA polymerase III s...    160   8e-43   Nicotiana tomentosiformis
ref|XP_009607010.1|  PREDICTED: DNA-directed RNA polymerase III s...    160   8e-43   Nicotiana tomentosiformis
ref|XP_006355616.1|  PREDICTED: DNA-directed RNA polymerase III s...    150   5e-39   Solanum tuberosum [potatoes]
ref|XP_010321476.1|  PREDICTED: DNA-directed RNA polymerase III s...    148   2e-38   Solanum lycopersicum
ref|XP_002263694.1|  PREDICTED: uncharacterized protein LOC100260717    137   2e-34   Vitis vinifera
emb|CAN67263.1|  hypothetical protein VITISV_022611                     136   5e-34   Vitis vinifera
ref|XP_007038340.1|  DNA binding protein, putative isoform 2            134   2e-33   
ref|XP_011027962.1|  PREDICTED: DNA-directed RNA polymerase III s...    134   3e-33   Populus euphratica
ref|XP_002303490.2|  hypothetical protein POPTR_0003s10650g             134   3e-33   
ref|XP_007038339.1|  DNA binding protein, putative isoform 1            134   3e-33   
ref|XP_002510979.1|  DNA binding protein, putative                      125   3e-30   Ricinus communis
ref|XP_011076392.1|  PREDICTED: DNA-directed RNA polymerase III s...    126   4e-30   Sesamum indicum [beniseed]
ref|XP_010258842.1|  PREDICTED: DNA-directed RNA polymerase III s...    124   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008234419.1|  PREDICTED: uncharacterized protein LOC103333...    124   6e-30   Prunus mume [ume]
ref|XP_008234418.1|  PREDICTED: uncharacterized protein LOC103333...    124   7e-30   
emb|CDP05351.1|  unnamed protein product                                125   8e-30   Coffea canephora [robusta coffee]
gb|KDO49943.1|  hypothetical protein CISIN_1g0205542mg                  122   2e-29   Citrus sinensis [apfelsine]
gb|KDO49941.1|  hypothetical protein CISIN_1g0205542mg                  122   2e-29   Citrus sinensis [apfelsine]
ref|XP_009374549.1|  PREDICTED: uncharacterized protein LOC103963446    123   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009340562.1|  PREDICTED: uncharacterized protein LOC103932654    122   3e-29   
gb|KHG22798.1|  DNA-directed RNA polymerase III subunit RPC4            122   4e-29   Gossypium arboreum [tree cotton]
ref|XP_006421620.1|  hypothetical protein CICLE_v10005426mg             122   5e-29   Citrus clementina [clementine]
gb|ACU24406.1|  unknown                                                 120   1e-28   Glycine max [soybeans]
gb|KDP22444.1|  hypothetical protein JCGZ_26275                         121   1e-28   Jatropha curcas
ref|XP_003534408.1|  PREDICTED: DNA-directed RNA polymerase III s...    120   1e-28   Glycine max [soybeans]
ref|XP_006490148.1|  PREDICTED: DNA-directed RNA polymerase III s...    121   1e-28   Citrus sinensis [apfelsine]
gb|KHN11670.1|  DNA-directed RNA polymerase III subunit RPC4            120   1e-28   Glycine soja [wild soybean]
ref|XP_010656128.1|  PREDICTED: uncharacterized protein LOC100256088    119   5e-28   Vitis vinifera
gb|KJB07872.1|  hypothetical protein B456_001G049700                    118   7e-28   Gossypium raimondii
gb|KJB07873.1|  hypothetical protein B456_001G049700                    118   7e-28   Gossypium raimondii
ref|XP_007220771.1|  hypothetical protein PRUPE_ppa024519mg             118   8e-28   
ref|XP_009384778.1|  PREDICTED: uncharacterized protein LOC103972235    118   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009370450.1|  PREDICTED: uncharacterized protein LOC103959808    118   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_008776776.1|  PREDICTED: DNA-directed RNA polymerase III s...    117   1e-27   Phoenix dactylifera
ref|XP_008376400.1|  PREDICTED: DNA-directed RNA polymerase III s...    118   1e-27   Malus domestica [apple tree]
ref|XP_006591962.1|  PREDICTED: uncharacterized protein LOC100787575    118   2e-27   Glycine max [soybeans]
ref|XP_009372858.1|  PREDICTED: uncharacterized protein LOC103961935    118   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_008799831.1|  PREDICTED: uncharacterized protein LOC103714...    117   2e-27   
ref|XP_009773975.1|  PREDICTED: DNA-directed RNA polymerase III s...    115   2e-27   Nicotiana sylvestris
ref|XP_002516293.1|  DNA binding protein, putative                      117   2e-27   Ricinus communis
gb|KHN32433.1|  hypothetical protein glysoja_026327                     117   3e-27   Glycine soja [wild soybean]
ref|XP_010927885.1|  PREDICTED: uncharacterized protein LOC105049...    117   3e-27   Elaeis guineensis
ref|XP_010927884.1|  PREDICTED: uncharacterized protein LOC105049...    116   4e-27   
gb|EYU24936.1|  hypothetical protein MIMGU_mgv1a009918mg                115   9e-27   Erythranthe guttata [common monkey flower]
ref|XP_008799830.1|  PREDICTED: uncharacterized protein LOC103714...    115   1e-26   Phoenix dactylifera
ref|XP_008354226.1|  PREDICTED: DNA-directed RNA polymerase III s...    116   1e-26   
ref|XP_007012676.1|  DNA-directed RNA polymerase III subunit RPC4...    114   3e-26   
ref|XP_010035038.1|  PREDICTED: DNA-directed RNA polymerase III s...    113   1e-25   Eucalyptus grandis [rose gum]
ref|XP_011094009.1|  PREDICTED: DNA-directed RNA polymerase III s...    111   2e-25   Sesamum indicum [beniseed]
gb|KDP33903.1|  hypothetical protein JCGZ_07474                         111   3e-25   Jatropha curcas
emb|CBI27823.3|  unnamed protein product                                110   4e-25   Vitis vinifera
ref|XP_009631588.1|  PREDICTED: uncharacterized protein LOC104121328    110   6e-25   Nicotiana tomentosiformis
gb|EYU25867.1|  hypothetical protein MIMGU_mgv1a015300mg                107   9e-25   Erythranthe guttata [common monkey flower]
ref|XP_010914429.1|  PREDICTED: DNA-directed RNA polymerase III s...    109   1e-24   Elaeis guineensis
ref|XP_010914453.1|  PREDICTED: DNA-directed RNA polymerase III s...    109   1e-24   
ref|XP_009383296.1|  PREDICTED: uncharacterized protein LOC103971075    109   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010270534.1|  PREDICTED: uncharacterized protein LOC104606837    108   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004514515.1|  PREDICTED: DNA-directed RNA polymerase III s...    109   2e-24   Cicer arietinum [garbanzo]
ref|XP_010693718.1|  PREDICTED: uncharacterized protein LOC104906635    107   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006383244.1|  hypothetical protein POPTR_0005s12820g             106   4e-24   
ref|XP_010914457.1|  PREDICTED: DNA-directed RNA polymerase III s...    108   4e-24   
ref|XP_004514516.1|  PREDICTED: DNA-directed RNA polymerase III s...    108   5e-24   Cicer arietinum [garbanzo]
ref|XP_006362806.1|  PREDICTED: uncharacterized protein LOC102600766    107   5e-24   Solanum tuberosum [potatoes]
ref|XP_006381642.1|  DNA-directed RNA polymerase 3 RPC4 family pr...    107   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006587708.1|  PREDICTED: DNA-directed RNA polymerase III s...    106   1e-23   Glycine max [soybeans]
gb|KHG12357.1|  DNA-directed RNA polymerase III subunit RPC4            106   1e-23   Gossypium arboreum [tree cotton]
gb|KJB83020.1|  hypothetical protein B456_013G225500                    106   2e-23   Gossypium raimondii
ref|XP_011045977.1|  PREDICTED: uncharacterized protein LOC105140...    106   2e-23   Populus euphratica
ref|XP_011045973.1|  PREDICTED: uncharacterized protein LOC105140...    106   2e-23   Populus euphratica
gb|KJB83018.1|  hypothetical protein B456_013G225500                    106   2e-23   Gossypium raimondii
emb|CDP03102.1|  unnamed protein product                                105   3e-23   Coffea canephora [robusta coffee]
ref|XP_010321121.1|  PREDICTED: uncharacterized protein LOC101251...    105   4e-23   Solanum lycopersicum
ref|XP_003550619.1|  PREDICTED: uncharacterized protein LOC100802173    105   6e-23   Glycine max [soybeans]
gb|KHN07911.1|  DNA-directed RNA polymerase III subunit RPC4            105   6e-23   Glycine soja [wild soybean]
gb|KHG19108.1|  DNA-directed RNA polymerase III subunit RPC4            102   6e-23   Gossypium arboreum [tree cotton]
ref|XP_010049526.1|  PREDICTED: DNA-directed RNA polymerase III s...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010049527.1|  PREDICTED: DNA-directed RNA polymerase III s...    103   2e-22   Eucalyptus grandis [rose gum]
ref|XP_004287620.1|  PREDICTED: DNA-directed RNA polymerase III s...    103   2e-22   Fragaria vesca subsp. vesca
ref|XP_003541303.2|  PREDICTED: uncharacterized protein LOC100782982    103   3e-22   
ref|XP_010090130.1|  DNA-directed RNA polymerase III subunit RPC4       102   4e-22   
gb|KJB54458.1|  hypothetical protein B456_009G035100                    102   4e-22   Gossypium raimondii
ref|XP_011470059.1|  PREDICTED: DNA-directed RNA polymerase III s...    102   4e-22   Fragaria vesca subsp. vesca
gb|KJB54460.1|  hypothetical protein B456_009G035100                    102   5e-22   Gossypium raimondii
ref|XP_011470060.1|  PREDICTED: DNA-directed RNA polymerase III s...    102   5e-22   Fragaria vesca subsp. vesca
gb|KJB54459.1|  hypothetical protein B456_009G035100                    102   5e-22   Gossypium raimondii
gb|KDO54063.1|  hypothetical protein CISIN_1g022055mg                   102   6e-22   Citrus sinensis [apfelsine]
ref|XP_010533037.1|  PREDICTED: uncharacterized protein LOC104808893    101   9e-22   Tarenaya hassleriana [spider flower]
ref|XP_003568830.1|  PREDICTED: uncharacterized protein LOC100846711    101   1e-21   Brachypodium distachyon [annual false brome]
gb|KDO49942.1|  hypothetical protein CISIN_1g0205542mg                  100   2e-21   Citrus sinensis [apfelsine]
emb|CDY03371.1|  BnaC01g17110D                                          100   2e-21   
ref|XP_008362778.1|  PREDICTED: DNA-directed RNA polymerase III s...  97.8    2e-21   
ref|XP_009138954.1|  PREDICTED: uncharacterized protein LOC103862...    100   3e-21   Brassica rapa
ref|XP_006428587.1|  hypothetical protein CICLE_v10012311mg           99.8    4e-21   Citrus clementina [clementine]
ref|XP_007131354.1|  hypothetical protein PHAVU_011G006800g           99.8    5e-21   Phaseolus vulgaris [French bean]
ref|XP_008779737.1|  PREDICTED: DNA-directed RNA polymerase III s...  97.4    5e-21   
ref|NP_196500.1|  RNA polymerase III RPC4                             99.0    6e-21   
ref|XP_008672161.1|  PREDICTED: uncharacterized protein LOC100193...  99.0    9e-21   Zea mays [maize]
ref|XP_008672159.1|  PREDICTED: uncharacterized protein LOC100193...  99.0    9e-21   Zea mays [maize]
ref|XP_008672162.1|  PREDICTED: uncharacterized protein LOC100193...  98.6    9e-21   Zea mays [maize]
ref|XP_010422990.1|  PREDICTED: uncharacterized protein LOC104708180  98.2    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008672165.1|  PREDICTED: uncharacterized protein LOC100193...  98.2    1e-20   Zea mays [maize]
ref|NP_001132322.1|  uncharacterized protein LOC100193764             98.2    1e-20   Zea mays [maize]
gb|ACG31814.1|  hypothetical protein                                  98.2    1e-20   Zea mays [maize]
ref|XP_008672167.1|  PREDICTED: uncharacterized protein LOC100193...  98.2    1e-20   Zea mays [maize]
ref|XP_004495578.1|  PREDICTED: DNA-directed RNA polymerase III s...  98.6    1e-20   Cicer arietinum [garbanzo]
ref|XP_010452926.1|  PREDICTED: uncharacterized protein LOC104734928  98.2    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009138960.1|  PREDICTED: uncharacterized protein LOC103862...  98.2    2e-20   Brassica rapa
ref|NP_001052654.2|  Os04g0394500                                     97.8    2e-20   
emb|CDX89440.1|  BnaA01g14530D                                        98.2    2e-20   
ref|XP_008450913.1|  PREDICTED: uncharacterized protein LOC103492360  97.4    2e-20   Cucumis melo [Oriental melon]
ref|XP_008453902.1|  PREDICTED: DNA-directed RNA polymerase III s...  97.8    2e-20   Cucumis melo [Oriental melon]
emb|CAH66462.1|  H0718E12.6                                           97.8    2e-20   Oryza sativa [red rice]
ref|XP_010491563.1|  PREDICTED: uncharacterized protein LOC104769122  97.1    3e-20   Camelina sativa [gold-of-pleasure]
gb|KEH29411.1|  RNA polymerase III RPC4                               97.4    3e-20   Medicago truncatula
ref|XP_002873399.1|  DNA-directed RNA polymerase III RPC4 family ...  96.7    4e-20   Arabidopsis lyrata subsp. lyrata
tpg|DAA56437.1|  TPA: hypothetical protein ZEAMMB73_943001            93.2    4e-20   
ref|XP_004952578.1|  PREDICTED: uncharacterized protein LOC101786879  97.1    4e-20   Setaria italica
ref|XP_007204524.1|  hypothetical protein PRUPE_ppa017748mg           96.7    5e-20   
ref|NP_194248.2|  RNA polymerase III RPC4                             96.7    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274963.1|  PREDICTED: DNA-directed RNA polymerase III s...  95.5    6e-20   
ref|XP_006652221.1|  PREDICTED: DNA-directed RNA polymerase III s...  95.9    9e-20   Oryza brachyantha
ref|XP_002867621.1|  DNA-directed RNA polymerase                      95.5    2e-19   Arabidopsis lyrata subsp. lyrata
gb|KFK29009.1|  hypothetical protein AALP_AA7G077100                  94.7    3e-19   Arabis alpina [alpine rockcress]
ref|XP_006288444.1|  hypothetical protein CARUB_v10001705mg           94.4    3e-19   Capsella rubella
ref|XP_010109751.1|  DNA-directed RNA polymerase III subunit RPC4     90.5    3e-19   
ref|XP_004146914.1|  PREDICTED: uncharacterized protein LOC101207602  94.0    4e-19   Cucumis sativus [cucumbers]
gb|KFK29008.1|  hypothetical protein AALP_AA7G077100                  94.0    5e-19   Arabis alpina [alpine rockcress]
ref|XP_004167167.1|  PREDICTED: uncharacterized protein LOC101227599  93.6    6e-19   
gb|AFK44935.1|  unknown                                               93.6    6e-19   Medicago truncatula
ref|XP_003590974.1|  DNA-directed RNA polymerase III subunit RPC4     93.2    6e-19   Medicago truncatula
ref|XP_006418592.1|  hypothetical protein EUTSA_v10002636mg           93.2    7e-19   Eutrema salsugineum [saltwater cress]
gb|EMS61184.1|  DNA-directed RNA polymerase III subunit RPC4          95.9    7e-19   Triticum urartu
ref|NP_001150257.1|  DNA binding protein                              93.2    7e-19   Zea mays [maize]
ref|XP_006413334.1|  hypothetical protein EUTSA_v10025722mg           93.6    7e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008242212.1|  PREDICTED: uncharacterized protein LOC103340568  93.2    8e-19   Prunus mume [ume]
ref|XP_004970851.1|  PREDICTED: DNA-directed RNA polymerase III s...  92.8    1e-18   
ref|XP_004144123.1|  PREDICTED: uncharacterized protein LOC101209454  92.4    1e-18   Cucumis sativus [cucumbers]
ref|XP_007154594.1|  hypothetical protein PHAVU_003G132000g           92.4    2e-18   Phaseolus vulgaris [French bean]
emb|CDY21578.1|  BnaC09g47140D                                        92.0    2e-18   Brassica napus [oilseed rape]
ref|XP_009122511.1|  PREDICTED: uncharacterized protein LOC103847203  92.0    2e-18   Brassica rapa
emb|CDX69909.1|  BnaA10g22580D                                        91.7    2e-18   
ref|NP_001045045.1|  Os01g0889200                                     90.1    3e-18   
ref|XP_006399413.1|  hypothetical protein EUTSA_v10014696mg           89.7    4e-18   
gb|EEE55781.1|  hypothetical protein OsJ_04354                        89.4    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010445138.1|  PREDICTED: uncharacterized protein LOC104727762  89.0    6e-18   
gb|EMS52407.1|  DNA-directed RNA polymerase III subunit RPC4          91.3    8e-18   Triticum urartu
ref|XP_010436390.1|  PREDICTED: uncharacterized protein LOC104720126  90.1    8e-18   
ref|XP_006284135.1|  hypothetical protein CARUB_v10005267mg           90.5    8e-18   Capsella rubella
gb|EMT05674.1|  DNA-directed RNA polymerase III subunit RPC4          90.9    1e-17   
gb|EEC71928.1|  hypothetical protein OsI_04731                        89.7    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010666258.1|  PREDICTED: DNA-directed RNA polymerase III s...  89.4    2e-17   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM85398.1|  unnamed protein product                              89.4    2e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006847937.1|  hypothetical protein AMTR_s00029p00131600        89.4    2e-17   
gb|ACG39972.1|  DNA binding protein                                   89.4    2e-17   Zea mays [maize]
ref|XP_008658805.1|  PREDICTED: DNA-directed RNA polymerase III s...  86.3    2e-17   
ref|XP_004975436.1|  PREDICTED: vesicle transport protein SEC20-l...  88.2    4e-17   
ref|XP_010448469.1|  PREDICTED: uncharacterized protein LOC104730922  87.0    1e-16   
ref|XP_009361687.1|  PREDICTED: uncharacterized protein LOC103951924  85.9    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_003562265.1|  PREDICTED: uncharacterized protein LOC100824963  85.9    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_002447716.1|  hypothetical protein SORBIDRAFT_06g014360        85.1    4e-16   Sorghum bicolor [broomcorn]
ref|XP_010232672.1|  PREDICTED: DNA-directed RNA polymerase III s...  85.1    4e-16   
ref|XP_003564813.1|  PREDICTED: DNA-directed RNA polymerase III s...  84.7    5e-16   Brachypodium distachyon [annual false brome]
ref|XP_008344033.1|  PREDICTED: uncharacterized protein LOC103406825  83.6    1e-15   
ref|XP_010240792.1|  PREDICTED: DNA-directed RNA polymerase III s...  83.6    1e-15   
emb|CAA23059.1|  hypothetical protein                                 81.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04591.1|  unnamed protein product                              77.8    9e-15   Coffea canephora [robusta coffee]
ref|XP_010693720.1|  PREDICTED: uncharacterized protein LOC104906...  79.3    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693719.1|  PREDICTED: uncharacterized protein LOC104906...  79.3    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011045979.1|  PREDICTED: uncharacterized protein LOC105140...  77.8    8e-14   Populus euphratica
gb|KHN34141.1|  hypothetical protein glysoja_038630                   77.8    3e-13   Glycine soja [wild soybean]
ref|XP_006573848.1|  PREDICTED: uncharacterized protein LOC100804615  78.2    3e-13   Glycine max [soybeans]
ref|XP_010448468.1|  PREDICTED: uncharacterized protein LOC104730921  73.6    4e-13   
ref|XP_010109752.1|  hypothetical protein L484_000449                 70.1    2e-12   
ref|XP_002453894.1|  hypothetical protein SORBIDRAFT_04g021023        71.6    2e-12   
gb|EMS47221.1|  hypothetical protein TRIUR3_08966                     73.6    4e-12   Triticum urartu
gb|KJB83019.1|  hypothetical protein B456_013G225500                  73.6    4e-12   Gossypium raimondii
gb|EMT19814.1|  hypothetical protein F775_27467                       72.8    5e-12   
ref|XP_010536548.1|  PREDICTED: uncharacterized protein LOC104811532  73.2    8e-12   Tarenaya hassleriana [spider flower]
ref|XP_004571513.1|  PREDICTED: DNA-directed RNA polymerase III s...  73.9    8e-12   Maylandia zebra
ref|XP_005752741.1|  PREDICTED: DNA-directed RNA polymerase III s...  73.6    9e-12   Pundamilia nyererei
ref|XP_005950302.1|  PREDICTED: DNA-directed RNA polymerase III s...  73.9    9e-12   Haplochromis burtoni
gb|ETP20965.1|  hypothetical protein F441_05409                       72.0    3e-11   Phytophthora parasitica CJ01A1
ref|XP_008902834.1|  hypothetical protein PPTG_09575                  72.0    3e-11   Phytophthora parasitica INRA-310
ref|XP_003454122.1|  PREDICTED: DNA-directed RNA polymerase III s...  70.5    1e-10   Oreochromis niloticus
ref|XP_002683346.1|  DNA-directed RNA polymerase III RPC4, polype...  69.7    2e-10   Naegleria gruberi strain NEG-M
gb|EPS57301.1|  hypothetical protein M569_17518                       67.0    3e-10   Genlisea aurea
ref|XP_005752742.1|  PREDICTED: DNA-directed RNA polymerase III s...  67.0    1e-09   Pundamilia nyererei
ref|XP_001702362.1|  hypothetical protein CHLREDRAFT_154065           64.3    2e-09   Chlamydomonas reinhardtii
ref|XP_001757951.1|  predicted protein                                65.5    7e-09   
ref|XP_010752704.1|  PREDICTED: DNA-directed RNA polymerase III s...  65.1    8e-09   Larimichthys crocea [croceine croaker]
gb|KDO27173.1|  hypothetical protein SPRG_07421                       62.8    1e-08   Saprolegnia parasitica CBS 223.65
ref|XP_002897888.1|  conserved hypothetical protein                   63.9    2e-08   Phytophthora infestans T30-4
ref|XP_010775691.1|  PREDICTED: DNA-directed RNA polymerase III s...  63.5    3e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010775694.1|  PREDICTED: DNA-directed RNA polymerase III s...  63.5    3e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008417285.1|  PREDICTED: DNA-directed RNA polymerase III s...  63.2    3e-08   Poecilia reticulata
ref|XP_010666259.1|  PREDICTED: uncharacterized protein LOC104883...  62.0    5e-08   
ref|XP_005804423.1|  PREDICTED: DNA-directed RNA polymerase III s...  62.4    6e-08   Xiphophorus maculatus
ref|XP_010775693.1|  PREDICTED: DNA-directed RNA polymerase III s...  62.0    9e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007563924.1|  PREDICTED: DNA-directed RNA polymerase III s...  61.6    1e-07   Poecilia formosa
ref|XP_002008597.1|  GI11729                                          62.0    1e-07   
ref|XP_562238.4|  AGAP004480-PA                                       61.6    1e-07   Anopheles gambiae str. PEST
ref|XP_008312618.1|  PREDICTED: DNA-directed RNA polymerase III s...  61.6    1e-07   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004544332.1|  PREDICTED: DNA-directed RNA polymerase III s...  61.2    2e-07   Maylandia zebra
ref|XP_006805995.1|  PREDICTED: DNA-directed RNA polymerase III s...  60.8    2e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005922768.1|  PREDICTED: DNA-directed RNA polymerase III s...  60.8    2e-07   Haplochromis burtoni
ref|XP_005729484.1|  PREDICTED: DNA-directed RNA polymerase III s...  60.8    2e-07   Pundamilia nyererei
ref|XP_006805994.1|  PREDICTED: DNA-directed RNA polymerase III s...  60.8    2e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002947935.1|  hypothetical protein VOLCADRAFT_103709           60.8    3e-07   Volvox carteri f. nagariensis
ref|XP_003445628.2|  PREDICTED: DNA-directed RNA polymerase III s...  60.5    3e-07   
ref|XP_008436399.1|  PREDICTED: DNA-directed RNA polymerase III s...  59.7    4e-07   Poecilia reticulata
ref|XP_008303756.1|  PREDICTED: DNA-directed RNA polymerase III s...  59.7    5e-07   Stegastes partitus
ref|XP_008436400.1|  PREDICTED: DNA-directed RNA polymerase III s...  59.7    5e-07   Poecilia reticulata
ref|XP_009829404.1|  hypothetical protein H257_06034                  59.7    5e-07   Aphanomyces astaci
ref|XP_008436398.1|  PREDICTED: DNA-directed RNA polymerase III s...  59.7    5e-07   Poecilia reticulata
ref|XP_006830387.1|  hypothetical protein AMTR_s00116p00141430        56.6    8e-07   
ref|XP_011477790.1|  PREDICTED: DNA-directed RNA polymerase III s...  58.5    1e-06   
ref|XP_001849273.1|  DNA-directed RNA polymerase III subunit D        58.5    1e-06   Culex quinquefasciatus
ref|XP_006341225.1|  PREDICTED: uncharacterized protein LOC102585768  55.8    1e-06   
emb|CDS13131.1|  hypothetical protein LRAMOSA05314                    57.8    3e-06   Lichtheimia ramosa
ref|XP_007558733.1|  PREDICTED: DNA-directed RNA polymerase III s...  57.4    3e-06   Poecilia formosa
ref|XP_007558715.1|  PREDICTED: DNA-directed RNA polymerase III s...  57.4    3e-06   Poecilia formosa
ref|XP_007558724.1|  PREDICTED: DNA-directed RNA polymerase III s...  57.4    3e-06   Poecilia formosa
ref|XP_003978578.1|  PREDICTED: DNA-directed RNA polymerase III s...  57.4    3e-06   
ref|XP_010775695.1|  PREDICTED: DNA-directed RNA polymerase III s...  57.4    3e-06   Notothenia coriiceps [yellowbelly rockcod]
emb|CDH60133.1|  hypothetical protein RO3G_15547                      57.4    4e-06   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007844173.1|  hypothetical protein Moror_6919                  57.0    5e-06   
ref|XP_001659518.1|  AAEL008794-PA                                    56.2    7e-06   Aedes aegypti
gb|KFB40569.1|  AGAP004480-PA-like protein                            56.2    8e-06   Anopheles sinensis
emb|CEG80460.1|  hypothetical protein RMATCC62417_14795               55.5    9e-06   Rhizopus microsporus
gb|EIF46806.1|  dna-directed rna polymerase iii subunit c4            55.8    1e-05   Brettanomyces bruxellensis AWRI1499
gb|AAH66421.2|  Zgc:56407                                             55.8    1e-05   Danio rerio [leopard danio]
gb|AAI53605.1|  Zgc:56407                                             55.8    1e-05   Danio rerio [leopard danio]
ref|NP_956581.1|  DNA-directed RNA polymerase III subunit RPC4        55.5    1e-05   Danio rerio [leopard danio]
ref|XP_005811751.1|  PREDICTED: DNA-directed RNA polymerase III s...  55.5    1e-05   
ref|XP_009055984.1|  hypothetical protein LOTGIDRAFT_232725           55.5    1e-05   Lottia gigantea
emb|CEP10166.1|  hypothetical protein                                 55.5    2e-05   Parasitella parasitica
ref|XP_008608135.1|  hypothetical protein SDRG_04249                  55.1    2e-05   Saprolegnia diclina VS20
dbj|GAM22143.1|  hypothetical protein SAMD00019534_053180             55.5    2e-05   Acytostelium subglobosum LB1
ref|XP_009523026.1|  hypothetical protein PHYSODRAFT_245995           54.7    2e-05   Phytophthora sojae
ref|XP_008280515.1|  PREDICTED: DNA-directed RNA polymerase III s...  54.7    2e-05   Stegastes partitus
ref|XP_009569702.1|  PREDICTED: DNA-directed RNA polymerase III s...  54.7    2e-05   Cuculus canorus
ref|XP_010765095.1|  PREDICTED: DNA-directed RNA polymerase III s...  54.3    3e-05   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_002386188.1|  hypothetical protein MPER_15665                  52.0    4e-05   
ref|XP_009903334.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  54.3    4e-05   Picoides pubescens
ref|XP_002735290.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.9    4e-05   Saccoglossus kowalevskii
ref|XP_011200476.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.9    5e-05   Bactrocera dorsalis [papaya fruit fly]
gb|EMC81482.1|  DNA-directed RNA polymerase III subunit RPC4          53.5    5e-05   
ref|XP_011200475.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.5    5e-05   Bactrocera dorsalis [papaya fruit fly]
ref|NP_001017346.1|  DNA-directed RNA polymerase III subunit RPC4     53.1    7e-05   Xenopus tropicalis [western clawed frog]
ref|XP_005510916.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.1    8e-05   
ref|XP_004357716.1|  RNA polymerase III RPC4 protein                  52.8    8e-05   Acanthamoeba castellanii str. Neff
ref|XP_010285322.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  52.8    8e-05   Phaethon lepturus
ref|XP_010561299.1|  PREDICTED: DNA-directed RNA polymerase III s...  53.1    1e-04   Haliaeetus leucocephalus
gb|KGL85961.1|  DNA-directed RNA polymerase III subunit RPC4          52.4    1e-04   Charadrius vociferus
ref|XP_008926823.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    1e-04   
ref|XP_002076556.1|  GD17563                                          52.8    1e-04   Drosophila simulans
ref|XP_007251115.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    1e-04   
ref|XP_007251113.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    1e-04   
ref|NP_649028.3|  CG5147                                              52.4    1e-04   Drosophila melanogaster
gb|AAL28497.1|  GM08670p                                              52.4    1e-04   Drosophila melanogaster
ref|XP_004522151.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    2e-04   Ceratitis capitata [medfly]
gb|KFQ26002.1|  DNA-directed RNA polymerase III subunit RPC4          51.6    2e-04   Mesitornis unicolor
ref|XP_004522150.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    2e-04   Ceratitis capitata [medfly]
ref|XP_010191359.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.6    2e-04   Mesitornis unicolor
ref|XP_005848437.1|  hypothetical protein CHLNCDRAFT_144796           52.4    2e-04   Chlorella variabilis
ref|XP_005530883.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.4    2e-04   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009892658.1|  PREDICTED: piwi-like protein 2                   52.8    2e-04   Charadrius vociferus
emb|CEG72065.1|  hypothetical protein RMATCC62417_07688               52.4    2e-04   Rhizopus microsporus
emb|CCK69493.1|  hypothetical protein KNAG_0C03890                    52.4    2e-04   Kazachstania naganishii CBS 8797
ref|XP_005995303.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.0    2e-04   Latimeria chalumnae
gb|KDQ27019.1|  hypothetical protein PLEOSDRAFT_1077786               52.0    2e-04   Pleurotus ostreatus PC15
ref|XP_008333785.1|  PREDICTED: DNA-directed RNA polymerase III s...  52.0    2e-04   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EIE90836.1|  hypothetical protein RO3G_15547                       51.6    2e-04   Rhizopus delemar RA 99-880
gb|KFH70193.1|  DNA-directed RNA polymerase III subunit C4            52.0    2e-04   Mortierella verticillata NRRL 6337
ref|XP_005430963.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.6    3e-04   
emb|CAF95323.1|  unnamed protein product                              51.2    3e-04   Tetraodon nigroviridis
gb|ETE59236.1|  DNA-directed RNA polymerase III subunit RPC4          51.2    3e-04   Ophiophagus hannah
ref|XP_007440782.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.6    3e-04   
gb|EMP29667.1|  DNA-directed RNA polymerase III subunit RPC4          51.2    3e-04   
ref|XP_007066379.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.2    3e-04   
gb|ETN60809.1|  DNA-directed RNA polymerase III subunit D             51.2    3e-04   
gb|KFP86246.1|  DNA-directed RNA polymerase III subunit RPC4          51.2    4e-04   
ref|XP_003974530.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.2    4e-04   
ref|XP_001381983.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.2    4e-04   
ref|XP_009078721.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.8    4e-04   
ref|NP_001089656.1|  polymerase (RNA) III (DNA directed) polypept...  51.2    4e-04   
ref|XP_010749445.1|  PREDICTED: DNA-directed RNA polymerase III s...  51.2    4e-04   
emb|CDO73287.1|  hypothetical protein BN946_scf185008.g49             50.8    4e-04   
ref|XP_003194095.1|  hypothetical protein CGB_E0380C                  50.8    6e-04   
ref|XP_008149715.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.4    6e-04   
ref|XP_008878686.1|  hypothetical protein H310_13095                  50.4    6e-04   
ref|XP_003758108.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.4    7e-04   
ref|XP_006135595.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.4    7e-04   
ref|XP_009638941.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.1    7e-04   
ref|XP_008580274.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.1    7e-04   
ref|XP_003272896.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  50.1    8e-04   
gb|KFO53082.1|  DNA-directed RNA polymerase III subunit RPC4          49.7    9e-04   
gb|KDQ61552.1|  hypothetical protein JAAARDRAFT_31006                 50.1    9e-04   
ref|XP_001985541.1|  GH17124                                          50.1    0.001   
ref|XP_004402250.1|  PREDICTED: DNA-directed RNA polymerase III s...  50.1    0.001   



>ref|XP_009784283.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 9/172 (5%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT-  572
            LDEAEFG+AA NAEYDE  IHP+SELGLL+++D+   ++ F+Q+P NLP     G  T  
Sbjct  175  LDEAEFGKAAANAEYDENNIHPASELGLLEKKDDV--QILFLQLPVNLPLATKGGRDTAG  232

Query  571  -LPAASTKGKEVI----EVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKML  407
             LP+   KGKE       +  SAKGKE V++  T+ RR ++ K+ C+LE+LP G MGKML
Sbjct  233  CLPSPMLKGKEAAGTAPRLLASAKGKEIVDSS-TISRRHNTAKEACNLEKLPAGNMGKML  291

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINTV+K+CC+LG I K AVV
Sbjct  292  VYKSGAIKLKLGDILYDVSPGVDCSFSQDVVAINTVEKHCCQLGEIGKRAVV  343



>ref|XP_009784284.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Nicotiana sylvestris]
Length=355

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 9/172 (5%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT-  572
            LDEAEFG+AA NAEYDE  IHP+SELGLL+++D+   ++ F+Q+P NLP     G  T  
Sbjct  174  LDEAEFGKAAANAEYDENNIHPASELGLLEKKDDV--QILFLQLPVNLPLATKGGRDTAG  231

Query  571  -LPAASTKGKEVI----EVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKML  407
             LP+   KGKE       +  SAKGKE V++  T+ RR ++ K+ C+LE+LP G MGKML
Sbjct  232  CLPSPMLKGKEAAGTAPRLLASAKGKEIVDSS-TISRRHNTAKEACNLEKLPAGNMGKML  290

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINTV+K+CC+LG I K AVV
Sbjct  291  VYKSGAIKLKLGDILYDVSPGVDCSFSQDVVAINTVEKHCCQLGEIGKRAVV  342



>ref|XP_009607009.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Nicotiana tomentosiformis]
Length=358

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT-  572
            LDEAEFG+AA NAEYDE  IHP+SELGLL+++D+   ++ F+Q+P NLP     G  T  
Sbjct  175  LDEAEFGKAAVNAEYDENNIHPASELGLLEKKDDV--QILFLQLPANLPLATKGGRDTAG  232

Query  571  -LPAASTKGKEVI----EVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKML  407
             L +   KGKE       +  SAKGKE V++  T+ RR ++ K+ CSLE LP G MGKML
Sbjct  233  CLSSPMLKGKEATGTAPRLLASAKGKEIVDSS-TISRRHNTAKEACSLEGLPAGNMGKML  291

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINTV+K+CC+LG I K AVV
Sbjct  292  VYKSGAIKLKLGDILYDVSPGVDCSFSQDVVAINTVEKHCCQLGEIGKRAVV  343



>ref|XP_009607010.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Nicotiana tomentosiformis]
Length=357

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 9/172 (5%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT-  572
            LDEAEFG+AA NAEYDE  IHP+SELGLL+++D+   ++ F+Q+P NLP     G  T  
Sbjct  174  LDEAEFGKAAVNAEYDENNIHPASELGLLEKKDDV--QILFLQLPANLPLATKGGRDTAG  231

Query  571  -LPAASTKGKEVI----EVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKML  407
             L +   KGKE       +  SAKGKE V++  T+ RR ++ K+ CSLE LP G MGKML
Sbjct  232  CLSSPMLKGKEATGTAPRLLASAKGKEIVDSS-TISRRHNTAKEACSLEGLPAGNMGKML  290

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINTV+K+CC+LG I K AVV
Sbjct  291  VYKSGAIKLKLGDILYDVSPGVDCSFSQDVVAINTVEKHCCQLGEIGKRAVV  342



>ref|XP_006355616.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Solanum tuberosum]
Length=368

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 124/186 (67%), Gaps = 22/186 (12%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLP-----------  602
            L+EAEFGEAA+NA YDE  I+P+SELGLL+++D+   ++ F+Q+P NLP           
Sbjct  173  LNEAEFGEAAKNAVYDENNINPASELGLLEKKDDV--QLLFLQLPANLPLSKLQASTGGR  230

Query  601  ---SCKSI-GDQT----TLPAASTKGKEVI-EVPTSAKGKEKVENPPTVLRRRSSPKKGC  449
                C ++ GD++    TL +   KGKEV       AKGKE  ++P    R  ++  K C
Sbjct  231  DTAVCLTLPGDKSDKAATLSSPMLKGKEVAGSALAGAKGKEIADSPTISRRHNNTTNKAC  290

Query  448  SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGI  269
            SL+ELP G MGKMLVYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINT +K CC+LG +
Sbjct  291  SLQELPAGSMGKMLVYKSGAIKLKLGDILYDVSPGVECSFSQDVVAINTAEKQCCQLGEL  350

Query  268  YKHAVV  251
             K AVV
Sbjct  351  GKRAVV  356



>ref|XP_010321476.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Solanum 
lycopersicum]
Length=371

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 123/189 (65%), Gaps = 25/189 (13%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLP-----------  602
            L+EAEFGEAA+NAEYDE  I+P+SELGLL+++D+   ++ F+Q+P NLP           
Sbjct  173  LNEAEFGEAAKNAEYDENNINPASELGLLEKKDDV--QLLFLQLPANLPLSKLQASTGGR  230

Query  601  ----SCKSIGDQT----TLPAASTKGKEVI----EVPTSAKGKEKVENPPTVLRRRSSPK  458
                S    GD++    TL +   KGKEV         SAKGKE  ++     R  ++  
Sbjct  231  DTAVSLTLPGDKSDKAATLSSPMLKGKEVAGSAPRFLASAKGKEISDSSTISRRHNNTTN  290

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
            K CSL+ELP G MGKMLVYKSG +KLKLG+ILYDVSPGV  S +Q+VVAINT +K CC+L
Sbjct  291  KVCSLQELPAGSMGKMLVYKSGAIKLKLGDILYDVSPGVECSFSQDVVAINTAEKQCCQL  350

Query  277  GGIYKHAVV  251
            G + K AVV
Sbjct  351  GELGKRAVV  359



>ref|XP_002263694.1| PREDICTED: uncharacterized protein LOC100260717 [Vitis vinifera]
 emb|CBI38675.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 109/172 (63%), Gaps = 16/172 (9%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFGEA+ N EYDE  I+P+SELGLL+E ++   RMF  Q+P NLP  K        
Sbjct  172  LDEAEFGEASTNLEYDEKTINPASELGLLEESEKG--RMFLFQLPANLPLFKQ-------  222

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK------KGCSLEELPGGYMGKML  407
             + S KGKE++E  TS +G         V R   S K        C LE+L GG++GKML
Sbjct  223  -SPSAKGKEIVENSTSLEGIYASAKGKQVARSSLSSKSIGTSEHSCRLEDLAGGHIGKML  281

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG ILYDVSPG+  +  Q+VVAINTVDK+C  LG + K  +V
Sbjct  282  VYKSGAIKLKLGEILYDVSPGLDCTCVQDVVAINTVDKHCYALGELGKRVIV  333



>emb|CAN67263.1| hypothetical protein VITISV_022611 [Vitis vinifera]
Length=348

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 108/172 (63%), Gaps = 16/172 (9%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFGEA+ N EYDE  I+P+SELGLL+E ++   RMF  Q+P NLP  K        
Sbjct  172  LDEAEFGEASTNLEYDEKTINPASELGLLEESEKG--RMFLFQLPANLPLVKQ-------  222

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK------KGCSLEELPGGYMGKML  407
             +AS KGKE++   TS +G         V R   S K        C LE+L GG+ GKML
Sbjct  223  -SASAKGKEIVGNSTSLEGIYASAKGKQVARSSLSSKSIGTSEHSCRLEDLAGGHXGKML  281

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VYKSG +KLKLG ILYDVSPG+  +  Q+VVAINTVDK+C  LG + K  +V
Sbjct  282  VYKSGAIKLKLGEILYDVSPGLDCTCVQDVVAINTVDKHCYALGELGKRVIV  333



>ref|XP_007038340.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22841.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
Length=328

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 106/166 (64%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+AEF EAAR  EYDE  I+P+S+LGLL+E ++   +MFF Q+P NLP           
Sbjct  172  LDQAEFVEAARK-EYDEKTINPASDLGLLEEGEKG--KMFFFQLPANLP-----------  217

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     VI+   S KGKEK EN  +   R  + KKGC LEELPGG+MGKMLVYKSG 
Sbjct  218  ---------VIKRLASTKGKEKAENLGSS-ERFGALKKGCQLEELPGGFMGKMLVYKSGA  267

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  LYDVSPG     AQ+V A+NT +K+CC +G + K  VV
Sbjct  268  VKLKLGETLYDVSPGSDCIFAQDVAAVNTTEKHCCVIGELGKRVVV  313



>ref|XP_011027962.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Populus euphratica]
Length=325

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 104/166 (63%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFGE ARN EYDET I+P+S+LGLL+E D    R+FF Q+P  LP  K        
Sbjct  169  LDEAEFGEEARNLEYDETTINPASDLGLLEECDN--ERLFFFQVPEKLPFLKR-------  219

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +AS KGKE  ++   ++ K              S  +  S EELP GYMGKMLVY+SG 
Sbjct  220  -SASAKGKERADMSMPSESK--------------SAARKTSFEELPKGYMGKMLVYRSGA  264

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVSPG     AQ+V+AINT  K+CC +G + K AVV
Sbjct  265  IKLKLGDALYDVSPGSECIFAQDVMAINTAGKDCCAIGELGKRAVV  310



>ref|XP_002303490.2| hypothetical protein POPTR_0003s10650g [Populus trichocarpa]
 gb|EEE78469.2| hypothetical protein POPTR_0003s10650g [Populus trichocarpa]
Length=368

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 105/166 (63%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFGE ARN EYDET I+P+S+LGLL+E D    R+FF Q+P  LP  K        
Sbjct  212  LDEAEFGEEARNLEYDETTINPASDLGLLEECDN--ERLFFFQVPEKLPFLKR-------  262

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +AS KGKE  ++   ++ K              S  +  S EELP GYMGKMLVY+SG 
Sbjct  263  -SASAKGKERADMSMPSESK--------------SAARKTSFEELPKGYMGKMLVYRSGA  307

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVSPG   + AQ+V+AINT  K+CC +G + K AVV
Sbjct  308  IKLKLGDALYDVSPGSECTFAQDVMAINTAGKDCCAIGELGKRAVV  353



>ref|XP_007038339.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22840.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
Length=359

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 106/166 (64%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+AEF EAAR  EYDE  I+P+S+LGLL+E ++   +MFF Q+P NLP           
Sbjct  203  LDQAEFVEAARK-EYDEKTINPASDLGLLEEGEKG--KMFFFQLPANLP-----------  248

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     VI+   S KGKEK EN  +   R  + KKGC LEELPGG+MGKMLVYKSG 
Sbjct  249  ---------VIKRLASTKGKEKAENLGSS-ERFGALKKGCQLEELPGGFMGKMLVYKSGA  298

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  LYDVSPG     AQ+V A+NT +K+CC +G + K  VV
Sbjct  299  VKLKLGETLYDVSPGSDCIFAQDVAAVNTTEKHCCVIGELGKRVVV  344



>ref|XP_002510979.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF51581.1| DNA binding protein, putative [Ricinus communis]
Length=328

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 102/166 (61%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFGEAAR  EYDE+ ++P+S+L LL+E D    +M F Q+P  LP  K        
Sbjct  171  LDEAEFGEAARKLEYDESTMNPASDLELLEECDT--EKMIFFQLPAKLPLVKR-------  221

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +AS KGKE  E    ++GK             ++ KK  SL+ L  GYMGKMLVY+SG 
Sbjct  222  -SASAKGKEKAEGSIPSQGK-------------NAAKKESSLDGLSAGYMGKMLVYRSGA  267

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVS G     AQ+V+AINT  K+CC +G + K AVV
Sbjct  268  VKLKLGDTLYDVSQGSDCMFAQDVMAINTAAKHCCTIGELEKRAVV  313



>ref|XP_011076392.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
 ref|XP_011076393.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
 ref|XP_011076394.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Sesamum indicum]
Length=366

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 107/186 (58%), Gaps = 26/186 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCK--------  593
            LD+ EF EA+   EYDE  +  SS   L     +D +RM F Q P NLP  +        
Sbjct  172  LDKEEFEEAS---EYDENNL--SSASDLGLLGQDDTQRMLFFQFPPNLPLGRRQTGTNKR  226

Query  592  -SIGDQTTLP----AASTKGKEVIE-------VPTSAKGKEKVENPPTVLRRRSSPKKGC  449
             +  D   L     +A++KGKE++        +    KGK+   N   ++    S  KGC
Sbjct  227  DTANDLKALECGVFSAASKGKEIVGCGPRVSGISMGTKGKDIAPNSINLVSGHPS-NKGC  285

Query  448  SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGI  269
            SLEELP GYMGKMLVYKSG VKLKLG+ILYDVSPG   + AQ V+AI+T +++CC LG +
Sbjct  286  SLEELPEGYMGKMLVYKSGAVKLKLGDILYDVSPGSDCTFAQSVMAIDTTNRDCCDLGAL  345

Query  268  YKHAVV  251
             K AVV
Sbjct  346  NKRAVV  351



>ref|XP_010258842.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Nelumbo 
nucifera]
Length=300

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFG+ + +  Y+E+ I P+  + L   ++ +E++MFFIQ+P++LP  K        
Sbjct  149  LDEEEFGKDSSDLPYEESTIKPA--VELGLMEEGEEQKMFFIQLPDSLPLVKR-------  199

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +AS KGK++     S+K           L+   +  +GCSLEELP G+MGKMLVYKSG 
Sbjct  200  -SASAKGKDMAR---SSKP----------LKSVGAADQGCSLEELPPGFMGKMLVYKSGA  245

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  LYDVS G     AQ+VVAINT D++CC +G +YK A++
Sbjct  246  VKLKLGETLYDVSSGSDCIFAQDVVAINTEDRHCCVIGELYKRAII  291



>ref|XP_008234419.1| PREDICTED: uncharacterized protein LOC103333371 isoform X2 [Prunus 
mume]
Length=324

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 100/166 (60%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGE A   EYDE+ I+ ++ELGLL+E+ E   RM F+Q+P  LP  K        
Sbjct  169  LNVNEFGEDAEK-EYDESTINHAAELGLLEEKAEA--RMLFVQLPTILPLTKRSA-----  220

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                           +AKGKEKV    T L    +PKKGCSLEELPGGYMGKMLVYKSG 
Sbjct  221  ---------------TAKGKEKV-GSSTSLESTGAPKKGCSLEELPGGYMGKMLVYKSGA  264

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLGN L DVSPG      ++V  INT +K CC LGGI   AVV
Sbjct  265  IKLKLGNTLCDVSPGSDCICDEDVAVINTEEKTCCVLGGISHRAVV  310



>ref|XP_008234418.1| PREDICTED: uncharacterized protein LOC103333371 isoform X1 [Prunus 
mume]
Length=325

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 100/166 (60%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGE A   EYDE+ I+ ++ELGLL+E+ E   RM F+Q+P  LP  K        
Sbjct  170  LNVNEFGEDAEK-EYDESTINHAAELGLLEEKAEA--RMLFVQLPTILPLTKR-------  219

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                           +AKGKEKV    T L    +PKKGCSLEELPGGYMGKMLVYKSG 
Sbjct  220  -------------SATAKGKEKV-GSSTSLESTGAPKKGCSLEELPGGYMGKMLVYKSGA  265

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLGN L DVSPG      ++V  INT +K CC LGGI   AVV
Sbjct  266  IKLKLGNTLCDVSPGSDCICDEDVAVINTEEKTCCVLGGISHRAVV  311



>emb|CDP05351.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 106/195 (54%), Gaps = 33/195 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCK------SI  587
            LD  EFGEA   +EYDE+ IH  S   L   ++ D  +M F+Q P NLP  K      S 
Sbjct  175  LDREEFGEAKAASEYDESAIH--SASDLGLLEEVDGEKMLFLQFPANLPFVKRESGPGST  232

Query  586  GDQTTLPA---------ASTKGKEVIEVPTSAKGKEKVENPPTV--------------LR  476
            G      A         +S  G  V   PT+AKGKE   + P V                
Sbjct  233  GTSEHASASVNHKHRAGSSRPGGSV--APTTAKGKEIPGSFPMVSGDAKGKEIVNSSVSS  290

Query  475  RRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
               + K  CSLEELP G+MGK+LV+KSG VKLKLG++LYDVSPG   + AQ++VAINT D
Sbjct  291  VVGTNKNVCSLEELPPGFMGKILVFKSGAVKLKLGDMLYDVSPGSNCTFAQDIVAINTSD  350

Query  295  KNCCKLGGIYKHAVV  251
            K+CC LG + K AVV
Sbjct  351  KHCCNLGEVSKRAVV  365



>gb|KDO49943.1| hypothetical protein CISIN_1g0205542mg, partial [Citrus sinensis]
Length=285

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE  RN+EYDE  ++  S   L    + + R++FF Q+P  LP  K        
Sbjct  134  LDQEEFGENTRNSEYDENSVN--SAADLGLLDESENRKLFFFQLPKKLPLDKR-------  184

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                         P S KGKEK E+    L R  +PK    L +LPGGYMGKMLVYKSG 
Sbjct  185  -------------PASTKGKEKAESS-KPLGRTDAPK-DLDLSKLPGGYMGKMLVYKSGA  229

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ L+DVS G   S AQ++V I+  DK CC LG + K AVV
Sbjct  230  VKFKLGDTLFDVSAGSDCSFAQDLVVIDVKDKTCCVLGQLDKLAVV  275



>gb|KDO49941.1| hypothetical protein CISIN_1g0205542mg, partial [Citrus sinensis]
Length=284

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE  RN+EYDE  ++  S   L    + + R++FF Q+P  LP  K        
Sbjct  133  LDQEEFGENTRNSEYDENSVN--SAADLGLLDESENRKLFFFQLPKKLPLDKR-------  183

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                         P S KGKEK E+    L R  +PK    L +LPGGYMGKMLVYKSG 
Sbjct  184  -------------PASTKGKEKAESS-KPLGRTDAPK-DLDLSKLPGGYMGKMLVYKSGA  228

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ L+DVS G   S AQ++V I+  DK CC LG + K AVV
Sbjct  229  VKFKLGDTLFDVSAGSDCSFAQDLVVIDVKDKTCCVLGQLDKLAVV  274



>ref|XP_009374549.1| PREDICTED: uncharacterized protein LOC103963446 [Pyrus x bretschneideri]
Length=328

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 105/166 (63%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E+EFGE A   EYDE+ I+P+SELGLL+E+++   ++ FIQ+P+ LP        T+ 
Sbjct  172  LNESEFGEDAEK-EYDESTINPASELGLLEEKEKA--KLLFIQLPSILP-------LTSK  221

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PAA+  GKE     TS             L    +P+KGCSLEELP GYMGKMLVYKSG 
Sbjct  222  PAATATGKEKAGSSTS-------------LESTGAPEKGCSLEELPAGYMGKMLVYKSGK  268

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKL+LG+  YDV+PG    S Q+VV  NTV+K C  L  + + AVV
Sbjct  269  VKLRLGDTFYDVAPGSDSKSNQDVVVANTVEKKCTVLRELRERAVV  314



>ref|XP_009340562.1| PREDICTED: uncharacterized protein LOC103932654 [Pyrus x bretschneideri]
Length=326

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 105/166 (63%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E+EFGE A   EYDE+ I+P+SELGLL+E+++   ++ FIQ+P+ LP        T+ 
Sbjct  170  LNESEFGEDAEK-EYDESTINPASELGLLEEKEKA--KLLFIQLPSILP-------LTSN  219

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PAA+  GKE     TS             L    +PKKGCSLEELP G+MGKMLVYKSG 
Sbjct  220  PAATATGKEKAGSSTS-------------LESTGAPKKGCSLEELPAGFMGKMLVYKSGK  266

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKL+LG+  YDV+PG    S Q+VV  NTV+K C  L  + + AVV
Sbjct  267  VKLRLGDTFYDVAPGSDSKSNQDVVVANTVEKKCTVLRELRERAVV  312



>gb|KHG22798.1| DNA-directed RNA polymerase III subunit RPC4 [Gossypium arboreum]
Length=302

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 99/166 (60%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEF E A+  EYDE  I+P+S+LGLL E D+  ++M F Q P NLP           
Sbjct  154  LDEAEFVETAKK-EYDEATINPASDLGLLQEGDK--QKMLFFQFPGNLPR----------  200

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                      I+ P S KGKEK E+  +   R  + KKGC LEELP GY+GKMLVYKSG 
Sbjct  201  ----------IKQPVSKKGKEKAEHSVSS-DRFGALKKGCRLEELPEGYVGKMLVYKSGA  249

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLK+G  L+DVSPG     AQ+V A NT  K CC +G + +  VV
Sbjct  250  VKLKIGETLFDVSPGEACVFAQDVAAFNTASKQCCVIGEVGQRVVV  295



>ref|XP_006421620.1| hypothetical protein CICLE_v10005426mg [Citrus clementina]
 gb|ESR34860.1| hypothetical protein CICLE_v10005426mg [Citrus clementina]
Length=324

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE  RN+EYDE  ++  S   L    + + R++FF Q+P  LP  K        
Sbjct  173  LDQEEFGENTRNSEYDENSVN--SAADLGLLDESENRKLFFFQLPKKLPLDKR-------  223

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                         P S KGKEK E+    L R  +PK    L +LPGGYMGKMLVYKSG 
Sbjct  224  -------------PASTKGKEKAESS-KPLGRTDAPK-DLDLSKLPGGYMGKMLVYKSGA  268

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ L+DVS G   S AQ++V I+  DK CC LG + K AVV
Sbjct  269  VKFKLGDTLFDVSAGSDCSFAQDLVVIDVKDKTCCVLGQLDKLAVV  314



>gb|ACU24406.1| unknown [Glycine max]
Length=303

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 94/166 (57%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA + EYDE  ++ ++EL +L+ ++   +RMFF QIP  LP  K        
Sbjct  157  LDEKEFGEAATSVEYDENTVNSAAELEILESEE---QRMFFFQIPTPLPMDKQ-------  206

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               S KGKE I   T +    K +N               +LEELP GYMGKMLVYKSG 
Sbjct  207  ---SNKGKEKIGTSTVSGEATKSKN---------------ALEELPRGYMGKMLVYKSGA  248

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  L DVSPG      Q+V+A+NT  K CC LG I K  VV
Sbjct  249  IKLKLGETLLDVSPGSNCRCVQDVMAVNTAQKQCCNLGEISKRVVV  294



>gb|KDP22444.1| hypothetical protein JCGZ_26275 [Jatropha curcas]
Length=331

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 103/166 (62%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEAAR  EY+E  I P+S+LGLL+E D+   R+FF Q+P+ LP  K        
Sbjct  174  LNEEEFGEAARKLEYNENTIKPASDLGLLEESDK--ERLFFFQLPSKLPLVKR-------  224

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A TKGKE +E  T ++G              S+ KK  S + L  GYMGKMLVY+SG 
Sbjct  225  -SAITKGKEKVEGSTPSQGT-------------SALKKESSFQGLSEGYMGKMLVYRSGA  270

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ LYDVSPG   + AQ+++AI+   K CC +G + K AVV
Sbjct  271  VKIKLGDTLYDVSPGSDCTFAQDLMAIDIASKQCCTIGKLRKRAVV  316



>ref|XP_003534408.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X1 [Glycine max]
Length=303

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 94/166 (57%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA + EYDE  ++ ++EL +L+ ++   +RMFF QIP  LP  K        
Sbjct  157  LDEKEFGEAATSVEYDENTVNSAAELEILESEE---QRMFFFQIPTPLPMDKQ-------  206

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               S KGKE I   T +    K +N               +LEELP GYMGKMLVYKSG 
Sbjct  207  ---SNKGKEKIGTSTVSGEATKSKN---------------ALEELPRGYMGKMLVYKSGA  248

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  L DVSPG      Q+V+A+NT  K CC LG I K  VV
Sbjct  249  IKLKLGETLLDVSPGSNCRCVQDVMAVNTAQKQCCNLGEISKRVVV  294



>ref|XP_006490148.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Citrus sinensis]
Length=324

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE  RN+EYDE  ++  S   L    + + R++FF Q+P  LP  K        
Sbjct  173  LDQEEFGENTRNSEYDENSVN--SAADLGLLDESENRKLFFFQLPKKLPLDKR-------  223

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                         P S KGKEK E+    L R  +PK    L +LPGGYMGKMLVYKSG 
Sbjct  224  -------------PASTKGKEKAESS-KPLGRTDAPK-DLDLSKLPGGYMGKMLVYKSGA  268

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ L+DVS G   S AQ++V ++  DK CC LG + K AVV
Sbjct  269  VKFKLGDTLFDVSAGSDCSFAQDLVVMDVKDKTCCVLGQLDKLAVV  314



>gb|KHN11670.1| DNA-directed RNA polymerase III subunit RPC4 [Glycine soja]
Length=307

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 94/166 (57%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA + EYDE  ++ ++EL +L+ ++   +RMFF QIP  LP          +
Sbjct  161  LDEKEFGEAATSVEYDENTVNSAAELEILESEE---QRMFFFQIPTPLP----------M  207

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               S KGKE I   T +    K +N               +LEELP GYMGKMLVYKSG 
Sbjct  208  DKQSNKGKEKIGTSTVSGEATKSKN---------------ALEELPRGYMGKMLVYKSGA  252

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  L DVSPG      Q+V+A+NT  K CC LG I K  VV
Sbjct  253  IKLKLGETLLDVSPGSNCRCVQDVMAVNTAQKQCCNLGEISKRVVV  298



>ref|XP_010656128.1| PREDICTED: uncharacterized protein LOC100256088 [Vitis vinifera]
Length=315

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 98/171 (57%), Gaps = 21/171 (12%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ +  YDE   +P+ ELGL+DE  E    M F+Q+P  +P  K        
Sbjct  146  LDEEEFGEASESTAYDENSTNPAMELGLMDENQEAS--MLFLQLPATMPMIKQAA-----  198

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP-----KKGCSLEELPGGYMGKMLV  404
                       EV  +A   +  E+     R + S      +K C LEELP G+MGKMLV
Sbjct  199  ---------TAEVKENASSSKPPEDAGQANRLKPSEGAGSIQKTCRLEELPSGFMGKMLV  249

Query  403  YKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            YKSG +KLKLG+ LYDVSPG+    AQ+VVAINT DK CC LG + K AVV
Sbjct  250  YKSGAIKLKLGDTLYDVSPGLDCVFAQDVVAINTEDKCCCVLGELKKRAVV  300



>gb|KJB07872.1| hypothetical protein B456_001G049700 [Gossypium raimondii]
Length=302

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 99/166 (60%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEF E A+  EYDET I+P+S+LGLL+E D+  ++M F Q P NLP           
Sbjct  154  LDEAEFVETAKK-EYDETTINPASDLGLLEEGDK--QKMLFFQFPGNLPR----------  200

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                      I+ P S KGKEK E+  +   R  + KKGC LEELP GY+GKMLVYKSG 
Sbjct  201  ----------IKQPVSKKGKEKAEHSVSS-DRFGALKKGCRLEELPEGYVGKMLVYKSGA  249

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLK+G  L+D S G     AQ+V A NT  K CC +G + +  VV
Sbjct  250  VKLKIGETLFDASTGEDCVFAQDVAAFNTASKQCCVIGEVGQRVVV  295



>gb|KJB07873.1| hypothetical protein B456_001G049700 [Gossypium raimondii]
Length=301

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 96/166 (58%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEF E A+  EYDET I+P+S+LGLL+      ++M F Q P NLP           
Sbjct  154  LDEAEFVETAKK-EYDETTINPASDLGLLEGDK---QKMLFFQFPGNLPR----------  199

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                      I+ P S KGKEK E+  +   R  + KKGC LEELP GY+GKMLVYKSG 
Sbjct  200  ----------IKQPVSKKGKEKAEHSVSS-DRFGALKKGCRLEELPEGYVGKMLVYKSGA  248

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLK+G  L+D S G     AQ+V A NT  K CC +G + +  VV
Sbjct  249  VKLKIGETLFDASTGEDCVFAQDVAAFNTASKQCCVIGEVGQRVVV  294



>ref|XP_007220771.1| hypothetical protein PRUPE_ppa024519mg [Prunus persica]
 gb|EMJ21970.1| hypothetical protein PRUPE_ppa024519mg [Prunus persica]
Length=310

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 94/153 (61%), Gaps = 23/153 (15%)
 Frame = -1

Query  709  EYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEV  530
            EYDE+ I+ ++ELGLL+E+ E   RM F+Q+P  LP  K                     
Sbjct  167  EYDESTINHAAELGLLEEKVEA--RMLFVQLPTILPLTKRSA------------------  206

Query  529  PTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVS  350
              +AKGKEKV +  T L    +PKKGCSLEELPGGYMGKMLVYKSG +KLKLGN L DVS
Sbjct  207  --TAKGKEKVGSS-TSLESTGAPKKGCSLEELPGGYMGKMLVYKSGAIKLKLGNTLCDVS  263

Query  349  PGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            PG      ++V  INT +K CC LGGI   AVV
Sbjct  264  PGSDCLCDEDVAVINTEEKRCCVLGGISHRAVV  296



>ref|XP_009384778.1| PREDICTED: uncharacterized protein LOC103972235 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 98/166 (59%), Gaps = 27/166 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ +   DETKI   S   L   +  +E +M F Q P NLP  K        
Sbjct  142  LDEEEFGEASASLGMDETKI--DSAGELGLMEKREETQMLFFQFPANLPLPKQ-------  192

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PAA+T  K+       A GK         + R  + KKGC LEELP G+MGK+LVYKSG 
Sbjct  193  PAATTNTKD-------AAGK---------IDR--ALKKGCKLEELPPGFMGKLLVYKSGK  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ L+DVS G+  S AQ+VVAINT DK CC LG I + AVV
Sbjct  235  VKMKLGDTLFDVSHGLCGSFAQDVVAINTKDKRCCVLGEIDRRAVV  280



>ref|XP_009370450.1| PREDICTED: uncharacterized protein LOC103959808 [Pyrus x bretschneideri]
Length=329

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 103/166 (62%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGE A   EYDE+ I+P+S+LGLL+E+ +   ++ F+Q+P+ LP        T+ 
Sbjct  173  LNANEFGEDAEK-EYDESAINPASKLGLLEEKGKA--KLLFVQLPSILP-------LTSK  222

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P+A+ KGKE +   TS             L    +PKK  S EELP G+MGKMLVYKSG 
Sbjct  223  PSATAKGKEKVGSSTS-------------LESSGAPKKEGSFEELPAGFMGKMLVYKSGA  269

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ LYDVSPG    SAQ+VV  NT +K C  LG + + AVV
Sbjct  270  IKLRLGDTLYDVSPGSDSVSAQDVVVANTAEKKCIVLGELRQRAVV  315



>ref|XP_008776776.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Phoenix dactylifera]
Length=291

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 103/166 (62%), Gaps = 27/166 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ +   DET I P+ ELGLL+E ++  R +FF Q+P + P  K       L
Sbjct  142  LDEEEFGEASASLTQDETCIKPAEELGLLEESEKKPRMLFF-QLPASFPFKK-------L  193

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PA   +GKE+       +G            ++S+ +KGC L+ELP G+MGKM+VYKS  
Sbjct  194  PAVGGRGKEI-------EG------------QKSALEKGCGLQELPAGFMGKMMVYKSSI  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ L+DVSPGV     Q+V AINT +K+CC LG I +H VV
Sbjct  235  VKMKLGDTLFDVSPGVNCIFPQDVAAINTKEKHCCILGNIDRHVVV  280



>ref|XP_008376400.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Malus domestica]
Length=329

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 104/166 (63%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGE A   EYDE+ I+P+S+LGLL+E+ +   ++ F+Q+P+ LP        T+ 
Sbjct  173  LNANEFGEDAEK-EYDESTINPASKLGLLEEKVKA--KLLFVQLPSILP-------LTSK  222

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P+A+ KGKE +       G  K       L    +PKK  SLEELP G+MGKMLVYKSG 
Sbjct  223  PSATAKGKEKV-------GSSKS------LESSGAPKKEGSLEELPAGFMGKMLVYKSGA  269

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ LYDVSPG    SAQ+VV  NT +K C  LG + + AVV
Sbjct  270  IKLRLGDTLYDVSPGSDSMSAQDVVVANTAEKKCIVLGELRQRAVV  315



>ref|XP_006591962.1| PREDICTED: uncharacterized protein LOC100787575 [Glycine max]
Length=345

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 90/166 (54%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA +AEYDE  ++  S   L   +   ++RM F + P  LP  K        
Sbjct  199  LDEKEFGEAASSAEYDENTVN--SAAELGLLKKSQQQRMLFFKFPT-LPLVKQ-------  248

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               + KGKE I       GK  V    T        K   +LEELP GYMGKMLVYKSG 
Sbjct  249  ---TNKGKEKI-------GKSTVSQEAT--------KSKSALEELPRGYMGKMLVYKSGA  290

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  ++DVSPG    S Q++VA+NT  K CC LG + K  VV
Sbjct  291  IKLKLGETMFDVSPGSNSVSVQDIVAVNTAQKQCCNLGELRKRVVV  336



>ref|XP_009372858.1| PREDICTED: uncharacterized protein LOC103961935 [Pyrus x bretschneideri]
Length=329

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGE A   EYDE+ I+P+S+LGLL+E+ +   ++ F+Q+P+ LP        T+ 
Sbjct  173  LNANEFGEDAEK-EYDESTINPASKLGLLEEKVKA--KLLFVQLPSILP-------LTSK  222

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P+A+ +GKE +   TS             L    +PKK  S EELP G+MGKMLVYKSG 
Sbjct  223  PSATARGKEKVGSSTS-------------LESSGAPKKEGSFEELPAGFMGKMLVYKSGA  269

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ LYDVSPG    SAQ+VV  NT +K C  LG + + AVV
Sbjct  270  IKLRLGDTLYDVSPGSDSVSAQDVVVANTAEKKCIVLGELRQRAVV  315



>ref|XP_008799831.1| PREDICTED: uncharacterized protein LOC103714387 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008799832.1| PREDICTED: uncharacterized protein LOC103714387 isoform X2 [Phoenix 
dactylifera]
Length=297

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 98/166 (59%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+  +   E +I+P+ ELGL+ +++E   +M F Q+P  LP  KS  +    
Sbjct  144  LDEEEFGEASARSGLGEAEINPAEELGLMKKREEP--QMLFFQMPTTLPMVKSAAE----  197

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A TK                       +R+     KGC LEELP GYMGK++VYKSG 
Sbjct  198  --ADTKDN---------------------IRKIDHALKGCKLEELPAGYMGKLMVYKSGK  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ L+DVSPGV    AQ+V AINT +K+CC LG I KHAVV
Sbjct  235  VKMKLGDALFDVSPGVDCVFAQDVAAINTKEKHCCILGEIDKHAVV  280



>ref|XP_009773975.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Nicotiana sylvestris]
Length=226

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 94/166 (57%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+R++ YDE  I P+  + L   ++  E +MFFIQ+P  +P  K        
Sbjct  79   LDEEEFGEASRSSSYDENTIKPA--MELGLMEENLEEKMFFIQLPTAMPMLKQ-------  129

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +  T+G E                       R S  K  S+ ELP G+MGKMLVYKSG 
Sbjct  130  -SIKTEGSEASS-------------------SRPSKAKAYSINELPRGFMGKMLVYKSGA  169

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVSPG+  S AQ+VVA+NT +K+C  +G + K  ++
Sbjct  170  IKLKLGDTLYDVSPGMDCSFAQDVVAVNTEEKHCSNIGELTKRIII  215



>ref|XP_002516293.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF46295.1| DNA binding protein, putative [Ricinus communis]
Length=286

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 94/166 (57%), Gaps = 34/166 (20%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+  EFGEA+  +EYDE   +  S + L   ++  E  MFF+Q+P  +P  K +      
Sbjct  141  LNAEEFGEASDTSEYDENSTN--SAINLGLMEENVEANMFFLQLPPTVPMIKRL------  192

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A+  G +V E                        +K C L+ELP G+MGKMLVY+SG 
Sbjct  193  --ATADGHKVKE------------------------EKTCKLDELPAGHMGKMLVYRSGA  226

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG+ F+ AQ++ AINT +K+CC +  I KHA+V
Sbjct  227  VKLKLGDTLYDVSPGLDFAFAQDIAAINTAEKHCCVVAEIDKHAIV  272



>gb|KHN32433.1| hypothetical protein glysoja_026327 [Glycine soja]
Length=353

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 90/166 (54%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA +AEYDE  ++  S   L   +   ++RM F + P  LP  K        
Sbjct  207  LDEKEFGEAASSAEYDENTVN--SAAELGLLKKSQQQRMLFFKFPT-LPLVKQ-------  256

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               + KGKE I       GK  V    T        K   +LEELP GYMGKMLVYKSG 
Sbjct  257  ---TNKGKEKI-------GKSTVSQEAT--------KSKSALEELPRGYMGKMLVYKSGA  298

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  ++DVSPG    S Q++VA+NT  K CC LG + K  VV
Sbjct  299  IKLKLGETMFDVSPGSNSVSVQDIVAVNTAQKQCCNLGELRKRVVV  344



>ref|XP_010927885.1| PREDICTED: uncharacterized protein LOC105049821 isoform X2 [Elaeis 
guineensis]
Length=302

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 102/166 (61%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ ++  DET I P+ ELGLL+E ++   +M F Q+P +LP  K       L
Sbjct  152  LDEEEFGEASASSTQDETCIKPAEELGLLEESEKP--QMLFFQLPASLPFEK-------L  202

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PA   +GKE+                     ++S+ +KGC L+ELP G+MGKM+VYKSG 
Sbjct  203  PALGGRGKEIAG-------------------QKSALEKGCGLQELPAGFMGKMMVYKSGI  243

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ L+DVSPGV     Q+V AINT +K+CC LG I +  VV
Sbjct  244  VKMKLGDTLFDVSPGVNCIFPQDVAAINTKEKHCCILGNIDRRVVV  289



>ref|XP_010927884.1| PREDICTED: uncharacterized protein LOC105049821 isoform X1 [Elaeis 
guineensis]
Length=315

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 102/166 (61%), Gaps = 28/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ ++  DET I P+ ELGLL+E ++   +M F Q+P +LP  K       L
Sbjct  165  LDEEEFGEASASSTQDETCIKPAEELGLLEESEKP--QMLFFQLPASLPFEK-------L  215

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PA   +GKE+                     ++S+ +KGC L+ELP G+MGKM+VYKSG 
Sbjct  216  PALGGRGKEIAG-------------------QKSALEKGCGLQELPAGFMGKMMVYKSGI  256

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG+ L+DVSPGV     Q+V AINT +K+CC LG I +  VV
Sbjct  257  VKMKLGDTLFDVSPGVNCIFPQDVAAINTKEKHCCILGNIDRRVVV  302



>gb|EYU24936.1| hypothetical protein MIMGU_mgv1a009918mg [Erythranthe guttata]
Length=327

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 99/166 (60%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD +EF +A    EYDE  +  S+    L ++D +  +M F Q P+NLP+ K        
Sbjct  166  LDNSEFEDAV---EYDEDSLS-SASGLGLLDEDANTPKMLFFQFPSNLPTGKR-------  214

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A++KGKE+    T+++      NPP         K+G  LEELP GYMGKMLVYKSG 
Sbjct  215  --AASKGKEI--AGTNSRILATSINPP---------KEGSRLEELPDGYMGKMLVYKSGA  261

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG +LYDVSPG     +Q VVA+NT D +CC++G + K A+V
Sbjct  262  VKLKLGGVLYDVSPGSDCMFSQSVVAVNTTDGSCCEVGEVNKRAIV  307



>ref|XP_008799830.1| PREDICTED: uncharacterized protein LOC103714387 isoform X1 [Phoenix 
dactylifera]
Length=302

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 97/165 (59%), Gaps = 29/165 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+  +   E +I+P+ ELGL+ +++E   +M F Q+P  LP  KS  +    
Sbjct  144  LDEEEFGEASARSGLGEAEINPAEELGLMKKREEP--QMLFFQMPTTLPMVKSAAE----  197

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A TK                       +R+     KGC LEELP GYMGK++VYKSG 
Sbjct  198  --ADTKDN---------------------IRKIDHALKGCKLEELPAGYMGKLMVYKSGK  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAV  254
            VK+KLG+ L+DVSPGV    AQ+V AINT +K+CC LG I KHAV
Sbjct  235  VKMKLGDALFDVSPGVDCVFAQDVAAINTKEKHCCILGEIDKHAV  279



>ref|XP_008354226.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Malus domestica]
Length=375

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 101/166 (61%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGE A   EYDE  I+P+SELGLL+E++    ++ FIQ+P+ LPS       T+ 
Sbjct  219  LNENEFGEDAEK-EYDENTINPASELGLLEEKEXA--KLLFIQLPSILPS-------TSK  268

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P A+ KGKE +   TS +                 P+KGCSLEELP GYMGKMLV KSG 
Sbjct  269  PXATAKGKEKVGSSTSXEST-------------GXPEKGCSLEELPAGYMGKMLVXKSGK  315

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKL+LG+  YDV+PG      Q+V   NTV+K C  LG + + AVV
Sbjct  316  VKLRLGDTFYDVAPGSDSKFDQDVAVANTVEKKCTVLGELXQRAVV  361



>ref|XP_007012676.1| DNA-directed RNA polymerase III subunit RPC4, putative [Theobroma 
cacao]
 gb|EOY30295.1| DNA-directed RNA polymerase III subunit RPC4, putative [Theobroma 
cacao]
Length=294

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 100/166 (60%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  A+ N  +DE  + P+ ELGL+DE  E    MFF+Q+P  LP  K  G     
Sbjct  140  LDEEEF--ASENITFDENSVEPAVELGLMDENLEPS--MFFLQLPPTLPMIKQSG-----  190

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               +T G   +EV +S+K   +V           S KK C LEELP G MGKMLV+KSG 
Sbjct  191  ---TTAG---LEVDSSSKPAARV----------GSVKKTCGLEELPAGLMGKMLVHKSGA  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV+PG+    AQ+VVA+NT +K CC +G + K AV+
Sbjct  235  VKLKLGDTLYDVTPGLNCVFAQDVVAVNTAEKQCCVVGELDKRAVL  280



>ref|XP_010035038.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Eucalyptus grandis]
 gb|KCW46307.1| hypothetical protein EUGRSUZ_K00171 [Eucalyptus grandis]
Length=331

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 97/166 (58%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEA RN EYDE  I+ +S+LGLL++      +M F Q+P NLPS +        
Sbjct  173  LNEKEFGEATRNFEYDEGIINAASDLGLLEDSGRG--KMLFFQLPPNLPSVRR-------  223

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                          TS KGKEK E+  +      + ++ C LE+L GGYMGK++VYKSG 
Sbjct  224  -------------STSVKGKEKAES--SASSAADASERDCKLEDLSGGYMGKLVVYKSGA  268

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  LYDVSPG     AQ+V  +NT DK+ C LG + K  ++
Sbjct  269  VKLKLGETLYDVSPGSDCIFAQDVAVVNTADKHFCSLGEVGKRGII  314



>ref|XP_011094009.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Sesamum 
indicum]
Length=299

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 91/166 (55%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF E  +N+ YDE+  +  S L L    +  E  +FF+Q+P+ LP+ K       +
Sbjct  143  LDEEEFAEDPQNSTYDESAEN--SALELGLLDENMEETIFFLQLPSILPTTKQ-STNAEV  199

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P A  K           KG E  + P             C LE+LP G MGKMLVY+SG 
Sbjct  200  PEADKKA-------NPGKGAEASQKP-------------CRLEDLPAGLMGKMLVYRSGA  239

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVS G+     Q+VVAINT DK+CC +G I K A++
Sbjct  240  IKLKLGDTLYDVSAGLNCVFGQDVVAINTDDKHCCNMGEISKRAII  285



>gb|KDP33903.1| hypothetical protein JCGZ_07474 [Jatropha curcas]
Length=297

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 98/166 (59%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD  EFGE +  A YDE   +P+ +LGL++E  E    MFF+Q+P  +P  K    ++ L
Sbjct  141  LDIEEFGENSETANYDENSTNPAVDLGLMEENSEAS--MFFLQLPPTVPMVK----RSAL  194

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             A    GKE               +P ++       +K   LEELP GYMGKM+VYKSG 
Sbjct  195  -ADGHGGKE---------SSRPSGDPLSI-------EKSSKLEELPAGYMGKMVVYKSGA  237

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG   S +Q+VVAINT +K+CC +  I KHA+V
Sbjct  238  VKLKLGDTLYDVSPGQDCSFSQDVVAINTAEKHCCTVAEIRKHAIV  283



>emb|CBI27823.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 87/166 (52%), Gaps = 42/166 (25%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ +  YDE   +P+ ELGL+DE  E    M F+Q+P  +P  K      T 
Sbjct  156  LDEEEFGEASESTAYDENSTNPAMELGLMDENQEAS--MLFLQLPATMPMIKQAATAET-  212

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                                                   C LEELP G+MGKMLVYKSG 
Sbjct  213  ---------------------------------------CRLEELPSGFMGKMLVYKSGA  233

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVSPG+    AQ+VVAINT DK CC LG + K AVV
Sbjct  234  IKLKLGDTLYDVSPGLDCVFAQDVVAINTEDKCCCVLGELKKRAVV  279



>ref|XP_009631588.1| PREDICTED: uncharacterized protein LOC104121328 [Nicotiana tomentosiformis]
 ref|XP_009631589.1| PREDICTED: uncharacterized protein LOC104121328 [Nicotiana tomentosiformis]
 ref|XP_009631590.1| PREDICTED: uncharacterized protein LOC104121328 [Nicotiana tomentosiformis]
Length=289

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 91/166 (55%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF EA+++  YDE  I P+  + L   ++  E +MFFIQ+P  +P  K        
Sbjct  142  LDEQEFREASQSLSYDENSIKPA--MELGLMEENLEEKMFFIQLPTAMPMLKQ-------  192

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +  T+G E                       R S  K  S+ ELP G+MGKMLVYKSG 
Sbjct  193  -SVKTEGSEASS-------------------SRPSKVKAYSMNELPRGFMGKMLVYKSGA  232

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  LYDVSPG+  + AQ+VVA+NT +K+C  +G + K  +V
Sbjct  233  VKLKLGETLYDVSPGMDCAFAQDVVAVNTEEKHCSNIGELTKRIIV  278



>gb|EYU25867.1| hypothetical protein MIMGU_mgv1a015300mg [Erythranthe guttata]
Length=162

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (57%), Gaps = 22/160 (14%)
 Frame = -1

Query  730  GEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTK  551
            GE  +  +YDE   + ++ELGL++E  E    MF ++ P NLP                 
Sbjct  11   GEFEKEPDYDENATNDAAELGLVEENAE--NNMFLLKFPENLP-----------------  51

Query  550  GKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLG  371
               +++ P  A+ +E    P    +    P+K C+LEELP G+MGKMLVYKSG VKLKLG
Sbjct  52   ---MVKQPDRAEAREPGNIPKNTQKGAGKPQKTCNLEELPAGFMGKMLVYKSGAVKLKLG  108

Query  370  NILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            + LYDVS G+    AQEVVA+N  +K CC +G ++K A V
Sbjct  109  DTLYDVSAGLDCVFAQEVVAVNAEEKKCCSVGELHKRASV  148



>ref|XP_010914429.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010914438.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010914446.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Elaeis guineensis]
Length=299

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 97/167 (58%), Gaps = 30/167 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ ++  DE +I+P+ EL LL + +E    M F+Q+P+ LP  K        
Sbjct  144  LDEEEFGEASASSSLDEAQINPAEELRLLKKSEEP--HMLFLQMPSTLPMMKQ-------  194

Query  568  PAASTKGKEVIEVPTSAKG-KEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
                         PT+  G K+ +      L       KGC LE+LPGGY+GK++VYKSG
Sbjct  195  -------------PTAEAGTKDNIHKIDRAL-------KGCKLEDLPGGYIGKLMVYKSG  234

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
             +K+K+G+ L+DVSPGV    AQ+   INT +K+CC LG I + AVV
Sbjct  235  KIKMKIGDALFDVSPGVKCVFAQDAAVINTKEKHCCILGEINQRAVV  281



>ref|XP_010914453.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Elaeis guineensis]
Length=298

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 97/167 (58%), Gaps = 30/167 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ ++  DE +I+P+ EL LL + +E    M F+Q+P+ LP  K        
Sbjct  144  LDEEEFGEASASSSLDEAQINPAEELRLLKKSEEP--HMLFLQMPSTLPMMKQ-------  194

Query  568  PAASTKGKEVIEVPTSAKG-KEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
                         PT+  G K+ +      L       KGC LE+LPGGY+GK++VYKSG
Sbjct  195  -------------PTAEAGTKDNIHKIDRAL-------KGCKLEDLPGGYIGKLMVYKSG  234

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
             +K+K+G+ L+DVSPGV    AQ+   INT +K+CC LG I + AVV
Sbjct  235  KIKMKIGDALFDVSPGVKCVFAQDAAVINTKEKHCCILGEINQRAVV  281



>ref|XP_009383296.1| PREDICTED: uncharacterized protein LOC103971075 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 27/166 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEA+ +A  DET+I+P+ ELGL+++ +E   +M F+Q P NLP           
Sbjct  145  LNEKEFGEASASAALDETQINPAEELGLMEKMEEA--QMLFLQFPANLPLVN--------  194

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                             +    + +  TV ++     KGC LE+L  GYMGK++VYKSG 
Sbjct  195  -----------------RSASSMSSSSTVGKKEHGAMKGCKLEDLSAGYMGKIMVYKSGK  237

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG++L+D+SPGV     Q++ AINT +K+CC LG + K AV+
Sbjct  238  VKMKLGDVLFDISPGVKCEFVQDIAAINTKEKHCCILGKLNKRAVL  283



>ref|XP_010270534.1| PREDICTED: uncharacterized protein LOC104606837 [Nelumbo nucifera]
Length=302

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGEA+    YDE+ +  ++EL L++E  E   RM F+Q+P++LP  K        
Sbjct  145  LDDEEFGEASEEIAYDESSVKLATELDLMEENKEA--RMIFLQLPSSLPLVKR-------  195

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+T         T++  K+         R   S +K C LEELP G+MGKMLVY+SG 
Sbjct  196  -SATTNNDG-----TNSGLKQ--------FRGGVSSEKPCKLEELPVGFMGKMLVYESGA  241

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVS G+    AQ+VVAINT +K+CC LG + K AV+
Sbjct  242  IKLKLGDTLYDVSSGMNCVFAQDVVAINTEEKHCCILGELNKRAVI  287



>ref|XP_004514515.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
isoform X1 [Cicer arietinum]
Length=316

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 91/166 (55%), Gaps = 31/166 (19%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEAA N EYD+ K   S++   L +   ++ RM F ++P  LP  K        
Sbjct  170  LNEIEFGEAATNVEYDD-KTLDSAKELGLLQDSNEQHRMLFFKLPVVLPFIK--------  220

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G+E         G  KV          ++ KKG +L ELPGGYMGKMLVYKSG 
Sbjct  221  ------GEE-------KSGTSKVA---------ANTKKGTNLLELPGGYMGKMLVYKSGA  258

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG  L+DVSPG     AQ+V+A+NT  K+CC LG +    VV
Sbjct  259  VKIKLGETLFDVSPGTKSICAQDVIAMNTAQKHCCNLGTVDAKVVV  304



>ref|XP_010693718.1| PREDICTED: uncharacterized protein LOC104906635 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 91/167 (54%), Gaps = 37/167 (22%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSel-glldeqdedERRMFFIQIPNNLPSCKSIGDQTT  572
            LDEAEFGEAA   EYDE  I+P+SEL  L  +   +E R+ F+Q+PN+LPS         
Sbjct  79   LDEAEFGEAA--TEYDENAINPASELGLLNPDDTSEETRLMFLQLPNSLPSINR------  130

Query  571  LPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
              +A+ +G+++                          ++G SL +LP GYMGKM VY SG
Sbjct  131  --SATAEGEQI--------------------------EQGYSLNDLPPGYMGKMRVYNSG  162

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
             VKLKLG   YDVSPG   S  QEVVA+NT  K    +G + K  ++
Sbjct  163  AVKLKLGETQYDVSPGSTISDVQEVVAVNTEKKEFVSVGDLDKRMII  209



>ref|XP_006383244.1| hypothetical protein POPTR_0005s12820g, partial [Populus trichocarpa]
 gb|ERP61041.1| hypothetical protein POPTR_0005s12820g, partial [Populus trichocarpa]
Length=194

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE +  A YDE   +  S + L   ++  E  M F+Q+P  +P  K        
Sbjct  39   LDEEEFGEVSEAATYDENSTN--SAVELGLMEENVEASMLFVQLPPTMPMIKR-------  89

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+  G EV E    + G   +E             K C L+ELP GYMGK+LVY+SG 
Sbjct  90   -SATAVGPEVKESSRPSGGARAIE-------------KTCRLDELPAGYMGKVLVYRSGA  135

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG+    AQ+VVAIN  ++ CC +  I K   +
Sbjct  136  VKLKLGDTLYDVSPGMNSIFAQDVVAINRGEETCCVVAEIEKRVTL  181



>ref|XP_010914457.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X3 [Elaeis guineensis]
Length=285

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 96/166 (58%), Gaps = 30/166 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+ ++  DE +I+P+ EL LL + +E    M F+Q+P+ LP  K        
Sbjct  144  LDEEEFGEASASSSLDEAQINPAEELRLLKKSEEP--HMLFLQMPSTLPMMKQ-------  194

Query  568  PAASTKGKEVIEVPTSAKG-KEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
                         PT+  G K+ +      L       KGC LE+LPGGY+GK++VYKSG
Sbjct  195  -------------PTAEAGTKDNIHKIDRAL-------KGCKLEDLPGGYIGKLMVYKSG  234

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAV  254
             +K+K+G+ L+DVSPGV    AQ+   INT +K+CC LG I + AV
Sbjct  235  KIKMKIGDALFDVSPGVKCVFAQDAAVINTKEKHCCILGEINQRAV  280



>ref|XP_004514516.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
isoform X2 [Cicer arietinum]
Length=315

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 88/166 (53%), Gaps = 32/166 (19%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEAA N EYD+  +   S   L      ++ RM F ++P  LP  K        
Sbjct  170  LNEIEFGEAATNVEYDDKTL--DSAKELGLLDSNEQHRMLFFKLPVVLPFIK--------  219

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G+E         G  KV          ++ KKG +L ELPGGYMGKMLVYKSG 
Sbjct  220  ------GEE-------KSGTSKVA---------ANTKKGTNLLELPGGYMGKMLVYKSGA  257

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG  L+DVSPG     AQ+V+A+NT  K+CC LG +    VV
Sbjct  258  VKIKLGETLFDVSPGTKSICAQDVIAMNTAQKHCCNLGTVDAKVVV  303



>ref|XP_006362806.1| PREDICTED: uncharacterized protein LOC102600766 [Solanum tuberosum]
Length=283

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 92/166 (55%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+R+  YDE  I P+  + L   ++  E +MF +Q+P  +P  K        
Sbjct  136  LDEEEFGEASRSLTYDENSIKPA--MDLGLMEESLEEKMFLVQLP-TMPMLKQ-------  185

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +  T+G E+      +K                   K CSL ELP G+MGKMLVYKSG 
Sbjct  186  -SIKTEGSEMANSSKPSKA------------------KACSLNELPAGFMGKMLVYKSGA  226

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  L+++SPG+  S AQ+VVA+NT +K C  +G + K  ++
Sbjct  227  VKLKLGETLFNLSPGMDCSFAQDVVAVNTEEKYCSNIGELTKRIII  272



>ref|XP_006381642.1| DNA-directed RNA polymerase 3 RPC4 family protein [Populus trichocarpa]
 gb|ERP59439.1| DNA-directed RNA polymerase 3 RPC4 family protein [Populus trichocarpa]
Length=292

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE +  A YDE   +  S + L   ++  E  M F+Q+P  +P  K        
Sbjct  136  LDEEEFGEVSEAATYDENSTN--SAVELGLMEENVEASMLFVQLPPTMPMIKR-------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+  G EV E    + G   +E             K C L+ELP GYMGK+LVY+SG 
Sbjct  187  -SATAVGPEVKESSRPSGGARAIE-------------KTCRLDELPAGYMGKVLVYRSGA  232

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG+    AQ+VVAIN  ++ CC +  I K   +
Sbjct  233  VKLKLGDTLYDVSPGMNSIFAQDVVAINRGEETCCVVAEIEKRVTL  278



>ref|XP_006587708.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X2 [Glycine max]
Length=292

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 83/166 (50%), Gaps = 39/166 (23%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA + EYDE  ++ ++E                I IP  LP  K        
Sbjct  157  LDEKEFGEAATSVEYDENTVNSAAE--------------LEILIPTPLPMDKQ-------  195

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               S KGKE I   T +    K +N               +LEELP GYMGKMLVYKSG 
Sbjct  196  ---SNKGKEKIGTSTVSGEATKSKN---------------ALEELPRGYMGKMLVYKSGA  237

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  L DVSPG      Q+V+A+NT  K CC LG I K  VV
Sbjct  238  IKLKLGETLLDVSPGSNCRCVQDVMAVNTAQKQCCNLGEISKRVVV  283



>gb|KHG12357.1| DNA-directed RNA polymerase III subunit RPC4 [Gossypium arboreum]
Length=288

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 91/166 (55%), Gaps = 30/166 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  AA+N  YDE  I P+  LGL++E  E    M F+Q+P  LP  K+  +    
Sbjct  139  LDEEEF--AAQNVAYDENSIEPAVGLGLMEENLEPM--MLFLQLPPTLPIIKAGHE----  190

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              AS+ G                       R   S KK C L ELP G MGKMLVYKSG 
Sbjct  191  -GASSSGSS---------------------RTVRSAKKTCGLTELPAGLMGKMLVYKSGA  228

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ +YDV+PG+    AQ+VVA++T  K CC +G + KH VV
Sbjct  229  VKLKLGDTIYDVNPGLSCVFAQDVVAVDTAKKQCCVVGEVNKHVVV  274



>gb|KJB83020.1| hypothetical protein B456_013G225500 [Gossypium raimondii]
Length=276

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 91/166 (55%), Gaps = 30/166 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  AA+N  YDE  I P+  LGL++E  E    M F+Q+P  LP  K+  +    
Sbjct  127  LDEEEF--AAQNVAYDENSIEPAVGLGLMEENLEPM--MLFLQLPPTLPIIKAGHE----  178

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              AS+ G                       R   S KK C L ELP G MGKMLVYKSG 
Sbjct  179  -GASSTGSS---------------------RTVRSAKKTCGLTELPAGLMGKMLVYKSGA  216

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ +YDV+PG+    AQ+VVA++T  K CC +G + KH +V
Sbjct  217  VKLKLGDTIYDVNPGLSCVFAQDVVAVDTAKKQCCVVGEVNKHVIV  262



>ref|XP_011045977.1| PREDICTED: uncharacterized protein LOC105140725 isoform X2 [Populus 
euphratica]
Length=288

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE +  A YDE   +  S + L   ++  E  M F+Q+P  +P  K        
Sbjct  132  LDEEEFGEVSEAATYDENSTN--SAVELGLMEENVEASMLFVQLPPAMPMIKR-------  182

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+  G EV E    + G   +E             K C L+ELP GYMGK+LVY+SG 
Sbjct  183  -SATAVGPEVKESSRPSGGARAIE-------------KTCRLDELPAGYMGKVLVYRSGA  228

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG+    AQ+VVAIN  ++ CC +  I K   +
Sbjct  229  VKLKLGDTLYDVSPGMNSIFAQDVVAINRGEETCCVVAEIEKRVTL  274



>ref|XP_011045973.1| PREDICTED: uncharacterized protein LOC105140725 isoform X1 [Populus 
euphratica]
 ref|XP_011045974.1| PREDICTED: uncharacterized protein LOC105140725 isoform X1 [Populus 
euphratica]
 ref|XP_011045975.1| PREDICTED: uncharacterized protein LOC105140725 isoform X1 [Populus 
euphratica]
 ref|XP_011045976.1| PREDICTED: uncharacterized protein LOC105140725 isoform X1 [Populus 
euphratica]
Length=291

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE +  A YDE   +  S + L   ++  E  M F+Q+P  +P  K        
Sbjct  135  LDEEEFGEVSEAATYDENSTN--SAVELGLMEENVEASMLFVQLPPAMPMIKR-------  185

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+  G EV E    + G   +E             K C L+ELP GYMGK+LVY+SG 
Sbjct  186  -SATAVGPEVKESSRPSGGARAIE-------------KTCRLDELPAGYMGKVLVYRSGA  231

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVSPG+    AQ+VVAIN  ++ CC +  I K   +
Sbjct  232  VKLKLGDTLYDVSPGMNSIFAQDVVAINRGEETCCVVAEIEKRVTL  277



>gb|KJB83018.1| hypothetical protein B456_013G225500 [Gossypium raimondii]
Length=289

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 91/166 (55%), Gaps = 30/166 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  AA+N  YDE  I P+  LGL++E  E    M F+Q+P  LP  K+  +    
Sbjct  140  LDEEEF--AAQNVAYDENSIEPAVGLGLMEENLEPM--MLFLQLPPTLPIIKAGHE----  191

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              AS+ G                       R   S KK C L ELP G MGKMLVYKSG 
Sbjct  192  -GASSTGSS---------------------RTVRSAKKTCGLTELPAGLMGKMLVYKSGA  229

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ +YDV+PG+    AQ+VVA++T  K CC +G + KH +V
Sbjct  230  VKLKLGDTIYDVNPGLSCVFAQDVVAVDTAKKQCCVVGEVNKHVIV  275



>emb|CDP03102.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (55%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EF EA+ +  YDE     S+   +     E +  M F+Q+P ++P  K +      
Sbjct  108  LDQEEFDEASESLNYDEC----STNAAVELGLTEGKETMLFLQLPASMPMIKQL------  157

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               +T G E+ +     K  E ++             K CSL+ELP G+MGK+LVY+SG 
Sbjct  158  --PNTAGSEMADTSKPTKSGELLQ-------------KSCSLDELPAGFMGKILVYRSGA  202

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDVS G+    AQ+VVAIN  +K+CC +G + K  ++
Sbjct  203  VKLKLGDNLYDVSVGLDCVFAQDVVAINDEEKHCCTVGELDKRVII  248



>ref|XP_010321121.1| PREDICTED: uncharacterized protein LOC101251183 isoform X1 [Solanum 
lycopersicum]
Length=284

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 92/166 (55%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEA+++  YDE  I P+  + L   ++  E +MF +Q+P  +P  K        
Sbjct  137  LDEEEFGEASQSLTYDENSIKPA--MDLGLMEENLEEKMFLVQLP-TMPMLKQ-------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +  T+G E+     ++K                   K CSL ELP G MGK+LVYKSG 
Sbjct  187  -SIKTEGSEMANSSKTSKA------------------KACSLNELPAGLMGKLLVYKSGA  227

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG  L++VSPG+  S AQ+VVA+NT +K C  +G + K  ++
Sbjct  228  VKLKLGETLFNVSPGMDCSFAQDVVAVNTEEKYCSNIGELTKRIII  273



>ref|XP_003550619.1| PREDICTED: uncharacterized protein LOC100802173 [Glycine max]
 gb|KHN17712.1| DNA-directed RNA polymerase III subunit RPC4 [Glycine soja]
Length=298

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 90/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EF EAA++  Y+E     +S + L   ++  E  MF I +P  LP  K        
Sbjct  142  LDDEEFAEAAQSRTYEENA--SNSTMDLGLLEENPEASMFLINLPTKLPMIKQ-------  192

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+   K+V E      G + VE             + C L EL  G+MGKMLVYKSG 
Sbjct  193  -SATAGDKDVNEKSIPHGGSKNVE-------------ELCELNELSSGFMGKMLVYKSGA  238

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLGN LYDVS G+  + AQ++VA+NT  K+CC +G I KH  +
Sbjct  239  IKLKLGNTLYDVSSGMNCACAQDLVAVNTAQKHCCTIGEISKHVTI  284



>gb|KHN07911.1| DNA-directed RNA polymerase III subunit RPC4 [Glycine soja]
Length=302

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 88/166 (53%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGEAA    YDE     +S + L   +   E  MFFI +P  LP  K        
Sbjct  146  LDDQEFGEAAEPRAYDENA--SNSAMELDLLEHNPEASMFFINLPTKLPMIKQ-------  196

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              ++T G   + V +   G  K            + ++ C L EL  G+MGKMLVYKSG 
Sbjct  197  --SATAGSSDVNVKSRPHGGSK------------NVEELCELNELSSGFMGKMLVYKSGA  242

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLGN LYDVS G+  + AQ++VAINT  K+CC +G I K   +
Sbjct  243  IKLKLGNTLYDVSSGMKCACAQDLVAINTAQKHCCTIGEISKRVSI  288



>gb|KHG19108.1| DNA-directed RNA polymerase III subunit RPC4 [Gossypium arboreum]
Length=166

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 96/166 (58%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  A  NA ++E  + P+ ELGL++E  E    MFFIQ+P  LP  K  G+    
Sbjct  12   LDEEEF--ALANATFEEDSVEPAVELGLMEENSEAT--MFFIQLPPTLPMTKQTGN----  63

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G E     T+++ K     P   +    S KK C +EEL  G+MGKMLVY+SG 
Sbjct  64   ----ISGNE-----TNSRSK-----PAASV---GSAKKTCGIEELSAGFMGKMLVYRSGA  106

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV PG     +Q+VVA+NT  K+CC +G I K A++
Sbjct  107  VKLKLGDTLYDVIPGCNGEFSQDVVAVNTGKKHCCGVGEIDKRAIL  152



>ref|XP_010049526.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X1 [Eucalyptus grandis]
Length=304

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 96/168 (57%), Gaps = 23/168 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERR--MFFIQIPNNLPSCKSIGDQT  575
            LDE EFGEA  +  Y+E  ++ + EL L+D Q +      MFFIQ+P  +P  K      
Sbjct  144  LDEEEFGEAPSSVTYNENILNTAMELDLMDSQRDGSLEPSMFFIQLPPTVPMAKR-----  198

Query  574  TLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
               + +  G E  E  TS+           VL    S +K CSL+ELP G MGKMLVY+S
Sbjct  199  ---STTAAGNETTESSTSS----------NVL---GSLEKSCSLDELPAGLMGKMLVYRS  242

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VKLKLG+ LYDVS G+    AQ+VVA+N  +K+ C +G + K A++
Sbjct  243  GAVKLKLGDTLYDVSSGLDCVFAQDVVAVNRTEKHFCVVGELNKRAIL  290



>ref|XP_010049527.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X2 [Eucalyptus grandis]
 gb|KCW82159.1| hypothetical protein EUGRSUZ_C03553 [Eucalyptus grandis]
 gb|KCW82160.1| hypothetical protein EUGRSUZ_C03553 [Eucalyptus grandis]
Length=304

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 96/168 (57%), Gaps = 23/168 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERR--MFFIQIPNNLPSCKSIGDQT  575
            LDE EFGEA  +  Y+E  ++ + EL L+D Q +      MFFIQ+P  +P  K      
Sbjct  144  LDEEEFGEAPSSVTYNENILNTAMELDLMDSQRDGSLEPSMFFIQLPPTVPMAKR-----  198

Query  574  TLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
               + +  G E  E  TS+           VL    S +K CSL+ELP G MGKMLVY+S
Sbjct  199  ---STTAAGNETTESSTSS----------NVL---GSLEKSCSLDELPAGLMGKMLVYRS  242

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VKLKLG+ LYDVS G+    AQ+VVA+N  +K+ C +G + K A++
Sbjct  243  GAVKLKLGDTLYDVSSGLDCVFAQDVVAVNRTEKHFCVVGELNKRAIL  290



>ref|XP_004287620.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Fragaria vesca subsp. vesca]
Length=286

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 89/166 (54%), Gaps = 26/166 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L++ EFG+ +  + YDE     + +L L +E       MFF+ +P  LP  K        
Sbjct  133  LNQQEFGDGSEESTYDENATPAADDLDLREENRATS--MFFLHLPPTLPMLKQ-------  183

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PA    G++V     +  G    E P             CSL +LP G+MGKMLVY+SG 
Sbjct  184  PA----GQQVNNSSGAPGGARNTEKP-------------CSLGDLPAGFMGKMLVYRSGA  226

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +K+KLG+ LYDVS G+    AQ+VVAINT +K CC +G + K AVV
Sbjct  227  IKMKLGDTLYDVSTGMNCDFAQDVVAINTTEKKCCTIGELNKRAVV  272



>ref|XP_003541303.2| PREDICTED: uncharacterized protein LOC100782982 [Glycine max]
Length=318

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 88/166 (53%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGEAA    YDE     +S + L   +   E  MFFI +P  LP  K        
Sbjct  146  LDDQEFGEAAEPRAYDENA--SNSAMELDLLEHNPEASMFFINLPTKLPMIKQ-------  196

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              ++T G   + V +   G  K            + ++ C L EL  G+MGKMLVYKSG 
Sbjct  197  --SATAGSSDVNVKSRPHGGSK------------NVEELCELNELSSGFMGKMLVYKSGA  242

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG+ LYDVS G+  + AQ++VAINT  K+CC +G I K   +
Sbjct  243  IKLKLGDTLYDVSSGMKCACAQDLVAINTAQKHCCTIGEISKRVSI  288



>ref|XP_010090130.1| DNA-directed RNA polymerase III subunit RPC4 [Morus notabilis]
 gb|EXB38927.1| DNA-directed RNA polymerase III subunit RPC4 [Morus notabilis]
Length=328

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 95/166 (57%), Gaps = 22/166 (13%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFG       YDET    ++ELGL++E  E    M  +Q+P  +P  K   +    
Sbjct  171  LDEEEFGADTETINYDETSAKAATELGLVEENPETS--MILLQLPPIMPLMKRSAN----  224

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                           +A G+E  ++ P  +  +++  K C+L ELP G+MGKMLVY+SG 
Sbjct  225  ---------------TAAGQEATKSSPAPVVAQAT-HKACALHELPAGFMGKMLVYRSGA  268

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLK+G+ LYDVS G+    +Q+VVAINTV+K+CC +G + K A +
Sbjct  269  IKLKIGDTLYDVSSGMDCVFSQDVVAINTVEKHCCAVGELKKRAAI  314



>gb|KJB54458.1| hypothetical protein B456_009G035100 [Gossypium raimondii]
Length=294

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 95/166 (57%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  A  NA ++E  + P+ ELGL++E  E    MFFIQ+P  LP  K  G+    
Sbjct  140  LDEEEFALA--NATFEEDSVEPAVELGLMEENSEAT--MFFIQLPPTLPMTKQTGN----  191

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G E     T+++ K              S KK   +EELP G+MGKMLVY+SG 
Sbjct  192  ----ISGNE-----TNSRSKPAAS--------VGSAKKTRGIEELPAGFMGKMLVYRSGA  234

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV+PG     +Q+VVA+NT  K+CC +G I K A++
Sbjct  235  VKLKLGDSLYDVTPGCNSEFSQDVVAVNTGKKHCCGVGEIDKRAIL  280



>ref|XP_011470059.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=323

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 96/166 (58%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EF E A   EYDE+ I+ +SELGLL++  +   ++ F+Q+P  LP           
Sbjct  167  LNEKEFVEDAAK-EYDESTINCASELGLLEQNPK--EKLLFVQLPPTLP-----------  212

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     +++  TSAKGKEKV    T   +  + KK   LEEL  GYMGKMLVYKSG 
Sbjct  213  ---------LVKRSTSAKGKEKV-GSSTPSEKVGAAKKSGGLEELSEGYMGKMLVYKSGA  262

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ LYDVSPG     AQ++ AINT  + CC LG + +  VV
Sbjct  263  VKFKLGDALYDVSPGSDCVFAQDIAAINTAARKCCVLGELGQRVVV  308



>gb|KJB54460.1| hypothetical protein B456_009G035100 [Gossypium raimondii]
Length=284

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 95/166 (57%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  A  NA ++E  + P+ ELGL++E  E    MFFIQ+P  LP  K  G+    
Sbjct  130  LDEEEFALA--NATFEEDSVEPAVELGLMEENSEAT--MFFIQLPPTLPMTKQTGN----  181

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G E     T+++ K              S KK   +EELP G+MGKMLVY+SG 
Sbjct  182  ----ISGNE-----TNSRSKPAAS--------VGSAKKTRGIEELPAGFMGKMLVYRSGA  224

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV+PG     +Q+VVA+NT  K+CC +G I K A++
Sbjct  225  VKLKLGDSLYDVTPGCNSEFSQDVVAVNTGKKHCCGVGEIDKRAIL  270



>ref|XP_011470060.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=322

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 96/166 (58%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EF E A   EYDE+ I+ +SELGLL++  +   ++ F+Q+P  LP           
Sbjct  166  LNEKEFVEDAAK-EYDESTINCASELGLLEQNPK--EKLLFVQLPPTLP-----------  211

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     +++  TSAKGKEKV    T   +  + KK   LEEL  GYMGKMLVYKSG 
Sbjct  212  ---------LVKRSTSAKGKEKV-GSSTPSEKVGAAKKSGGLEELSEGYMGKMLVYKSGA  261

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ LYDVSPG     AQ++ AINT  + CC LG + +  VV
Sbjct  262  VKFKLGDALYDVSPGSDCVFAQDIAAINTAARKCCVLGELGQRVVV  307



>gb|KJB54459.1| hypothetical protein B456_009G035100 [Gossypium raimondii]
Length=273

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 95/166 (57%), Gaps = 25/166 (15%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  A  NA ++E  + P+ ELGL++E  E    MFFIQ+P  LP  K  G+    
Sbjct  119  LDEEEF--ALANATFEEDSVEPAVELGLMEENSEAT--MFFIQLPPTLPMTKQTGN----  170

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G E     T+++ K              S KK   +EELP G+MGKMLVY+SG 
Sbjct  171  ----ISGNE-----TNSRSKPAAS--------VGSAKKTRGIEELPAGFMGKMLVYRSGA  213

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV+PG     +Q+VVA+NT  K+CC +G I K A++
Sbjct  214  VKLKLGDSLYDVTPGCNSEFSQDVVAVNTGKKHCCGVGEIDKRAIL  259



>gb|KDO54063.1| hypothetical protein CISIN_1g022055mg [Citrus sinensis]
Length=303

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 27/168 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCK--SIGDQT  575
            LDE EFGEA+    YDE+ ++P+ ELGL++E  E    M F+Q+P  LP  K  + G++ 
Sbjct  147  LDEEEFGEASETINYDESSMNPAEELGLMEENLEP--NMIFLQLPPTLPLKKQPATGNER  204

Query  574  TLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
             +  +S+K +        A  KEK                  SL ELPGG+MGK+LVY+S
Sbjct  205  QVNESSSKHE-------GATAKEKT----------------SSLSELPGGFMGKLLVYRS  241

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VKLKLG+ +Y+V+PG+    AQ+VV INT +K+ C  G + K A++
Sbjct  242  GAVKLKLGDTVYNVTPGMDCMFAQDVVVINTAEKHFCVAGELNKRAIL  289



>ref|XP_010533037.1| PREDICTED: uncharacterized protein LOC104808893 [Tarenaya hassleriana]
 ref|XP_010533038.1| PREDICTED: uncharacterized protein LOC104808893 [Tarenaya hassleriana]
Length=283

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 96/167 (57%), Gaps = 27/167 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedER-RMFFIQIPNNLPSCKSIGDQTT  572
            LDE EF  A++ A + E  I+ ++ELGL+   +  E  +M F+Q+P   P  K +     
Sbjct  129  LDEEEFAPASQAATHHENSINAAAELGLMARDETVEEPKMLFMQLPT-APMFKQLSTS--  185

Query  571  LPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
                                 E+ EN P +     + +K C L+ELP G+MGKM+VYKSG
Sbjct  186  ---------------------EQNENKPDM--EAGAKEKACGLKELPKGFMGKMIVYKSG  222

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
             VKLKLG++LYDV+PG+    AQ+V+AIN+ +K CC +  ++KHAV+
Sbjct  223  AVKLKLGDVLYDVNPGLKCEFAQDVMAINSAEKQCCLIEKVHKHAVL  269



>ref|XP_003568830.1| PREDICTED: uncharacterized protein LOC100846711 [Brachypodium 
distachyon]
Length=309

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 90/166 (54%), Gaps = 14/166 (8%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   DE     ++   L      D  ++ F Q+P++LP    + +Q   
Sbjct  142  LDEEEFGESSASRAQDEL----TAAEELGLMDRSDTPQLLFFQLPSSLP----LPNQAQS  193

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                  G E    P S      + +  T  + R S   G  +++LPGG+MGK+LVYKSG 
Sbjct  194  VEQPNTGSEENAEPAS------INSMLTCEKTRPSSLTGSKVKDLPGGFMGKILVYKSGK  247

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+K+G+ L+DVSPG     AQEV AINT +  CC LG I K AVV
Sbjct  248  VKMKIGDALFDVSPGANCKFAQEVTAINTRENQCCALGEISKRAVV  293



>gb|KDO49942.1| hypothetical protein CISIN_1g0205542mg, partial [Citrus sinensis]
Length=273

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 82/166 (49%), Gaps = 36/166 (22%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE  RN+EYDE                                   S+     L
Sbjct  134  LDQEEFGENTRNSEYDEN----------------------------------SVNSAADL  159

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                 K   + + P S KGKEK E+    L R  +P K   L +LPGGYMGKMLVYKSG 
Sbjct  160  GLLLPKKLPLDKRPASTKGKEKAES-SKPLGRTDAP-KDLDLSKLPGGYMGKMLVYKSGA  217

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK KLG+ L+DVS G   S AQ++V I+  DK CC LG + K AVV
Sbjct  218  VKFKLGDTLFDVSAGSDCSFAQDLVVIDVKDKTCCVLGQLDKLAVV  263



>emb|CDY03371.1| BnaC01g17110D [Brassica napus]
Length=313

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 88/166 (53%), Gaps = 36/166 (22%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFG  A++A YDE  I+ S+E   L      +++M F +IP+ LP           
Sbjct  166  LDQEEFGNVAKHAHYDENSIN-SAEELGLTSGQHCKKQMLFFKIPDCLP-----------  213

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     V + PTS +           +  RSSP +G     LP G+MGKMLVYKSG 
Sbjct  214  ---------VTKQPTSKRS----------VSERSSPFEG-----LPEGFMGKMLVYKSGT  249

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++LYDVSPG       +V AIN  ++NCC++G   K A V
Sbjct  250  VKLKLGDVLYDVSPGPNTVFHNDVAAINGKERNCCRIGSSAKFATV  295



>ref|XP_008362778.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Malus domestica]
Length=157

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 86/133 (65%), Gaps = 23/133 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGE A   EYDE  I+P+SELGLL+E+++   ++ FIQ+P+ LPS       T+ 
Sbjct  45   LNENEFGEDAEK-EYDENTINPASELGLLEEKEQA--KLLFIQLPSILPS-------TSK  94

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            PAA+ KGKE +   TS             L    +P+KGCSLEELP GYMGKMLV KSG 
Sbjct  95   PAATAKGKEKVGSSTS-------------LESTGAPEKGCSLEELPAGYMGKMLVSKSGK  141

Query  388  VKLKLGNILYDVS  350
            VKL+LG+  YDVS
Sbjct  142  VKLRLGDTFYDVS  154



>ref|XP_009138954.1| PREDICTED: uncharacterized protein LOC103862974 isoform X1 [Brassica 
rapa]
Length=315

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 90/166 (54%), Gaps = 35/166 (21%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFG  A++  YDE  I+ + ELGL  +    +++M F ++P++LP           
Sbjct  167  LDQEEFGNVAKHLHYDENSINSAEELGLTSQGPHCKKQMLFFKVPDSLP-----------  215

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     V + PT+ +           +  RSSP +G     LP G+MGKMLVYKSG 
Sbjct  216  ---------VTKQPTAKRS----------VSERSSPFEG-----LPEGFMGKMLVYKSGT  251

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++LYDVSPG       +V AIN  ++NCC++G   K A V
Sbjct  252  VKLKLGDVLYDVSPGPNTVFHNDVAAINGKERNCCRIGSSAKFATV  297



>ref|XP_006428587.1| hypothetical protein CICLE_v10012311mg [Citrus clementina]
 ref|XP_006480425.1| PREDICTED: uncharacterized protein LOC102622464 [Citrus sinensis]
 gb|ESR41827.1| hypothetical protein CICLE_v10012311mg [Citrus clementina]
Length=303

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (58%), Gaps = 27/168 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCK--SIGDQT  575
            LDE EFGEA+    YDE+ ++P+ ELGL++E  E    M F+Q+P  LP  K  + G++ 
Sbjct  147  LDEEEFGEASETINYDESSMNPAEELGLMEENLEP--NMIFLQLPPTLPLKKQPATGNER  204

Query  574  TLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
             +  +S+K +        A  KEK                  SL ELPG +MGK+LVY+S
Sbjct  205  QVTESSSKHE-------GATAKEKT----------------SSLSELPGAFMGKLLVYRS  241

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VKLKLG  +Y+V+PG+    AQ+VV INT +K+ C  G + K A++
Sbjct  242  GAVKLKLGETVYNVTPGMDCMFAQDVVVINTAEKHFCVAGELNKRAIL  289



>ref|XP_007131354.1| hypothetical protein PHAVU_011G006800g [Phaseolus vulgaris]
 gb|ESW03348.1| hypothetical protein PHAVU_011G006800g [Phaseolus vulgaris]
Length=318

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 82/166 (49%), Gaps = 31/166 (19%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA +++YDE  ++  S   L   +  ++ +MF  Q P N P           
Sbjct  167  LDEEEFGEAATSSKYDENAVN--SAAELKLLEKSEQHKMFLFQFPKNFP----------F  214

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               S K K  I   T+  GK                    +LEELP GYMGKM +YKSG 
Sbjct  215  NVGSNKEKGQIGA-TTVSGK------------------AGALEELPSGYMGKMQIYKSGA  255

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KLKLG  L+DVSPG     +Q+VVA+N   K  C LG +    VV
Sbjct  256  IKLKLGETLFDVSPGTKCGFSQDVVAVNIAQKQICNLGEVNHKVVV  301



>ref|XP_008779737.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like, 
partial [Phoenix dactylifera]
Length=181

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 17/168 (10%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGE++     D      ++   L      D+ ++ F Q+P +LP  K    Q   
Sbjct  13   LNEEEFGESSATGAQDGEL---TTAEELGLMHRSDKAQLLFFQMPASLPLPK----QPDS  65

Query  568  PAASTKGKEVIEVPTSAKGKEKVE--NPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
             A + KG  V   PTS   KE      PP VL        G  L++LP G+MGK+LVY+S
Sbjct  66   VAETDKGDGVDAEPTSTSSKEMHAGTRPPKVL--------GSKLKDLPEGFMGKILVYRS  117

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VK+K+G+ L+DVSPG      QEV AIN  +K+CC LG I K A+V
Sbjct  118  GKVKMKIGDSLFDVSPGSNCMFVQEVAAINAREKHCCTLGEISKRAIV  165



>ref|NP_196500.1| RNA polymerase III RPC4 [Arabidopsis thaliana]
 emb|CAC05464.1| putative protein [Arabidopsis thaliana]
 gb|AED91384.1| RNA polymerase III RPC4 [Arabidopsis thaliana]
Length=272

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 77/130 (59%), Gaps = 28/130 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            ++MFF+++P             ++P AST        PT     E +E  P +  +    
Sbjct  157  QKMFFMRLP-------------SVPLAST--------PT-----ENLETRPNI--KGPVE  188

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            KK   L+ LP GYMGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+ +NT  KNCC 
Sbjct  189  KKTVDLKALPEGYMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMVVNTEQKNCCL  248

Query  280  LGGIYKHAVV  251
            +G +YKHAV+
Sbjct  249  VGDVYKHAVL  258



>ref|XP_008672161.1| PREDICTED: uncharacterized protein LOC100193764 isoform X2 [Zea 
mays]
Length=310

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  205  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  230

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  231  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  289

Query  277  GGIY-KHAVV  251
            G I  +H +V
Sbjct  290  GEIENRHVIV  299



>ref|XP_008672159.1| PREDICTED: uncharacterized protein LOC100193764 isoform X1 [Zea 
mays]
 gb|ACN35249.1| unknown [Zea mays]
 tpg|DAA56430.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=311

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  206  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  231

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  232  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  290

Query  277  GGIY-KHAVV  251
            G I  +H +V
Sbjct  291  GEIENRHVIV  300



>ref|XP_008672162.1| PREDICTED: uncharacterized protein LOC100193764 isoform X3 [Zea 
mays]
 ref|XP_008672163.1| PREDICTED: uncharacterized protein LOC100193764 isoform X3 [Zea 
mays]
 ref|XP_008672164.1| PREDICTED: uncharacterized protein LOC100193764 isoform X3 [Zea 
mays]
 tpg|DAA56431.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
 tpg|DAA56432.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
 tpg|DAA56433.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=274

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  169  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  194

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  195  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  253

Query  277  GGIY-KHAVV  251
            G I  +H +V
Sbjct  254  GEIENRHVIV  263



>ref|XP_010422990.1| PREDICTED: uncharacterized protein LOC104708180 [Camelina sativa]
Length=271

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 28/130 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            ++MFF+++P+ +P           PAA+T+ +E         GK  ++ P          
Sbjct  156  QKMFFMKLPS-VPMA---------PAATTENRE---------GKPNIKGPV---------  187

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            KK   L+ LP G+MGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+ ++T  KNCC 
Sbjct  188  KKTVDLKALPEGFMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMVVDTEQKNCCL  247

Query  280  LGGIYKHAVV  251
            +G +YKHAV+
Sbjct  248  VGDVYKHAVL  257



>ref|XP_008672165.1| PREDICTED: uncharacterized protein LOC100193764 isoform X4 [Zea 
mays]
 ref|XP_008672166.1| PREDICTED: uncharacterized protein LOC100193764 isoform X4 [Zea 
mays]
 gb|ACR38260.1| unknown [Zea mays]
 tpg|DAA56434.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=273

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  168  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  193

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  194  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  252

Query  277  GGI-YKHAVV  251
            G I  +H +V
Sbjct  253  GEIENRHVIV  262



>ref|NP_001132322.1| uncharacterized protein LOC100193764 [Zea mays]
 gb|ACF81122.1| unknown [Zea mays]
 tpg|DAA56435.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=268

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  163  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  188

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  189  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  247

Query  277  GGI-YKHAVV  251
            G I  +H +V
Sbjct  248  GEIENRHVIV  257



>gb|ACG31814.1| hypothetical protein [Zea mays]
Length=267

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  162  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  187

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  188  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  246

Query  277  GGI-YKHAVV  251
            G I  +H +V
Sbjct  247  GEIENRHVIV  256



>ref|XP_008672167.1| PREDICTED: uncharacterized protein LOC100193764 isoform X5 [Zea 
mays]
 tpg|DAA56436.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=267

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 36/130 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMFF Q PN+LP  K          +S+ GKEV+E                         
Sbjct  162  RMFFFQFPNSLPLPKR---------SSSAGKEVME-------------------------  187

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC L
Sbjct  188  -GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLL  246

Query  277  GGI-YKHAVV  251
            G I  +H +V
Sbjct  247  GEIENRHVIV  256



>ref|XP_004495578.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Cicer arietinum]
Length=298

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 90/166 (54%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEAA    YDE+K +  S + L   ++  E   FFI++P  +P  K+       
Sbjct  140  LNEEEFGEAAITRTYDESKSN--SAMELGLLEENPEASAFFIKLPPVVPMIKNPAK----  193

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             A S   KE  + P  +KG  K+                  L ELP G MGKMLVYKSG 
Sbjct  194  -AGSQDVKENSKRPRVSKGVGKL----------------YKLNELPPGLMGKMLVYKSGA  236

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLGN LYDVS G+  S AQ+  A+NT +K+C  +G I KHA +
Sbjct  237  VKLKLGNTLYDVSSGMDCSFAQDYAAMNTAEKHCSIIGEITKHATI  282



>ref|XP_010452926.1| PREDICTED: uncharacterized protein LOC104734928 [Camelina sativa]
Length=272

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 28/130 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            ++MFF+++P+ +P           PAA+T+ +E         GK  ++ P          
Sbjct  157  QKMFFMKLPS-VPMA---------PAATTENRE---------GKPNIKGPV---------  188

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            KK   L+ LP G+MGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+ ++T  KNCC 
Sbjct  189  KKTVDLKALPEGFMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMVVDTEQKNCCL  248

Query  280  LGGIYKHAVV  251
            +G +YKHAV+
Sbjct  249  VGDVYKHAVL  258



>ref|XP_009138960.1| PREDICTED: uncharacterized protein LOC103862974 isoform X2 [Brassica 
rapa]
Length=314

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 88/166 (53%), Gaps = 36/166 (22%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFG  A++  YDE  I+ S+E   L      +++M F ++P++LP           
Sbjct  167  LDQEEFGNVAKHLHYDENSIN-SAEELGLTSGPHCKKQMLFFKVPDSLP-----------  214

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     V + PT+ +           +  RSSP +G     LP G+MGKMLVYKSG 
Sbjct  215  ---------VTKQPTAKRS----------VSERSSPFEG-----LPEGFMGKMLVYKSGT  250

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++LYDVSPG       +V AIN  ++NCC++G   K A V
Sbjct  251  VKLKLGDVLYDVSPGPNTVFHNDVAAINGKERNCCRIGSSAKFATV  296



>ref|NP_001052654.2| Os04g0394500 [Oryza sativa Japonica Group]
 emb|CAD40550.1| OSJNBa0072K14.7 [Oryza sativa Japonica Group]
 gb|EAZ30567.1| hypothetical protein OsJ_14617 [Oryza sativa Japonica Group]
 dbj|BAF14568.2| Os04g0394500 [Oryza sativa Japonica Group]
Length=276

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 17/168 (10%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGE++     D      ++   L      D+ ++ F Q+P +LP  K    Q   
Sbjct  108  LNEEEFGESSATGAQDG---ELTTAEELGLMHRSDKAQLLFFQMPASLPLPK----QPDS  160

Query  568  PAASTKGKEVIEVPTSAKGKEKV--ENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
             A + KG  V   PTS   KE      PP VL        G  L++LP G+MGK+LVY+S
Sbjct  161  VAETDKGDGVDAEPTSTSSKEMHAGTRPPKVL--------GSKLKDLPEGFMGKILVYRS  212

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VK+K+G+ L+DVSPG      QEV AIN  +K+CC LG I K A+V
Sbjct  213  GKVKMKIGDSLFDVSPGSNCMFVQEVAAINAREKHCCTLGEISKRAIV  260



>emb|CDX89440.1| BnaA01g14530D [Brassica napus]
Length=313

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 88/166 (53%), Gaps = 36/166 (22%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFG  A++  YDE  I+ S+E   L      +++M F ++P++LP           
Sbjct  166  LDQEEFGNVAKHLHYDENSIN-SAEELGLTSGPHCKKQMLFFKVPDSLP-----------  213

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     V + PT+ +           +  RSSP +G     LP G+MGKMLVYKSG 
Sbjct  214  ---------VTKQPTAKRS----------VSERSSPFEG-----LPEGFMGKMLVYKSGT  249

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++LYDVSPG       +V AIN  ++NCC++G   K A V
Sbjct  250  VKLKLGDVLYDVSPGPNTVFHNDVAAINGKERNCCRIGSSAKFATV  295



>ref|XP_008450913.1| PREDICTED: uncharacterized protein LOC103492360 [Cucumis melo]
Length=293

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 91/166 (55%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEA+ N  YDE     ++ + L   ++  E  +FF+Q+P  +P  K        
Sbjct  137  LNEEEFGEASENFTYDENTT--TAAMNLGLLEENPETDVFFLQLPPMVPMIKQ-------  187

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              +ST       V     G    +N  +  R     +K CS+ ELP G MGK+LVY+SG 
Sbjct  188  --SST-------VENMGSGNVSEQNSASQTR-----QKTCSMNELPSGSMGKLLVYRSGA  233

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+I+YDVS G+    AQEV AIN   K+CC +G + K A++
Sbjct  234  VKLKLGDIIYDVSSGMDCGFAQEVAAINMEGKHCCIVGELSKRAIL  279



>ref|XP_008453902.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Cucumis melo]
Length=334

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 93/166 (56%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFG+ A N EYDE  + P+ +LGL DE  E+ +  +F Q+P  LP          L
Sbjct  178  LDEAEFGQDAMNREYDENSVIPALDLGLQDENTENTK--YFFQLPARLP----------L  225

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P  S+          +A GKEKV N  +     SS      L++L  G MGK+L+YKSG 
Sbjct  226  PKQSS----------TATGKEKVGNSRSSNSTSSSDLD--DLKKLSAGCMGKLLIYKSGA  273

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ILYDVS G   S  Q VVAINT    CC LG I K  VV
Sbjct  274  IKLRLGDILYDVSSGSDCSFLQHVVAINTEKGQCCDLGDIGKRVVV  319



>emb|CAH66462.1| H0718E12.6 [Oryza sativa Indica Group]
 emb|CAH66463.1| H0718E12.7 [Oryza sativa Indica Group]
Length=308

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 17/168 (10%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGE++     D      ++   L      D+ ++ F Q+P +LP  K    Q   
Sbjct  140  LNEEEFGESSATGAQDG---ELTTAEELGLMHRSDKAQLLFFQMPASLPLPK----QPDS  192

Query  568  PAASTKGKEVIEVPTSAKGKEKV--ENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKS  395
             A + KG  V   PTS   KE      PP VL        G  L++LP G+MGK+LVY+S
Sbjct  193  VAETDKGDGVDAEPTSTSSKEMHAGTRPPKVL--------GSKLKDLPEGFMGKILVYRS  244

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VK+K+G+ L+DVSPG      QEV AIN  +K+CC LG I K A+V
Sbjct  245  GKVKMKIGDSLFDVSPGSNCMFVQEVAAINAREKHCCTLGEISKRAIV  292



>ref|XP_010491563.1| PREDICTED: uncharacterized protein LOC104769122 [Camelina sativa]
Length=272

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 78/130 (60%), Gaps = 28/130 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            ++MFF+++P+ +P            AA+T+ +E         GK  ++ P          
Sbjct  157  QKMFFMKLPS-VPMAS---------AATTENRE---------GKPNIKGPV---------  188

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            KK   L+ LP G+MGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+ +NT  KNCC 
Sbjct  189  KKTVDLKALPEGFMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMVVNTEQKNCCL  248

Query  280  LGGIYKHAVV  251
            +G +YKHAV+
Sbjct  249  VGDVYKHAVL  258



>gb|KEH29411.1| RNA polymerase III RPC4 [Medicago truncatula]
Length=310

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 83/160 (52%), Gaps = 26/160 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGEAA + +YD   ++  S   L      ++ ++ F ++P  LP  K        
Sbjct  155  LDEIEFGEAATDVKYDGDNLN--SAEELGLSDKSEQPQLIFFKLPTVLPCVKQ-------  205

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                         P ++KGKEK+       +  +  KK  +L ELP GYMGKM VYKSG 
Sbjct  206  -------------PVNSKGKEKI----GTSKVSAKAKKASNLLELPSGYMGKMQVYKSGA  248

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGI  269
            VKLK+G  LYDVSPG      Q+VVAINT  KN   +G +
Sbjct  249  VKLKIGETLYDVSPGTKTILDQDVVAINTAKKNYSVVGKV  288



>ref|XP_002873399.1| DNA-directed RNA polymerase III RPC4 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49658.1| DNA-directed RNA polymerase III RPC4 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=271

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = -1

Query  532  VPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDV  353
            VP ++   E  E  P +   R   +K   L+ LP G+MGK+LVYKSG VK+KLG +LYDV
Sbjct  167  VPLASTPTENRETKPNI---RGPVQKTVDLKALPEGFMGKLLVYKSGAVKMKLGEVLYDV  223

Query  352  SPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            SPG+    AQ+V+ +NT  KNCC +G +YKHAV+
Sbjct  224  SPGLKSEFAQDVMVVNTEQKNCCLVGDVYKHAVL  257



>tpg|DAA56437.1| TPA: hypothetical protein ZEAMMB73_943001 [Zea mays]
Length=105

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 36/129 (28%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            MFF Q PN+LP  K          +S+ GKEV+E                          
Sbjct  1    MFFFQFPNSLPLPKR---------SSSAGKEVME--------------------------  25

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
            G +L++LP GY+GKMLVYKSG +K+KLG+I++DV+PGV     Q  VA+NT DK+CC LG
Sbjct  26   GSNLQQLPQGYLGKMLVYKSGKIKMKLGDIIFDVNPGVESRMLQRAVALNTRDKHCCLLG  85

Query  274  GI-YKHAVV  251
             I  +H +V
Sbjct  86   EIENRHVIV  94



>ref|XP_004952578.1| PREDICTED: uncharacterized protein LOC101786879 [Setaria italica]
Length=302

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 87/166 (52%), Gaps = 21/166 (13%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFG ++  A+  E     S+   L   Q  D  ++ F Q P  LP  +        
Sbjct  145  LDEEEFGHSSGRAQVSEL----SAAEELGLMQRVDTPQLLFFQFPTTLPLPRQAD-----  195

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P A T     + +   + G  +        +RR     GC L+ELP G+MGKMLVYKSG 
Sbjct  196  PDAGTN----MNMNAKSMGDNR--------KRRLDSIHGCGLKELPDGFMGKMLVYKSGK  243

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+ LG++L+DVS G      QEVVAINT +K+CC +G I K A+V
Sbjct  244  VKMTLGDVLFDVSAGSNCMFPQEVVAINTREKHCCGIGEIGKRAIV  289



>ref|XP_007204524.1| hypothetical protein PRUPE_ppa017748mg [Prunus persica]
 gb|EMJ05723.1| hypothetical protein PRUPE_ppa017748mg [Prunus persica]
Length=281

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 21/128 (16%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            MFF+Q+P N+P+ K         +A+   +EV           K   PP   R    P  
Sbjct  161  MFFLQLPPNMPTIKR--------SATADSQEVT----------KSSGPPGGARNMQKP--  200

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
             CSL ELP G+MGKMLVY+SG VK+K+G+ L+DVSPG+    AQ+VV +N  +K C  +G
Sbjct  201  -CSLSELPAGFMGKMLVYRSGAVKMKIGDSLFDVSPGMNCDFAQDVVVVNKAEKGCGIIG  259

Query  274  GIYKHAVV  251
             + K A++
Sbjct  260  ELNKRAII  267



>ref|NP_194248.2| RNA polymerase III RPC4 [Arabidopsis thaliana]
 gb|AAT46034.1| At4g25180 [Arabidopsis thaliana]
 gb|AAU29479.1| At4g25180 [Arabidopsis thaliana]
 dbj|BAE98845.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85021.1| RNA polymerase III RPC4 [Arabidopsis thaliana]
Length=311

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 90/166 (54%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A+N +YDE  I+ S+E   L      +++MF  +IP+ LP  K    QTT 
Sbjct  157  LDQEEFGEVAKNRDYDENTIN-SAEELGLTSVQHSKKQMFIFKIPDCLPVVK----QTT-  210

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A+TK + V E  +       + NP                E LP G+MGKMLVYKSG 
Sbjct  211  -GATTK-RSVREYSSG------ISNP---------------FEGLPEGFMGKMLVYKSGA  247

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLK+G+ L+DVSPG G     +VVAI+   +NC ++G   K   V
Sbjct  248  VKLKVGDALFDVSPGPGTKIPNDVVAIDIKGRNCSRIGSSAKFVTV  293



>ref|XP_010274963.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Nelumbo nucifera]
Length=246

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 99/165 (60%), Gaps = 23/165 (14%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            DE EFGEA+    YDE+ +  ++EL L++E  E   RM F+Q+P++LP  K         
Sbjct  90   DEEEFGEASEEIAYDESSVKLATELDLMEENKEA--RMIFLQLPSSLPLVKRSA------  141

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
             A+  G       T++  K+         R   S +K C LEELP G+MGKMLVY+SG V
Sbjct  142  TANNDG-------TNSGLKQ--------FRDGVSSEKPCELEELPAGFMGKMLVYESGVV  186

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG+ LYDVS G+    AQ+VVAINT +K+CC LG + K AV+
Sbjct  187  KLKLGDTLYDVSSGMNCVFAQDVVAINTEEKHCCILGELNKRAVI  231



>ref|XP_006652221.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4-like 
[Oryza brachyantha]
Length=313

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 95/169 (56%), Gaps = 17/169 (10%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCK---SIGDQ  578
            L+E EFGE++   + D      ++   L      DE ++FF Q+P +LP  K   S+ ++
Sbjct  143  LNEEEFGESSSTRDQDG---ELTAAEELGLMDRSDEPQLFFFQMPTSLPLPKQPDSVAEK  199

Query  577  TTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYK  398
             T   A  K       P +   K   ++P T    R S   G  L+ELPGG++GK+LVYK
Sbjct  200  DTGAGADAK-------PKNTGSKLTHKDPVT----RPSSLVGSRLKELPGGFIGKILVYK  248

Query  397  SGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            SG VK+K+ ++L+DVSPG     +QEV AINT +K+ C LG I K AVV
Sbjct  249  SGKVKMKINDLLFDVSPGSDCKFSQEVAAINTREKHLCALGEISKRAVV  297



>ref|XP_002867621.1| DNA-directed RNA polymerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43880.1| DNA-directed RNA polymerase [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A++ +Y+E  I+ S+E   L      + +MFF +IP+ LP           
Sbjct  161  LDQEEFGEVAKHRDYEENTIN-SAEELGLTSVQHCKNQMFFFKIPDCLP-----------  208

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     V++  T A  K  V        R  S  +    E LP G+MGKMLVYKSG 
Sbjct  209  ---------VMKQSTGATTKRSV--------REYSSGRSNPFEGLPEGFMGKMLVYKSGA  251

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++L+DV PG       +V AI+T  +NCC++G   K   V
Sbjct  252  VKLKLGDVLFDVLPGPNAKFHNDVAAIDTKGRNCCRIGSSAKFVTV  297



>gb|KFK29009.1| hypothetical protein AALP_AA7G077100 [Arabis alpina]
Length=318

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 29/165 (18%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            D+ EFGE A++ +YDE+ I+ S++   L  Q   +++MF  +IP+ LP            
Sbjct  165  DQEEFGELAKHPDYDESTIN-SAKELGLTSQQHCKKQMFMFKIPDELP------------  211

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
                    V++  T    K  + +         S K+    E L  G+MGKMLVYKSG V
Sbjct  212  --------VMKQSTGTNTKRSISD--------YSSKRNNPFEGLSEGFMGKMLVYKSGAV  255

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG+ L+DVSPG       +VVAINT  + CC++G   K A +
Sbjct  256  KLKLGDALFDVSPGPNTKFHSDVVAINTEGRKCCRIGSSAKFATI  300



>ref|XP_006288444.1| hypothetical protein CARUB_v10001705mg [Capsella rubella]
 gb|EOA21342.1| hypothetical protein CARUB_v10001705mg [Capsella rubella]
Length=271

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 29/130 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            ++MFF++IP+                          VP +++  E  E  P +   +   
Sbjct  157  QKMFFMRIPS--------------------------VPLASETTENREAKPNI---KGPV  187

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            +K   L+ LP G+MGK+LVYKSG VK+KLG +L+DVSPG+    AQ+V+ +NT  KNCC 
Sbjct  188  EKTLDLKALPEGFMGKLLVYKSGAVKMKLGEVLFDVSPGLKSEFAQDVMVVNTEQKNCCL  247

Query  280  LGGIYKHAVV  251
            +G +YKHAV+
Sbjct  248  VGDVYKHAVL  257



>ref|XP_010109751.1| DNA-directed RNA polymerase III subunit RPC4 [Morus notabilis]
 gb|EXC57358.1| DNA-directed RNA polymerase III subunit RPC4 [Morus notabilis]
Length=111

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = -1

Query  541  VIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNIL  362
            +++   SAKGKEKV +    L       KG   E+L  G+ GKMLVYKSG VKL+LG+IL
Sbjct  3    LVKRSASAKGKEKVGSS---LSLDGPSAKGSKFEDLAAGFAGKMLVYKSGAVKLRLGDIL  59

Query  361  YDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            YDVS G     A++VV INT +K CC LG + K AVV
Sbjct  60   YDVSAGSNCIFAEDVVTINTAEKQCCVLGALRKRAVV  96



>ref|XP_004146914.1| PREDICTED: uncharacterized protein LOC101207602 [Cucumis sativus]
 gb|KGN53151.1| hypothetical protein Csa_4G022870 [Cucumis sativus]
Length=334

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFG+   N EYDE  + P+ +LGLLDE  E  +  +F Q+P  LP          L
Sbjct  178  LDEAEFGQDVMNREYDENSVIPALDLGLLDENTESTK--YFFQLPARLP----------L  225

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P  S+          +A GKEKV N  +     +S      L++L  G MGK+L+YKSG 
Sbjct  226  PKQSS----------TATGKEKVGN--SRSSNSTSSSDLDDLKKLSAGCMGKLLIYKSGA  273

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ILYDVS G   S  Q VVAINT +  CC LG I    VV
Sbjct  274  IKLRLGDILYDVSSGSNCSFLQHVVAINTEEGQCCDLGDIGNRVVV  319



>gb|KFK29008.1| hypothetical protein AALP_AA7G077100 [Arabis alpina]
Length=317

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 30/165 (18%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            D+ EFGE A++ +YDE+ I+  S   L       +++MF  +IP+ LP            
Sbjct  165  DQEEFGELAKHPDYDESTIN--SAKELGLTSQHCKKQMFMFKIPDELP------------  210

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
                    V++  T    K  + +         S K+    E L  G+MGKMLVYKSG V
Sbjct  211  --------VMKQSTGTNTKRSISD--------YSSKRNNPFEGLSEGFMGKMLVYKSGAV  254

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG+ L+DVSPG       +VVAINT  + CC++G   K A +
Sbjct  255  KLKLGDALFDVSPGPNTKFHSDVVAINTEGRKCCRIGSSAKFATI  299



>ref|XP_004167167.1| PREDICTED: uncharacterized protein LOC101227599 [Cucumis sativus]
Length=322

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDEAEFG+   N EYDE  + P+ +LGLLDE  E  +  +F Q+P  LP          L
Sbjct  166  LDEAEFGQDVMNREYDENSVIPALDLGLLDENTESTK--YFFQLPARLP----------L  213

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P  S+          +A GKEKV N  +     +S      L++L  G MGK+L+YKSG 
Sbjct  214  PKQSS----------TATGKEKVGN--SRSSNSTSSSDLDDLKKLSAGCMGKLLIYKSGA  261

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +KL+LG+ILYDVS G   S  Q VVAINT +  CC LG I    VV
Sbjct  262  IKLRLGDILYDVSSGSNCSFLQHVVAINTEEGQCCDLGDIGNRVVV  307



>gb|AFK44935.1| unknown [Medicago truncatula]
Length=288

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 83/166 (50%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE A +  YDE+    SS + L   ++  E   FF+++P  +P  K        
Sbjct  136  LDEKEFGETAESRTYDESAA--SSAVELDLLEENPEASAFFMKLPPVIPMIKK-------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P A  K K     P   +G  K+                C L +LP G +GKMLVYKSG 
Sbjct  187  PDADGKDKR----PGGYRGAAKL----------------CRLNDLPPGLIGKMLVYKSGK  226

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLGN LYDVS G+    AQE  AINT  K C  LG I K A V
Sbjct  227  VKLKLGNTLYDVSSGMNCIFAQEFAAINTAQKFCSALGEINKFATV  272



>ref|XP_003590974.1| DNA-directed RNA polymerase III subunit RPC4 [Medicago truncatula]
 gb|AES61225.1| RNA polymerase III RPC4 [Medicago truncatula]
Length=288

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 83/166 (50%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE A +  YDE+    SS + L   ++  E   FF+++P  +P  K        
Sbjct  136  LDEKEFGETAESRTYDESAA--SSAVELDLLEENPEASAFFMKLPPVIPMIKK-------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P A  K K     P   +G  K+                C L +LP G +GKMLVYKSG 
Sbjct  187  PDADGKDKR----PGGYRGAAKL----------------CRLNDLPPGLIGKMLVYKSGK  226

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLGN LYDVS G+    AQE  AINT  K C  LG I K A V
Sbjct  227  VKLKLGNTLYDVSSGMNCIFAQEFAAINTAQKFCSALGEINKFATV  272



>ref|XP_006418592.1| hypothetical protein EUTSA_v10002636mg [Eutrema salsugineum]
 gb|ESQ37028.1| hypothetical protein EUTSA_v10002636mg [Eutrema salsugineum]
Length=274

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  460  KKGCSLEE-LPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCC  284
            +K C L+  LP G+MGK+L+YKSG VK+KLG +LYDVSPG+    AQ+V+ +NT +KNCC
Sbjct  190  EKTCDLKAILPEGFMGKLLIYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMVVNTDEKNCC  249

Query  283  KLGGIYKHAVV  251
             +G +YKHAV+
Sbjct  250  LIGDVYKHAVL  260



>gb|EMS61184.1| DNA-directed RNA polymerase III subunit RPC4 [Triticum urartu]
Length=584

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 74/129 (57%), Gaps = 14/129 (11%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            ++ F Q P +LP          LP   +     ++   S    E VE   T  +RR    
Sbjct  455  QLLFFQFPASLP----------LPQVVSVAGGDMDTSDS----EGVETEETNKKRRLESI  500

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             GC L++LPGG MGK+LVYKSG VK++LG+ L+DVS G+  + AQE VAINT  K+CC L
Sbjct  501  NGCKLKDLPGGLMGKLLVYKSGKVKMRLGDALFDVSAGLDCTFAQEAVAINTNKKHCCSL  560

Query  277  GGIYKHAVV  251
            G + K A++
Sbjct  561  GEVNKRAIL  569



>ref|NP_001150257.1| DNA binding protein [Zea mays]
 ref|XP_008668051.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 ref|XP_008668052.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 gb|ACF85554.1| unknown [Zea mays]
 gb|ACG38404.1| DNA binding protein [Zea mays]
 tpg|DAA38093.1| TPA: DNA binding protein [Zea mays]
Length=300

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 87/166 (52%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   D+     S+   L       E +  F Q+P++LP          L
Sbjct  143  LDEEEFGESSASRTQDDEL---SAAEQLGLMDMSSESQFLFFQLPSSLP----------L  189

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P     G +  EV       EK E+       R S   G  L+E+P GYMGKMLVYKSG 
Sbjct  190  PRQPQSGADPNEV-----RDEKRED------MRPSSHNGSKLKEVPEGYMGKMLVYKSGK  238

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+K+G+ L+DVS G     +QEV AIN  +K+CC +G I K A++
Sbjct  239  VKMKIGDTLFDVSFGSNCMFSQEVAAINIREKHCCTVGEISKRAII  284



>ref|XP_006413334.1| hypothetical protein EUTSA_v10025722mg [Eutrema salsugineum]
 gb|ESQ54787.1| hypothetical protein EUTSA_v10025722mg [Eutrema salsugineum]
Length=323

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 85/165 (52%), Gaps = 29/165 (18%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            D+ EFG+ A++ +YDE+ I+ S+E   L      +++MFF +IP+ LP  K +       
Sbjct  170  DQEEFGDVAKHLDYDESTIN-SAEELGLTSYQHCKKQMFFFKIPDCLPVTKQV-------  221

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
                         T A  K  V          +S K+    E LP G+MGKMLVYKSG V
Sbjct  222  -------------TGANTKRSVS--------ENSSKRNNPFEGLPEGFMGKMLVYKSGAV  260

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG++L+DVSPG       +V AI+   +N C++G   K   V
Sbjct  261  KLKLGDVLFDVSPGPNAKFHSDVAAIDNKGRNYCRIGSSAKLVTV  305



>ref|XP_008242212.1| PREDICTED: uncharacterized protein LOC103340568 [Prunus mume]
 ref|XP_008242213.1| PREDICTED: uncharacterized protein LOC103340568 [Prunus mume]
Length=289

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 73/128 (57%), Gaps = 21/128 (16%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            MFF+Q+P N+P+ K         +A+   +E+ +      G   ++ P            
Sbjct  169  MFFLQLPPNMPTIKR--------SATADSQELTKSSGPPGGACNIQKP------------  208

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
             CSL ELP G+MGKMLVY+SG VK+K+G+ L+DVSPG+    AQ+VV +N  +K C  +G
Sbjct  209  -CSLSELPAGFMGKMLVYRSGAVKMKMGDSLFDVSPGMNCDFAQDVVVVNKAEKGCGIIG  267

Query  274  GIYKHAVV  251
             + K A++
Sbjct  268  ELNKRAII  275



>ref|XP_004970851.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Setaria italica]
Length=285

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (58%), Gaps = 28/130 (22%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            RMF  ++P +LP          LP  S+    ++E    A GKE               K
Sbjct  172  RMFLFKLPKSLP----------LPRRSSN---IVERKGKAAGKEV--------------K  204

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
            +G +L++LP GY+GKMLVYKSG +K+KLG++++DV+PG      Q VVA+NT +K+CC L
Sbjct  205  EGSNLQQLPQGYLGKMLVYKSGKIKMKLGDVMFDVNPGAESRMPQHVVALNTQEKHCCLL  264

Query  277  GGIY-KHAVV  251
            G I  +H +V
Sbjct  265  GEIENRHVIV  274



>ref|XP_004144123.1| PREDICTED: uncharacterized protein LOC101209454 [Cucumis sativus]
 ref|XP_004161125.1| PREDICTED: uncharacterized LOC101209454 [Cucumis sativus]
 gb|KGN66283.1| hypothetical protein Csa_1G595870 [Cucumis sativus]
Length=293

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 23/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            L+E EFGEA+ N  YDE     ++ + L   ++  E  + F+Q+P  +P  K        
Sbjct  137  LNEEEFGEASENLTYDENTT--TAAMNLGLLEENPEADVLFLQLPPMVPMIK--------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                    +   V     G    +N  +  R     +K CS+ ELP G +GK+LVY+SG 
Sbjct  187  --------QSSSVEDMGSGNSSEQNKASQPR-----QKTCSMNELPSGSIGKLLVYRSGA  233

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+I+YDVS G+    AQEV AIN   K CC +G + K A++
Sbjct  234  VKLKLGDIIYDVSSGMDCGFAQEVAAINVEGKRCCIVGELSKRAIL  279



>ref|XP_007154594.1| hypothetical protein PHAVU_003G132000g [Phaseolus vulgaris]
 ref|XP_007154595.1| hypothetical protein PHAVU_003G132000g [Phaseolus vulgaris]
 gb|ESW26588.1| hypothetical protein PHAVU_003G132000g [Phaseolus vulgaris]
 gb|ESW26589.1| hypothetical protein PHAVU_003G132000g [Phaseolus vulgaris]
Length=291

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 76/128 (59%), Gaps = 23/128 (18%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            MF I++P+ LP          + + +  GK+V     +AK K     PP   ++    ++
Sbjct  173  MFLIKLPSKLP----------IISTADGGKDV-----NAKSK-----PPVGTKKG---ER  209

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
             C L++LP G+MGKMLVYKSG +KLKLGN LYDVS G+  S +Q+VVAIN  +K  C +G
Sbjct  210  LCELKDLPSGFMGKMLVYKSGKIKLKLGNTLYDVSSGMNCSFSQDVVAINKAEKTLCSIG  269

Query  274  GIYKHAVV  251
             I KH  +
Sbjct  270  EISKHVTI  277



>emb|CDY21578.1| BnaC09g47140D [Brassica napus]
Length=274

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -1

Query  472  RSSPKKGCSLEELPG-GYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            R   +K C L+     G+MGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+A+NT +
Sbjct  186  RGGAEKACDLKAASANGFMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMAVNTDE  245

Query  295  KNCCKLGGIYKHAVV  251
            KNCC +G +YKHAV+
Sbjct  246  KNCCLVGDVYKHAVL  260



>ref|XP_009122511.1| PREDICTED: uncharacterized protein LOC103847203 [Brassica rapa]
 ref|XP_009122512.1| PREDICTED: uncharacterized protein LOC103847203 [Brassica rapa]
Length=274

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -1

Query  472  RSSPKKGCSLEELPG-GYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            R   +K C L+     G+MGK+LVYKSG VK+KLG +LYDVSPG+    AQ+V+A+NT +
Sbjct  186  RGGAEKACDLKAASANGFMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDVMAVNTDE  245

Query  295  KNCCKLGGIYKHAVV  251
            KNCC +G +YKHAV+
Sbjct  246  KNCCLVGDVYKHAVL  260



>emb|CDX69909.1| BnaA10g22580D [Brassica napus]
Length=274

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = -1

Query  472  RSSPKKGCSLEELPG-GYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            R   +K C L+     G+MGK+LVYKSG +K+KLG +LYDVSPG+    AQ+V+A+NT +
Sbjct  186  RGGAEKACDLKAASANGFMGKLLVYKSGAIKMKLGEVLYDVSPGLKSEFAQDVMAVNTDE  245

Query  295  KNCCKLGGIYKHAVV  251
            KNCC +G +YKHAV+
Sbjct  246  KNCCLVGDVYKHAVL  260



>ref|NP_001045045.1| Os01g0889200 [Oryza sativa Japonica Group]
 dbj|BAF06959.1| Os01g0889200, partial [Oryza sativa Japonica Group]
Length=198

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 86/151 (57%), Gaps = 31/151 (21%)
 Frame = -1

Query  700  ETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTS  521
            E+ IHP+ EL LL++ D   RRM   Q+P +LP          LP  S      +E    
Sbjct  64   ESSIHPAEELNLLEQGDT--RRMLLFQLPKSLP----------LPRISA----AVERNGK  107

Query  520  AKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGV  341
            A+ KE               K+G +L+ELP GY+GKM+VYKSG +K+KLG++++DV+PG 
Sbjct  108  ARDKEV--------------KEGSNLKELPQGYLGKMVVYKSGKIKMKLGDVMFDVNPGE  153

Query  340  GFSSAQEVVAINTVDKNCCKLGGI-YKHAVV  251
                AQ V AINT +K+CC LG I  +H VV
Sbjct  154  ECRMAQHVAAINTKEKHCCLLGEIESRHVVV  184



>ref|XP_006399413.1| hypothetical protein EUTSA_v10014696mg [Eutrema salsugineum]
 gb|ESQ40866.1| hypothetical protein EUTSA_v10014696mg [Eutrema salsugineum]
Length=206

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 7/91 (8%)
 Frame = -1

Query  502  VENPPTVLRRRSSP------KKGCSLE-ELPGGYMGKMLVYKSGGVKLKLGNILYDVSPG  344
            V+   T   R + P      +K C L+  LP G+MGK+L+YKSG VK+KLG +LYDVSPG
Sbjct  102  VKQSATTANRETKPNSKGGVEKTCDLKATLPEGFMGKLLIYKSGAVKMKLGEVLYDVSPG  161

Query  343  VGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +    AQ+V+ +N  +KNCC +G +YKHAV+
Sbjct  162  LKSEFAQDVMVVNVDEKNCCLVGDVYKHAVL  192



>gb|EEE55781.1| hypothetical protein OsJ_04354 [Oryza sativa Japonica Group]
Length=178

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 73/131 (56%), Gaps = 29/131 (22%)
 Frame = -1

Query  640  RRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            RRM   Q+P +LP          LP  S      +E    A+ KE               
Sbjct  62   RRMLLFQLPKSLP----------LPRISA----AVERNGKARDKEV--------------  93

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            K+G +L+ELP GY+GKM+VYKSG +K+KLG++++DV+PG     AQ V AINT +K+CC 
Sbjct  94   KEGSNLKELPQGYLGKMVVYKSGKIKMKLGDVMFDVNPGEECRMAQHVAAINTKEKHCCL  153

Query  280  LGGI-YKHAVV  251
            LG I  +H VV
Sbjct  154  LGEIESRHVVV  164



>ref|XP_010445138.1| PREDICTED: uncharacterized protein LOC104727762 [Camelina sativa]
Length=191

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFG+ A++ EYDE  I+ S+E   L      +++MFF + P+ LP  K    + T 
Sbjct  37   LDQEEFGKLAKHREYDEN-IN-SAEELGLTSVQHCKKQMFFFKFPDRLPVMKQSTGKNT-  93

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                       +   S++      NP                E LP G+MGKMLVYKSG 
Sbjct  94   -----------KRSISSESSSIRSNP---------------FEGLPEGFMGKMLVYKSGN  127

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++L+DVSPG       +V AINT  +NCC++G   K   V
Sbjct  128  VKLKLGDVLFDVSPGPNAKFHNDVAAINTRGRNCCRVGSSAKLVTV  173



>gb|EMS52407.1| DNA-directed RNA polymerase III subunit RPC4 [Triticum urartu]
Length=402

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 68/134 (51%), Gaps = 37/134 (28%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP-  461
            RMF  Q+P +LP  ++                                P TV+ R     
Sbjct  287  RMFLFQLPKSLPLLRT--------------------------------PSTVVHRNGRAI  314

Query  460  ----KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK  293
                K+G +L +LPGGYMGKMLVYKSG VK+KLG+ ++DVSPG      Q  VA+NT  K
Sbjct  315  VKEVKEGYNLNDLPGGYMGKMLVYKSGKVKMKLGDAVFDVSPGTECGMQQHAVAVNTRRK  374

Query  292  NCCKLGGIYKHAVV  251
            +CC+LG I +  VV
Sbjct  375  HCCQLGEIERQHVV  388



>ref|XP_010436390.1| PREDICTED: uncharacterized protein LOC104720126 [Camelina sativa]
Length=267

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 84/166 (51%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A++ EYDE  I+ S+E   L      +++MFF + P+ LP  K    + T 
Sbjct  113  LDQEEFGELAKHREYDEN-IN-SAEELGLTSVQHCKKQMFFFKFPDRLPVMKQSTGKNTK  170

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             + S++   +   P                            E LP G+MGKMLVYKSG 
Sbjct  171  RSISSESSSIRSNP---------------------------FEGLPEGFMGKMLVYKSGN  203

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++L+DVSPG       +V AINT  +NCC +G   K   V
Sbjct  204  VKLKLGDVLFDVSPGPNAKFHNDVAAINTRGRNCCGIGSSAKLVTV  249



>ref|XP_006284135.1| hypothetical protein CARUB_v10005267mg [Capsella rubella]
 gb|EOA17033.1| hypothetical protein CARUB_v10005267mg [Capsella rubella]
Length=319

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 88/166 (53%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A++ E++E  I+ S+E   L   +  + +MFF ++P+ LP           
Sbjct  165  LDQEEFGEVAKHREHNENTIN-SAEELGLTSVEHGKEQMFFFKLPDCLP-----------  212

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
                     +++  T    K  V   P    +RS+P +G     L  G+MGKMLVYKSG 
Sbjct  213  ---------IMKQSTGTNTKRSV---PENSSQRSNPFEG-----LREGFMGKMLVYKSGN  255

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+KLG++L+DV PG       +V AINT  +NCC++G   K   V
Sbjct  256  VKMKLGDVLFDVLPGPNTKFHNDVAAINTKGRNCCRIGSSAKIVTV  301



>gb|EMT05674.1| DNA-directed RNA polymerase III subunit RPC4 [Aegilops tauschii]
Length=391

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 88/170 (52%), Gaps = 39/170 (23%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            ++ E  E+  ++   E+ IHP+ EL LL+  D+   RMF  Q+P +LP  ++        
Sbjct  242  NDVELPESLPSSIECESSIHPAKELNLLEHDDKT--RMFLFQLPKSLPLLRT--------  291

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP-----KKGCSLEELPGGYMGKMLVY  401
                                    P TV+ R         K+G +L +LPGGYMGKMLVY
Sbjct  292  ------------------------PSTVVHRNGRAIVKEVKEGYNLNDLPGGYMGKMLVY  327

Query  400  KSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KSG VK+KLG+ ++DVSPG      Q  VA+NT  K+CC+LG I +  VV
Sbjct  328  KSGKVKMKLGDAVFDVSPGTECGMQQHAVAVNTRRKHCCQLGEIERQHVV  377



>gb|EEC71928.1| hypothetical protein OsI_04731 [Oryza sativa Indica Group]
Length=286

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 86/151 (57%), Gaps = 31/151 (21%)
 Frame = -1

Query  700  ETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTS  521
            E+ IHP+ EL LL++ D   RRM   Q+P +LP          LP  S      +E    
Sbjct  152  ESSIHPAEELNLLEQGDT--RRMLLFQLPKSLP----------LPRISA----AVERNGK  195

Query  520  AKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGV  341
            A+ KE               K+G +L+ELP GY+GKM+VYKSG +K+KLG++++DV+PG 
Sbjct  196  ARDKEV--------------KEGFNLKELPQGYLGKMVVYKSGKIKMKLGDVMFDVNPGE  241

Query  340  GFSSAQEVVAINTVDKNCCKLGGI-YKHAVV  251
                AQ V AINT +K+CC LG I  +H VV
Sbjct  242  ECRMAQHVAAINTKEKHCCLLGEIESRHVVV  272



>ref|XP_010666258.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc4 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=292

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 83/166 (50%), Gaps = 26/166 (16%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD  EFG+    + +DE+ I+P+  + L   +   E RM F+Q+P  LP  K        
Sbjct  138  LDNEEFGQ---QSTFDESMINPA--MELGLMEQTSEPRMLFLQLPKTLPMIKR-------  185

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A+  G+          G   VE             K   L++L  G MGKM+VYKSG 
Sbjct  186  -TAAAAGQASTSSSKPPSGPNLVE-------------KAAGLKDLEAGLMGKMMVYKSGA  231

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG+ LYDV PG     AQ+VVA+N  +KN C +G I K  +V
Sbjct  232  VKLKLGDTLYDVGPGSECVFAQDVVAVNVEEKNFCVVGEINKRVIV  277



>emb|CDM85398.1| unnamed protein product [Triticum aestivum]
Length=291

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 87/170 (51%), Gaps = 39/170 (23%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            ++ E  E+  ++   E+ IHP+ EL LL+  D+   RMF  Q+P +LP  ++        
Sbjct  142  NDVELPESLPSSTECESSIHPAKELNLLEHDDKT--RMFLFQLPKSLPLLRT--------  191

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP-----KKGCSLEELPGGYMGKMLVY  401
                                    P T++ R         K+G +L +LP GYMGKMLVY
Sbjct  192  ------------------------PSTIVHRNGRAIVKEVKEGYNLNDLPEGYMGKMLVY  227

Query  400  KSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KSG VK+KLG+ ++DVSPG      Q  VA+NT  K+CC+LG I +  VV
Sbjct  228  KSGKVKMKLGDAVFDVSPGTECGMQQHAVAVNTRRKHCCQLGEIERQHVV  277



>ref|XP_006847937.1| hypothetical protein AMTR_s00029p00131600 [Amborella trichopoda]
 gb|ERN09518.1| hypothetical protein AMTR_s00029p00131600 [Amborella trichopoda]
Length=305

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 92/169 (54%), Gaps = 29/169 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEY---DETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQ  578
            LDE EFGE+A +      D T    ++   L  +++ +ER++ F Q+P +LP  K     
Sbjct  151  LDEKEFGESAASKSVCNEDST----NAAEELGLKEEREERQLVFFQLPESLPIPKR----  202

Query  577  TTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYK  398
                +A+  GKEV +  +  K   K E P               LE+L  G+MGK+L+Y+
Sbjct  203  ----SATADGKEVQD-DSGQKRTGKSEMP-------------SRLEDLQAGFMGKLLIYE  244

Query  397  SGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            SG VKLK+G+ L++VSPG     AQEV AINT D+  C LG I K A+V
Sbjct  245  SGAVKLKIGDTLFNVSPGSKCEFAQEVAAINTRDRQYCVLGEINKRAIV  293



>gb|ACG39972.1| DNA binding protein [Zea mays]
Length=300

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 86/166 (52%), Gaps = 24/166 (14%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   D+     S+   L       E +  F Q+P++LP  +        
Sbjct  143  LDEEEFGESSASRTQDDEL---SAAEQLGLMDMSSESQFLFFQLPSSLPLPRQ-------  192

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
            P +     EV +        EK E        R S   G  L+E+P GYMGKMLVYKSG 
Sbjct  193  PQSVADPNEVRD--------EKREG------MRPSSHNGSKLKEVPEGYMGKMLVYKSGK  238

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VK+K+G+ L+DVS G     +QEV AIN  +K+CC +G I K A++
Sbjct  239  VKMKIGDTLFDVSFGSNCMFSQEVAAINIREKHCCTVGEISKRAII  284



>ref|XP_008658805.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Zea mays]
Length=129

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 21/129 (16%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            +  F Q+P++LP          LP     G +  EV       EK E+       R S  
Sbjct  6    QFLFFQLPSSLP----------LPRQPQSGADPNEV-----RDEKRED------MRPSSH  44

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
             G  L+E+P GYMGKMLVYKSG VK+K+G+ L+DVS G     +QEV AIN  +K+CC +
Sbjct  45   NGSKLKEVPEGYMGKMLVYKSGKVKMKIGDTLFDVSFGSNCMFSQEVAAINIREKHCCTV  104

Query  277  GGIYKHAVV  251
            G I K A++
Sbjct  105  GEISKRAII  113



>ref|XP_004975436.1| PREDICTED: vesicle transport protein SEC20-like isoform X1 [Setaria 
italica]
 ref|XP_004975437.1| PREDICTED: vesicle transport protein SEC20-like isoform X2 [Setaria 
italica]
 ref|XP_004975438.1| PREDICTED: vesicle transport protein SEC20-like isoform X3 [Setaria 
italica]
 ref|XP_004975439.1| PREDICTED: vesicle transport protein SEC20-like isoform X4 [Setaria 
italica]
 ref|XP_004975440.1| PREDICTED: vesicle transport protein SEC20-like isoform X5 [Setaria 
italica]
Length=295

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 90/168 (54%), Gaps = 28/168 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   D  K+  ++   L      DE ++ FIQ+P++LP          L
Sbjct  138  LDEKEFGESSASRAQD-AKL--TAAEELGLIDRSDESQLLFIQLPSSLP----------L  184

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGC--SLEELPGGYMGKMLVYKS  395
            P           V    KG E+        R+   P   C   L++LPGGYMGK+LVYKS
Sbjct  185  PLQPQ------SVAEPNKGSEE-------RRQGMKPSSHCGSKLKDLPGGYMGKILVYKS  231

Query  394  GGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            G VK+K+G+ L+DVS G      QEV A++T +K+CC +G I K AV+
Sbjct  232  GKVKMKVGDTLFDVSSGSNCKFVQEVAAMDTREKHCCAVGEINKRAVI  279



>ref|XP_010448469.1| PREDICTED: uncharacterized protein LOC104730922 [Camelina sativa]
Length=323

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 87/166 (52%), Gaps = 29/166 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A++ +YDE  I+ S+E   L      +++MFF + P++LP  K    Q+T 
Sbjct  167  LDQEEFGELAKHRDYDEN-IN-SAEELGLTSVQHCKKQMFFFKFPDSLPVVK----QST-  219

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
               +TK         S+       NP                E LP G+MGKMLVYKSG 
Sbjct  220  -RTNTKRS------ISSASSSTRSNP---------------FEGLPEGFMGKMLVYKSGT  257

Query  388  VKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            VKLKLG++L+DVSPG       +V AINT  ++CC++    K   V
Sbjct  258  VKLKLGDVLFDVSPGPNAKFHNDVAAINTKGRHCCRIASSAKLVTV  303



>ref|XP_009361687.1| PREDICTED: uncharacterized protein LOC103951924 [Pyrus x bretschneideri]
 ref|XP_009361688.1| PREDICTED: uncharacterized protein LOC103951924 [Pyrus x bretschneideri]
Length=290

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 88/165 (53%), Gaps = 23/165 (14%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            ++ EFG  +  + YDE    P+++L LL+E       MFF+Q+P  LP+ K         
Sbjct  134  NQEEFGVGSEESTYDENSTKPANDLDLLEENKATS--MFFLQLPQYLPTMKR--------  183

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
            +A+  G E            K   PP     R + +K C+L +LP G+MGKMLVY+SG +
Sbjct  184  SATADGPEAT----------KSSGPPG---SRHNMQKFCALSDLPPGHMGKMLVYRSGAI  230

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG+ L+DVS G+    AQ++V  N  +K    +G + K A+ 
Sbjct  231  KLKLGDTLFDVSSGMKCGFAQDLVVTNENEKGFGIIGELNKRAIA  275



>ref|XP_003562265.1| PREDICTED: uncharacterized protein LOC100824963 [Brachypodium 
distachyon]
Length=335

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 83/169 (49%), Gaps = 17/169 (10%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLP---SCKSIGDQ  578
            L E EFGE + +   D           +  E   ++ ++ F Q P +LP     +S+G  
Sbjct  165  LYEDEFGEFSSSRARDGELTAAKELGLMDTEDMMNKPQLLFFQFPASLPLQTQVESVG--  222

Query  577  TTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYK  398
              +  +     EV +   + K            + R    +GC L++LP G MGK+LVYK
Sbjct  223  ANMDTSEDAEAEVTKSTVNYK------------KTRLQSTQGCKLKDLPDGLMGKVLVYK  270

Query  397  SGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            SG VK++LG  L+DVS G+  +  QE V INT  K CC LG + K AVV
Sbjct  271  SGKVKMRLGGALFDVSAGINCAFPQEAVVINTNKKRCCSLGEVSKRAVV  319



>ref|XP_002447716.1| hypothetical protein SORBIDRAFT_06g014360 [Sorghum bicolor]
 gb|EES12044.1| hypothetical protein SORBIDRAFT_06g014360 [Sorghum bicolor]
Length=299

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 85/171 (50%), Gaps = 34/171 (20%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   D      S+   L       E +  + Q P++LP          L
Sbjct  144  LDEKEFGESSTSRSED---AQLSAAEELGLMDWPAESQFLYFQFPSSLP----------L  190

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVL--RR---RSSPKKGCSLEELPGGYMGKMLV  404
            P                +  + V NP  V   RR   R S   G  L+E+P GYMG++LV
Sbjct  191  P----------------RQPQSVANPNVVSNERREDMRPSSHIGSRLKEIPEGYMGRILV  234

Query  403  YKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            Y+SG VK+K+G+ L+DVS G      QEV AINT +K+CC +G I K AV+
Sbjct  235  YRSGKVKMKIGDALFDVSSGSNCMFVQEVAAINTREKHCCTVGEISKRAVI  285



>ref|XP_010232672.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Brachypodium distachyon]
Length=288

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            K+G +L +LPGGYMGKMLVYKSG +K+KLG+ ++DV+ G     +Q  VAINT +K+CC 
Sbjct  205  KEGHNLNDLPGGYMGKMLVYKSGKIKMKLGDTMFDVNSGTECGMSQHAVAINTREKHCCP  264

Query  280  LGGI-YKHAVV  251
            LG I  +H VV
Sbjct  265  LGEIENRHVVV  275



>ref|XP_003564813.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Brachypodium distachyon]
 ref|XP_010232673.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Brachypodium distachyon]
 ref|XP_010232674.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Brachypodium distachyon]
Length=287

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            K+G +L +LPGGYMGKMLVYKSG +K+KLG+ ++DV+ G     +Q  VAINT +K+CC 
Sbjct  204  KEGHNLNDLPGGYMGKMLVYKSGKIKMKLGDTMFDVNSGTECGMSQHAVAINTREKHCCP  263

Query  280  LGGI-YKHAVV  251
            LG I  +H VV
Sbjct  264  LGEIENRHVVV  274



>ref|XP_008344033.1| PREDICTED: uncharacterized protein LOC103406825 [Malus domestica]
Length=290

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 85/165 (52%), Gaps = 23/165 (14%)
 Frame = -1

Query  745  DEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLP  566
            ++ EFG+ +  + YDE    P+++L LL+E       MFF+Q+P  LP  K         
Sbjct  134  NQEEFGDGSEESTYDENSTKPANDLDLLEENKATS--MFFLQLPQYLPXMKR--------  183

Query  565  AASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGV  386
            + +  G E            K   PP         +K C+L +LP G+MGKMLVY+SG +
Sbjct  184  SXTADGPEAT----------KSSRPPGSAHNM---QKFCALSDLPPGHMGKMLVYRSGAI  230

Query  385  KLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            KLKLG+ L+DVS G+    AQ++V  N  +K    +G + K A+ 
Sbjct  231  KLKLGDTLFDVSSGMKCGFAQDLVVTNENEKGFGIIGELNKRAIA  275



>ref|XP_010240792.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Brachypodium distachyon]
Length=309

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 20/167 (12%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +   D      ++   L      D   +     P +LP  K        
Sbjct  146  LDEEEFGESSASRAQDGEL---TAAEELGLMDRSDTPPLLLFLFPKSLPLLKQ-------  195

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK-KGCSLEELPGGYMGKMLVYKSG  392
                    + +E P +  G +    P + + + +  K  G  + +LPGG MGK+LVYKSG
Sbjct  196  -------AQSVEEPNT--GNKDNTGPASTISKLAHEKITGSKINDLPGGLMGKILVYKSG  246

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
             VK+K+G+ L+DVSPGV     Q+V AIN  + +CC LG I K+AVV
Sbjct  247  KVKMKIGDALFDVSPGVNCKFVQDVAAINIRENHCCTLGEISKNAVV  293



>emb|CAA23059.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79427.1| hypothetical protein [Arabidopsis thaliana]
Length=277

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 90/191 (47%), Gaps = 54/191 (28%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD+ EFGE A+N +YDE  I+ S+E   L      +++MF  +IP+ LP  K    QTT 
Sbjct  98   LDQEEFGEVAKNRDYDENTIN-SAEELGLTSVQHSKKQMFIFKIPDCLPVVK----QTT-  151

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A+TK + V E  +       + NP                E LP G+MGKMLVYKSG 
Sbjct  152  -GATTK-RSVREYSSG------ISNP---------------FEGLPEGFMGKMLVYKSGA  188

Query  388  VKLKLGNILYD-------------------------VSPGVGFSSAQEVVAINTVDKNCC  284
            VKLK+G+ L+D                         VSPG G     +VVAI+   +NC 
Sbjct  189  VKLKVGDALFDVSHFRLIIIICEPTYLKLCWNSPPLVSPGPGTKIPNDVVAIDIKGRNCS  248

Query  283  KLGGIYKHAVV  251
            ++G   K   V
Sbjct  249  RIGSSAKFVTV  259



>emb|CDP04591.1| unnamed protein product [Coffea canephora]
Length=99

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            +  CSL+ELP G+MGK+L Y+SG VKLKL + L DVS G+  + AQ+VVA+N  +++CC 
Sbjct  16   QNACSLDELPAGFMGKILFYRSGAVKLKLDDNLCDVSVGLDCAFAQDVVAVNIEERHCCT  75

Query  280  LGGIYKHAVV  251
            LG + K  ++
Sbjct  76   LGELNKRVLI  85



>ref|XP_010693720.1| PREDICTED: uncharacterized protein LOC104906636 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=300

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            ++G SL++LP G+MGKM VYKSG VKLKLG   +DVSPG   S A+EVVA+N   K    
Sbjct  217  QQGYSLKDLPPGHMGKMCVYKSGAVKLKLGETQFDVSPGTTISDAEEVVAVNAEKKEFLS  276

Query  280  LGGIYKHAVV  251
            LG + K  ++
Sbjct  277  LGDLDKRMII  286



>ref|XP_010693719.1| PREDICTED: uncharacterized protein LOC104906636 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=308

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
            ++G SL++LP G+MGKM VYKSG VKLKLG   +DVSPG   S A+EVVA+N   K    
Sbjct  225  QQGYSLKDLPPGHMGKMCVYKSGAVKLKLGETQFDVSPGTTISDAEEVVAVNAEKKEFLS  284

Query  280  LGGIYKHAVV  251
            LG + K  ++
Sbjct  285  LGDLDKRMII  294



>ref|XP_011045979.1| PREDICTED: uncharacterized protein LOC105140725 isoform X3 [Populus 
euphratica]
Length=247

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 68/131 (52%), Gaps = 23/131 (18%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE +  A YDE   +  S + L   ++  E  M F+Q+P  +P  K        
Sbjct  135  LDEEEFGEVSEAATYDENSTN--SAVELGLMEENVEASMLFVQLPPAMPMIKR-------  185

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+  G EV E    + G   +E             K C L+ELP GYMGK+LVY+SG 
Sbjct  186  -SATAVGPEVKESSRPSGGARAIE-------------KTCRLDELPAGYMGKVLVYRSGA  231

Query  388  VKLKLGNILYD  356
            VKLKLG+ LYD
Sbjct  232  VKLKLGDTLYD  242



>gb|KHN34141.1| hypothetical protein glysoja_038630 [Glycine soja]
Length=368

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 69/153 (45%), Gaps = 44/153 (29%)
 Frame = -1

Query  709  EYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEV  530
            EYDE  ++  S   L   +  +++RMFF +IP  LP                        
Sbjct  249  EYDENSVN--SAAELRILEKSEDQRMFFFKIPAYLP------------------------  282

Query  529  PTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVS  350
                 G   V   PT L+            +LP GYMGKMLVYKSG + LKLG  L+DV 
Sbjct  283  -----GTSTVSGEPTHLK------------DLPRGYMGKMLVYKSGAINLKLGESLFDVY  325

Query  349  PGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            PG      ++VVA+NT  K CC LG I K   V
Sbjct  326  PGSNRGHVEDVVAVNT-QKQCCNLGKISKRVNV  357



>ref|XP_006573848.1| PREDICTED: uncharacterized protein LOC100804615 [Glycine max]
Length=385

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 69/153 (45%), Gaps = 44/153 (29%)
 Frame = -1

Query  709  EYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEV  530
            EYDE  ++  S   L   +  +++RMFF +IP  LP                        
Sbjct  266  EYDENSVN--SAAELRILEKSEDQRMFFFKIPAYLP------------------------  299

Query  529  PTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVS  350
                 G   V   PT L+            +LP GYMGKMLVYKSG + LKLG  L+DV 
Sbjct  300  -----GTSTVSGEPTHLK------------DLPRGYMGKMLVYKSGAINLKLGESLFDVY  342

Query  349  PGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            PG      ++VVA+NT  K CC LG I K   V
Sbjct  343  PGSNRGHVEDVVAVNT-QKQCCNLGKISKRVNV  374



>ref|XP_010448468.1| PREDICTED: uncharacterized protein LOC104730921 [Camelina sativa]
Length=121

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  445  LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIY  266
             E LP G+MGKMLVYKSG VKLKLG++L+DVSPG       +V AINT  ++CC++    
Sbjct  37   FEGLPEGFMGKMLVYKSGTVKLKLGDVLFDVSPGPNAKFHNDVAAINTKGRHCCRIASSA  96

Query  265  KHAVV  251
            K   V
Sbjct  97   KLVTV  101



>ref|XP_010109752.1| hypothetical protein L484_000449 [Morus notabilis]
 gb|EXC57359.1| hypothetical protein L484_000449 [Morus notabilis]
Length=69

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  412  MLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            MLVYKSG VKL+LG+ILYDVS G     A++VV INT +K CC LG + K AVV
Sbjct  1    MLVYKSGAVKLRLGDILYDVSAGSNCIFAEDVVTINTAEKQCCVLGALRKRAVV  54



>ref|XP_002453894.1| hypothetical protein SORBIDRAFT_04g021023 [Sorghum bicolor]
 gb|EES06870.1| hypothetical protein SORBIDRAFT_04g021023 [Sorghum bicolor]
Length=122

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 13/123 (11%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
             + F Q P +LP  +      T PAA T+   ++     + G  +        +R     
Sbjct  8    HLLFFQFPTSLPLPRE-----TDPAAETETNTIVNGNVKSMGNYR--------KRMLDSG  54

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKL  278
              C+L+EL GG MGK+L+YKSG VK+KLG++L+DV+ G      QEVV I+T       L
Sbjct  55   NACNLKELSGGLMGKILIYKSGKVKMKLGDVLFDVAAGSNCMFVQEVVPIDTRILFAVAL  114

Query  277  GGI  269
            G +
Sbjct  115  GSL  117



>gb|EMS47221.1| hypothetical protein TRIUR3_08966 [Triticum urartu]
Length=291

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 84/159 (53%), Gaps = 31/159 (19%)
 Frame = -1

Query  748  LDEAEFGE-AARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT  572
            LDE EFGE +A  A+  E     ++   L      D  ++ F Q+P +LP  K +    +
Sbjct  124  LDEEEFGEKSASRAQDGEL----TAAEELGLMDWSDTPQLLFFQLPASLPLPKQM---ES  176

Query  571  LPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
            +   +T  +E +E  TS+K          V R R+ P  G  +++LPGG MGK+LVYKSG
Sbjct  177  VEEPNTGSEENVEPATSSK----------VARGRTLP--GSKIKDLPGGLMGKILVYKSG  224

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
             VK+K+G+ L+D           E VA+NT + +CC LG
Sbjct  225  KVKMKIGDALFD-----------EAVAVNTRENHCCTLG  252



>gb|KJB83019.1| hypothetical protein B456_013G225500 [Gossypium raimondii]
Length=293

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 69/133 (52%), Gaps = 30/133 (23%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EF  AA+N  YDE  I P+  LGL++E  E    M F+Q+P  LP  K+  +    
Sbjct  140  LDEEEF--AAQNVAYDENSIEPAVGLGLMEENLEPM--MLFLQLPPTLPIIKAGHE----  191

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              AS+ G                       R   S KK C L ELP G MGKMLVYKSG 
Sbjct  192  -GASSTGSS---------------------RTVRSAKKTCGLTELPAGLMGKMLVYKSGA  229

Query  388  VKLKLGNILYDVS  350
            VKLKLG+ +YDVS
Sbjct  230  VKLKLGDTIYDVS  242



>gb|EMT19814.1| hypothetical protein F775_27467 [Aegilops tauschii]
Length=255

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 31/159 (19%)
 Frame = -1

Query  748  LDEAEFGE-AARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTT  572
            LDE EFGE +A  A+  E     ++   L      D  ++ F Q+P +LP  K +    +
Sbjct  124  LDEEEFGENSASRAQDGEL----TAAEELGLMDWSDTPQLLFFQLPASLPLPKQM---ES  176

Query  571  LPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSG  392
            +   +T  +E +E  TS+K          V R ++ P  G  +++LPGG MGK+LVYKSG
Sbjct  177  VEEPNTGSEENVEPATSSK----------VARGQTLP--GSKIKDLPGGLMGKILVYKSG  224

Query  391  GVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
             VK+K+G+ L+D           E VA+NT + +CC LG
Sbjct  225  KVKMKIGDALFD-----------EAVAVNTRENHCCTLG  252



>ref|XP_010536548.1| PREDICTED: uncharacterized protein LOC104811532 [Tarenaya hassleriana]
Length=317

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 78/160 (49%), Gaps = 32/160 (20%)
 Frame = -1

Query  730  GEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTK  551
            G  AR    DE+ ++ + +LGL  E++  +R+M F Q+P  LP  K + D  +       
Sbjct  170  GVVARYPVTDESTLNSAEKLGLTLEEENGKRKMIFFQLPGPLPVKKELADANS-------  222

Query  550  GKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLG  371
                           + +N     +RRS+       + L  G+MGKM VYKSG VKLKLG
Sbjct  223  ---------------EEDN----TQRRSA------FDGLKEGFMGKMCVYKSGAVKLKLG  257

Query  370  NILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            +ILYDVSPG     A  V AINT  +    LG   K A V
Sbjct  258  DILYDVSPGPDTFFADTVAAINTRKREFGNLGSTEKMATV  297



>ref|XP_004571513.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Maylandia zebra]
 ref|XP_005950303.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Haplochromis burtoni]
Length=386

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 79/135 (59%), Gaps = 17/135 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL---PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSS  464
            +FF+Q+P+ +P  ++ G +  L   PAA        E P + +GK +V+  P  L+ +S+
Sbjct  243  LFFMQLPDCMPG-RASGAKVDLAPGPAA--------ETPATKEGKHEVKRTPH-LQAKSA  292

Query  463  PKKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---  296
             K+GC  L + P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++   D   
Sbjct  293  VKEGCPVLSQFPEGFLGKLQIRKSGKVELKLGDIIMDVSEGAAFSFLQQLVSVRLCDGRT  352

Query  295  KNCCKLGGIYKHAVV  251
             +   LG ++   V+
Sbjct  353  GDMMVLGNVHHKLVL  367



>ref|XP_005752741.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Pundamilia nyererei]
Length=384

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 79/135 (59%), Gaps = 17/135 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL---PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSS  464
            +FF+Q+P+ +P  ++ G +  L   PAA        E P + +GK +V+  P  L+ +S+
Sbjct  241  LFFMQLPDCMPG-RASGAKVDLAPGPAA--------ETPATKEGKHEVKRTPH-LQAKSA  290

Query  463  PKKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---  296
             K+GC  L + P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++   D   
Sbjct  291  VKEGCPVLSQFPEGFLGKLQIRKSGKVELKLGDIIMDVSEGAAFSFLQQLVSVRLCDGRT  350

Query  295  KNCCKLGGIYKHAVV  251
             +   LG ++   V+
Sbjct  351  GDMMVLGNVHHKLVL  365



>ref|XP_005950302.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Haplochromis burtoni]
Length=391

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 79/135 (59%), Gaps = 17/135 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL---PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSS  464
            +FF+Q+P+ +P  ++ G +  L   PAA        E P + +GK +V+  P  L+ +S+
Sbjct  248  LFFMQLPDCMPG-RASGAKVDLAPGPAA--------ETPATKEGKHEVKRTPH-LQAKSA  297

Query  463  PKKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---  296
             K+GC  L + P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++   D   
Sbjct  298  VKEGCPVLSQFPEGFLGKLQIRKSGKVELKLGDIIMDVSEGAAFSFLQQLVSVRLCDGRT  357

Query  295  KNCCKLGGIYKHAVV  251
             +   LG ++   V+
Sbjct  358  GDMMVLGNVHHKLVL  372



>gb|ETP20965.1| hypothetical protein F441_05409 [Phytophthora parasitica CJ01A1]
Length=348

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 8/131 (6%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FFIQ+P  LP   +I   T  P+AST   E +E  ++ + KE  +          SP  
Sbjct  214  LFFIQMPTTLPLSSAI---TKTPSASTDEDEPME--SADESKEDAKKVKESKNPEESPDD  268

Query  454  GC---SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCC  284
            G    S+E  PGG++GK+ V+KSG + L LG+  ++V+     S  +E+ A+NT +K+  
Sbjct  269  GVFDHSVETAPGGFIGKICVHKSGKMVLMLGDKQFEVAAAQTPSFCEEIYAVNTSEKHLS  328

Query  283  KLGGIYKHAVV  251
             LG + +H VV
Sbjct  329  ILGNVERHLVV  339



>ref|XP_008902834.1| hypothetical protein PPTG_09575 [Phytophthora parasitica INRA-310]
 gb|ETI51202.1| hypothetical protein F443_05402 [Phytophthora parasitica P1569]
 gb|ETK91119.1| hypothetical protein L915_05259 [Phytophthora parasitica]
 gb|ETL44492.1| hypothetical protein L916_05214 [Phytophthora parasitica]
 gb|ETL97657.1| hypothetical protein L917_05099 [Phytophthora parasitica]
 gb|ETM50814.1| hypothetical protein L914_05215 [Phytophthora parasitica]
 gb|ETN11909.1| hypothetical protein PPTG_09575 [Phytophthora parasitica INRA-310]
 gb|ETO79944.1| hypothetical protein F444_05447 [Phytophthora parasitica P1976]
 gb|ETP48919.1| hypothetical protein F442_05452 [Phytophthora parasitica P10297]
Length=348

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 8/131 (6%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FFIQ+P  LP   +I   T  P+AST   E +E  ++ + KE  +          SP  
Sbjct  214  LFFIQMPTTLPLSSAI---TKTPSASTDEDEPME--SADESKEDAKKVKESKNPEESPDD  268

Query  454  GC---SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCC  284
            G    S+E  PGG++GK+ V+KSG + L LG+  ++V+     S  +E+ A+NT +K+  
Sbjct  269  GVFDHSVETAPGGFIGKICVHKSGKMVLMLGDKQFEVAAAQTPSFCEEIYAVNTSEKHLS  328

Query  283  KLGGIYKHAVV  251
             LG + +H VV
Sbjct  329  ILGNVERHLVV  339



>ref|XP_003454122.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Oreochromis niloticus]
Length=389

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 78/135 (58%), Gaps = 17/135 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL---PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSS  464
            +FF+Q+P+ +P  ++ G +  L   PAA        E P + +GK + +  P  L+ +S+
Sbjct  246  LFFMQLPDCMPG-RASGAKVDLAPGPAA--------ESPATKEGKPEAKRTPH-LQAKSA  295

Query  463  PKKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---  296
             K+GC  L + P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++   D   
Sbjct  296  VKEGCPVLSQFPEGFLGKLQIRKSGKVELKLGDIIMDVSEGAAFSFLQQLVSVRLCDGRT  355

Query  295  KNCCKLGGIYKHAVV  251
             +   LG ++   V+
Sbjct  356  GDMMVLGNVHHKLVL  370



>ref|XP_002683346.1| DNA-directed RNA polymerase III RPC4, polypeptide D [Naegleria 
gruberi]
 gb|EFC50602.1| DNA-directed RNA polymerase III RPC4, polypeptide D [Naegleria 
gruberi]
Length=396

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 25/132 (19%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIE---VPTSAKGKEKVENPPTVLRRRS  467
            ++FFIQ+P+ +P          + AA  K ++  E   V TS    E +   P       
Sbjct  266  KLFFIQLPSKIP---------YMDAAERKRQQAQEKKVVSTSVDDAENIWTQPF------  310

Query  466  SPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--  293
                  +L+++P G +G+M+VYKSG VKLKLG++L DV PG  FS  + V  ++  DK  
Sbjct  311  ----ENTLDKVPNGLIGEMVVYKSGKVKLKLGDVLLDVFPGSEFSFPEHVACVDATDKEK  366

Query  292  -NCCKLGGIYKH  260
              C  LG I K 
Sbjct  367  GQCHILGNIAKR  378



>gb|EPS57301.1| hypothetical protein M569_17518 [Genlisea aurea]
Length=197

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  406  VYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            V++SG VKLK+G+ILYDVSPGV F  AQ V A+N+ DK C  LG +   AVV
Sbjct  132  VHRSGAVKLKIGDILYDVSPGVKFGFAQNVFAVNSEDKKCTNLGELNARAVV  183



>ref|XP_005752742.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Pundamilia nyererei]
Length=344

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 66/108 (61%), Gaps = 14/108 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL---PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSS  464
            +FF+Q+P+ +P  ++ G +  L   PAA        E P + +GK +V+  P  L+ +S+
Sbjct  241  LFFMQLPDCMPG-RASGAKVDLAPGPAA--------ETPATKEGKHEVKRTPH-LQAKSA  290

Query  463  PKKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQ  323
             K+GC  L + P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q
Sbjct  291  VKEGCPVLSQFPEGFLGKLQIRKSGKVELKLGDIIMDVSEGAAFSFLQ  338



>ref|XP_001702362.1| hypothetical protein CHLREDRAFT_154065 [Chlamydomonas reinhardtii]
 gb|EDO96982.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=166

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -1

Query  472  RSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK  293
            + +P  GC   E+  G +GK+LV+KSG VK+ +G++L DVS G+     Q+VVA+N    
Sbjct  23   KEAPGAGCDFREMASGRIGKLLVFKSGKVKMLVGDVLMDVSMGLPNQHRQDVVAVNPTSA  82

Query  292  NCCKLGGIYKHAVV  251
             C  LG +++  +V
Sbjct  83   ACVLLGNVHERVLV  96



>ref|XP_001757951.1| predicted protein [Physcomitrella patens]
 gb|EDQ77193.1| predicted protein [Physcomitrella patens]
Length=462

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = -1

Query  445  LEEL-PGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGI  269
            LE+L   G MGK+L+Y+SG VK K+G++++D  PG   + AQE+ A+N   K+C  LG +
Sbjct  379  LEDLGKAGAMGKLLIYESGAVKFKVGDVIFDALPGTEVTFAQELAAVNITTKHCGFLGEV  438

Query  268  YKHAVV  251
            YK  V+
Sbjct  439  YKRVVL  444



>ref|XP_010752704.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Larimichthys crocea]
Length=396

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+ +P  ++ G +      ST  K       + +GK + + P  +  + ++ K 
Sbjct  252  LFFMQLPDCMPG-RTSGQKVDATLRSTADKLA-----NKEGKPEDKRPAHLQAQEAAMKD  305

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---KNC  287
            GC  L + P G++GK+ + KSG V+LKLG+++ DVS G  FS  Q++V++   D    + 
Sbjct  306  GCPVLSQFPEGFLGKLQIRKSGKVELKLGDVVMDVSEGAAFSFLQQLVSVRLSDGRTGDM  365

Query  286  CKLGGIYKHAVV  251
              LG ++   V+
Sbjct  366  MVLGNVHHKLVL  377



>gb|KDO27173.1| hypothetical protein SPRG_07421 [Saprolegnia parasitica CBS 223.65]
Length=216

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 26/128 (20%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FFIQ+P  LP+ K   D    PA              A+G E  +N             
Sbjct  106  LFFIQLPTTLPATKDDDDAPVKPANK-----------DAEGLELFDN-------------  141

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
              +L  +P GY+GK+ ++KSG   L LG+  +D++P    +  +E+V+++T D+    LG
Sbjct  142  --ALNTMPSGYLGKIQIHKSGKAVLVLGDKTFDIAPAQPPTFYEELVSMDTKDRLLSHLG  199

Query  274  GIYKHAVV  251
             +  H VV
Sbjct  200  PVANHLVV  207



>ref|XP_002897888.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY64688.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=351

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (52%), Gaps = 16/135 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKE----VIEVPTSAKGKEKVENPPTVLRRRS  467
            +FFIQ+P  LP   ++   T  P+A+T   E    V E    AK  +  +NP  +     
Sbjct  217  LFFIQMPTTLPLSSAV---TKAPSATTDVDEPMESVDESKEDAKQAKGSKNPEELA----  269

Query  466  SPKKGC---SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
                G    S+E  PGG++GK+ V+KSG + L LG+  ++V+     S  +E+ AINT +
Sbjct  270  --DDGVFDHSVETAPGGFIGKICVHKSGKMVLMLGDKQFEVAAAQTPSFCEEIYAINTTE  327

Query  295  KNCCKLGGIYKHAVV  251
            K    LG + +H VV
Sbjct  328  KLLSILGNVERHLVV  342



>ref|XP_010775691.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Notothenia coriiceps]
 ref|XP_010775692.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Notothenia coriiceps]
Length=394

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 60/114 (53%), Gaps = 8/114 (7%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+++P                      E P   +GK   + P  +  ++   K+
Sbjct  251  LFFMQLPDSMPG-------RAAQKVDPPPAPAAEKPDKKEGKLADKRPAQLQAQQVPLKE  303

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            GC  L +LP G++GK+ + KSG V+LK+G ++ DVS G  FS  Q++V++   D
Sbjct  304  GCPVLSQLPEGFLGKLQIRKSGKVELKMGQVVMDVSEGAAFSFLQQLVSVRLSD  357



>ref|XP_010775694.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X3 [Notothenia coriiceps]
Length=391

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 60/114 (53%), Gaps = 8/114 (7%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+++P                      E P   +GK   + P  +  ++   K+
Sbjct  248  LFFMQLPDSMPG-------RAAQKVDPPPAPAAEKPDKKEGKLADKRPAQLQAQQVPLKE  300

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            GC  L +LP G++GK+ + KSG V+LK+G ++ DVS G  FS  Q++V++   D
Sbjct  301  GCPVLSQLPEGFLGKLQIRKSGKVELKMGQVVMDVSEGAAFSFLQQLVSVRLSD  354



>ref|XP_008417285.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Poecilia 
reticulata]
 ref|XP_008417286.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Poecilia 
reticulata]
Length=387

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +  T+     S  G+ V+ + T ++ +E  +N           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKTVKTEVQSEDGQSVL-LKTESQEEEAEDN-----------  305

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V++ T DK  N 
Sbjct  306  --NCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSVQTGDKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + +H +V
Sbjct  364  TVLGNV-RHKMV  374



>ref|XP_010666259.1| PREDICTED: uncharacterized protein LOC104883429 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=265

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 66/132 (50%), Gaps = 26/132 (20%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LD  EFG+    + +DE+ I+P+ ELGL+++  E   RM F+Q+P  LP  K        
Sbjct  138  LDNEEFGQ---QSTFDESMINPAMELGLMEQTSEP--RMLFLQLPKTLPMIKRT------  186

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
              A+  G+          G   VE             K   L++L  G MGKM+VYKSG 
Sbjct  187  --AAAAGQASTSSSKPPSGPNLVE-------------KAAGLKDLEAGLMGKMMVYKSGA  231

Query  388  VKLKLGNILYDV  353
            VKLKLG+ LYD 
Sbjct  232  VKLKLGDTLYDA  243



>ref|XP_005804423.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Xiphophorus maculatus]
Length=387

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 18/131 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL--PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +  T+     S  G+ V+ + T  + +E  +N           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKTVKTEVQSEDGQSVL-LKTEPQDEEAEDN-----------  305

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V++ T +K  N 
Sbjct  306  --SCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSVQTAEKTGNL  363

Query  286  CKLGGIYKHAV  254
              LG +    V
Sbjct  364  TVLGNVRNKMV  374



>ref|XP_010775693.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Notothenia coriiceps]
Length=393

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+++P                      E P   +GK   +  P  L+ +   K+
Sbjct  251  LFFMQLPDSMPG-------RAAQKVDPPPAPAAEKPDKKEGK-LADKRPAQLQAQVPLKE  302

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD  296
            GC  L +LP G++GK+ + KSG V+LK+G ++ DVS G  FS  Q++V++   D
Sbjct  303  GCPVLSQLPEGFLGKLQIRKSGKVELKMGQVVMDVSEGAAFSFLQQLVSVRLSD  356



>ref|XP_007563924.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Poecilia 
formosa]
 ref|XP_007563933.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Poecilia 
formosa]
 ref|XP_007563939.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Poecilia 
formosa]
Length=387

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +  T+     S  G+ V+ + T ++ +E  +N           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKTVKTEVQSEDGQSVL-LKTESQEEEAEDN-----------  305

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V++ T +K  N 
Sbjct  306  --SCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSVQTGEKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + +H +V
Sbjct  364  TVLGNV-RHKMV  374



>ref|XP_002008597.1| GI11729 [Drosophila mojavensis]
 gb|EDW19073.1| GI11729 [Drosophila mojavensis]
Length=419

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 7/112 (6%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            ++F +Q+PN LP     G+    PAA T      E PT++    +  N P     R    
Sbjct  258  QLFIMQLPNVLPCVADEGEDAA-PAAGT------EQPTASAAASEQPNSPLPTSGREGTP  310

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINT  302
            K   L +L  G +GK+L Y+SG VKL+LG+  +D+  G+     QEV++IN+
Sbjct  311  KHSMLTQLEEGQIGKILRYRSGRVKLQLGDTHFDLDLGLDSGFLQEVMSINS  362



>ref|XP_562238.4| AGAP004480-PA [Anopheles gambiae str. PEST]
 gb|EAL40548.4| AGAP004480-PA [Anopheles gambiae str. PEST]
Length=357

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 20/112 (18%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPK  458
            ++F +Q+P+ LP     G++       +K +       +A G+E             +PK
Sbjct  233  KIFLLQLPDALPGKSDDGNKRPTNGDDSKPE------ATANGEE-------------TPK  273

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINT  302
              C++ +L  GY+GK++ Y+SG VKLKLG I++D+S G+     QE+V+INT
Sbjct  274  Y-CTVRDLAEGYIGKIIRYRSGKVKLKLGEIMFDISVGMDTGFLQELVSINT  324



>ref|XP_008312618.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Cynoglossus semilaevis]
Length=391

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 71/132 (54%), Gaps = 12/132 (9%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+ +P   S   +  LP  S   K       +AK + K E+   +   +   K 
Sbjct  249  LFFMQLPDCVPGQLS-EQKDALPLRSPTEK-------AAKKEGKAEDRRHLQSLQLRMKS  300

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---KNC  287
            GC  L ++P G++GK+ + KSG V+LK+G+I+ DVS G  FS  QE+V++   +    + 
Sbjct  301  GCPVLSQMPEGFLGKLQIRKSGKVELKMGDIVMDVSEGAAFSFLQELVSVRHSEGKSGDM  360

Query  286  CKLGGIYKHAVV  251
              LG ++   V+
Sbjct  361  MVLGNVHHKLVL  372



>ref|XP_004544332.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Maylandia zebra]
Length=387

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  304

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+INT  K  N 
Sbjct  305  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSINTEGKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  364  TVLGNV-KHKMV  374



>ref|XP_006805995.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Neolamprologus brichardi]
Length=387

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  304

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+INT  K  N 
Sbjct  305  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSINTEGKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  364  TVLGNV-KHKMV  374



>ref|XP_005922768.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Haplochromis burtoni]
Length=387

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  304

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+INT  K  N 
Sbjct  305  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSINTEGKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  364  TVLGNV-KHKMV  374



>ref|XP_005729484.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Pundamilia nyererei]
Length=387

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  258  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  304

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+INT  K  N 
Sbjct  305  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSINTEGKTGNL  363

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  364  TVLGNV-KHKMV  374



>ref|XP_006805994.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Neolamprologus brichardi]
Length=425

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  296  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  342

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+INT  K  N 
Sbjct  343  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSINTEGKTGNL  401

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  402  TVLGNV-KHKMV  412



>ref|XP_002947935.1| hypothetical protein VOLCADRAFT_103709 [Volvox carteri f. nagariensis]
 gb|EFJ50923.1| hypothetical protein VOLCADRAFT_103709 [Volvox carteri f. nagariensis]
Length=2192

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -1

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
            GC++ ELP G +GK+LV++SG V++++G++L DVS G+     Q+VVA+N     C  LG
Sbjct  281  GCNMRELPSGRIGKLLVFRSGKVQMQVGDVLLDVSIGLPNQHRQDVVALNPSSNACVLLG  340

Query  274  GIYKHAVV  251
             + +  +V
Sbjct  341  DVTQRVLV  348



>ref|XP_003445628.2| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Oreochromis niloticus]
Length=425

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +EK E+           
Sbjct  296  LFFIQLPDSLPGQPPTKEHKPVKTEVQSEDGQSVL-LKTESE-EEKAED-----------  342

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V++NT  K  N 
Sbjct  343  -NSCNLKDLREGVVGKMLVRKSGRVQLILGQVTLDVSLGTSCSFLQELVSVNTEGKTGNL  401

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  402  TVLGNV-KHKMV  412



>ref|XP_008436399.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Poecilia reticulata]
Length=387

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 22/134 (16%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGK---EKVENPPTVLRRRSS  464
            +FF+Q P+ LP   S       P A        E P+    K   +K EN    L     
Sbjct  254  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDAKSAQQKSENMDGSL-----  302

Query  463  PKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DK  293
                  L E P G++GK+ + KSG V+LKLG+++ DVS G  FS  Q++V++        
Sbjct  303  -----VLSEFPEGFLGKLQIRKSGKVELKLGDVILDVSEGAAFSFLQQLVSVRLSGGRTG  357

Query  292  NCCKLGGIYKHAVV  251
            N   LG I+   V+
Sbjct  358  NITVLGNIHHKLVL  371



>ref|XP_008303756.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Stegastes partitus]
Length=398

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 76/134 (57%), Gaps = 14/134 (10%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPT--VLRRRSSP  461
            +FF+Q+P+ +P  ++ G    L    T+G  V +   SAK + K+E+  T  +  + +  
Sbjct  254  LFFMQLPDCMPD-RACG----LKVDPTQGSTVEK---SAKKEGKLEDKRTAYLQAQEAVV  305

Query  460  KKGCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---K  293
            K+GC  L + P G +GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++   +    
Sbjct  306  KEGCPVLSQFPEGLLGKLQIRKSGKVELKLGDIVMDVSEGAAFSFLQQLVSVRLSEGRTG  365

Query  292  NCCKLGGIYKHAVV  251
            +   LG ++   V+
Sbjct  366  DMMVLGNVHHKLVL  379



>ref|XP_008436400.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X3 [Poecilia reticulata]
Length=387

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 22/134 (16%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGK---EKVENPPTVLRRRSS  464
            +FF+Q P+ LP   S       P A        E P+    K   +K EN    L     
Sbjct  254  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDAKSAQQKSENMDGSL-----  302

Query  463  PKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DK  293
                  L E P G++GK+ + KSG V+LKLG+++ DVS G  FS  Q++V++        
Sbjct  303  -----VLSEFPEGFLGKLQIRKSGKVELKLGDVILDVSEGAAFSFLQQLVSVRLSGGRTG  357

Query  292  NCCKLGGIYKHAVV  251
            N   LG I+   V+
Sbjct  358  NITVLGNIHHKLVL  371



>ref|XP_009829404.1| hypothetical protein H257_06034 [Aphanomyces astaci]
 gb|ETV81546.1| hypothetical protein H257_06034 [Aphanomyces astaci]
Length=341

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 24/128 (19%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P  LP    +         S  GKE     T++K  E            +  + 
Sbjct  229  LFFVQLPTTLPYTAPL---------SGVGKE-----TASKSSE----------NGTETRF  264

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
              SL  +PGGY+GK+ ++KSG   L LG+  +D++PG   S  +EVV+I+  DK    LG
Sbjct  265  DKSLSAMPGGYLGKINIHKSGKAVLVLGDKTFDLAPGQPPSFYEEVVSIDVKDKLLSMLG  324

Query  274  GIYKHAVV  251
             +  H V+
Sbjct  325  PVATHLVI  332



>ref|XP_008436398.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Poecilia reticulata]
Length=388

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 22/134 (16%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGK---EKVENPPTVLRRRSS  464
            +FF+Q P+ LP   S       P A        E P+    K   +K EN    L     
Sbjct  255  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDAKSAQQKSENMDGSL-----  303

Query  463  PKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DK  293
                  L E P G++GK+ + KSG V+LKLG+++ DVS G  FS  Q++V++        
Sbjct  304  -----VLSEFPEGFLGKLQIRKSGKVELKLGDVILDVSEGAAFSFLQQLVSVRLSGGRTG  358

Query  292  NCCKLGGIYKHAVV  251
            N   LG I+   V+
Sbjct  359  NITVLGNIHHKLVL  372



>ref|XP_006830387.1| hypothetical protein AMTR_s00116p00141430 [Amborella trichopoda]
 gb|ERM97803.1| hypothetical protein AMTR_s00116p00141430 [Amborella trichopoda]
Length=156

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 23/135 (17%)
 Frame = -1

Query  748  LDEAEFGEAARNAEYDETKIHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTL  569
            LDE EFGE++ +      K   ++   L  +++ +E R+ F Q+P   P  K        
Sbjct  44   LDEEEFGESSASKSVS-NKDSINAAEELGVKEEREEPRLLFFQLPETFPVPKR-------  95

Query  568  PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGG  389
             +A+ +G E               +  + L+R    +    LE+L  G+MGK+L+Y+SG 
Sbjct  96   -SATAEGNEA--------------HDDSGLKRIGKSQMPSRLEDLQTGFMGKLLIYESGA  140

Query  388  VKLKLGNILYDVSPG  344
            VKLK+G+ L++VSPG
Sbjct  141  VKLKIGDTLFNVSPG  155



>ref|XP_011477790.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Oryzias 
latipes]
Length=351

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 69/132 (52%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTL--PAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FFIQ+P++LP      +   +     S  G+ V+ + T ++ +E  +N           
Sbjct  222  LFFIQLPDSLPGQPPTKEHRPVRTEVQSEDGQSVL-LKTESQEEEAEDN-----------  269

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKN--C  287
               C+L++L  G +GKMLV KSG V+L LG +  DVS G   S  QE+V+IN   K+   
Sbjct  270  --SCNLKDLREGLVGKMLVRKSGRVQLILGQVTLDVSLGASCSFLQELVSINPEGKSGTL  327

Query  286  CKLGGIYKHAVV  251
              LG I KH +V
Sbjct  328  TVLGNI-KHKMV  338



>ref|XP_001849273.1| DNA-directed RNA polymerase III subunit D [Culex quinquefasciatus]
 gb|EDS29970.1| DNA-directed RNA polymerase III subunit D [Culex quinquefasciatus]
Length=371

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 17/111 (15%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +F +Q+P+ LP       +   PAA+   +   E   +      V++PP           
Sbjct  245  LFLLQLPDALPGKTDTEVRRPDPAAAKPAEGTTENGGA------VQDPPR----------  288

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINT  302
             C++ EL  GY+GK+L Y+SG VKL LG  ++D++ G+     QE+V+INT
Sbjct  289  -CTVRELEEGYIGKVLRYRSGKVKLLLGETMFDLTMGMDSGFLQELVSINT  338



>ref|XP_006341225.1| PREDICTED: uncharacterized protein LOC102585768 [Solanum tuberosum]
Length=142

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  421  MGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            + K+LVYKSG VK+K+G+ +++V PGV     Q+VV INT DK   +LG + K+ VV
Sbjct  78   LCKLLVYKSGKVKMKIGDDIWNVFPGVNHRFCQDVVVINTGDKYFARLGKLNKNVVV  134



>emb|CDS13131.1| hypothetical protein LRAMOSA05314 [Absidia idahoensis var. thermophila]
Length=459

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            + F Q+P+ LP  +   D+   PA S       ++P +AK K  +E          S   
Sbjct  330  LLFFQLPSILPQFEKNNDEPVEPADSKD----TQLPPAAK-KSTLE----------SAMA  374

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---KNCC  284
              S+ ++P G +G ++VYKSG +KLK+G++L+D++ G+  S  +  + ++T+    K   
Sbjct  375  SLSMGDMPQGQVGSLVVYKSGKMKLKIGDVLFDITQGMQSSFLENAMMVDTLSEDKKKVI  434

Query  283  KLGGIYKHAV  254
            +LG + +  V
Sbjct  435  ELGNLTQKFV  444



>ref|XP_007558733.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X3 [Poecilia formosa]
Length=387

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 16/131 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q P+ LP   S       P A        E P+    K   +    +         
Sbjct  254  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDTKSAQQESGNM-------DG  300

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DKNCC  284
               L E P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++        N  
Sbjct  301  SLVLSEFPEGFLGKLQIRKSGKVELKLGDIILDVSEGAAFSFLQQLVSVRLSGGRTGNMM  360

Query  283  KLGGIYKHAVV  251
             LG ++   V+
Sbjct  361  VLGNVHHKLVL  371



>ref|XP_007558715.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X1 [Poecilia formosa]
Length=388

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 16/131 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q P+ LP   S       P A        E P+    K   +    +         
Sbjct  255  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDTKSAQQESGNM-------DG  301

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DKNCC  284
               L E P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++        N  
Sbjct  302  SLVLSEFPEGFLGKLQIRKSGKVELKLGDIILDVSEGAAFSFLQQLVSVRLSGGRTGNMM  361

Query  283  KLGGIYKHAVV  251
             LG ++   V+
Sbjct  362  VLGNVHHKLVL  372



>ref|XP_007558724.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X2 [Poecilia formosa]
Length=387

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 16/131 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q P+ LP   S       P A        E P+    K   +    +         
Sbjct  254  LFFMQFPDCLPGRHSA------PKADLHHGGATEKPSKTDTKSAQQESGNM-------DG  300

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---DKNCC  284
               L E P G++GK+ + KSG V+LKLG+I+ DVS G  FS  Q++V++        N  
Sbjct  301  SLVLSEFPEGFLGKLQIRKSGKVELKLGDIILDVSEGAAFSFLQQLVSVRLSGGRTGNMM  360

Query  283  KLGGIYKHAVV  251
             LG ++   V+
Sbjct  361  VLGNVHHKLVL  371



>ref|XP_003978578.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Takifugu rubripes]
Length=363

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 22/150 (15%)
 Frame = -1

Query  691  IHPSSelglldeqdedERRMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKG  512
            + PS    L D +  D++ +FF+Q+P+ +P+  S     +   A                
Sbjct  220  VQPSLNKMLQDLKLSDKQELFFMQLPDCMPASGSAHSSNSSTLAD---------------  264

Query  511  KEKVENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFS  332
            + KV     V ++  SP     L + P G++GK+ + KSG V+L+LG+I+ DVS G  FS
Sbjct  265  RRKVHLHGQVAKKDGSP----VLSQFPEGFLGKLQIRKSGKVELRLGDIVMDVSEGAAFS  320

Query  331  SAQEVVAINTVD---KNCCKLGGIYKHAVV  251
              Q++V+++  D    +   LG +++  V+
Sbjct  321  FLQQLVSVHLSDGWKGDMMVLGNVHQKLVL  350



>ref|XP_010775695.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
isoform X4 [Notothenia coriiceps]
Length=353

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 8/105 (8%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q+P+++P                      E P   +GK   + P  +  ++   K+
Sbjct  251  LFFMQLPDSMPG-------RAAQKVDPPPAPAAEKPDKKEGKLADKRPAQLQAQQVPLKE  303

Query  454  GCS-LEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQ  323
            GC  L +LP G++GK+ + KSG V+LK+G ++ DVS G  FS  Q
Sbjct  304  GCPVLSQLPEGFLGKLQIRKSGKVELKMGQVVMDVSEGAAFSFLQ  348



>emb|CDH60133.1| hypothetical protein RO3G_15547 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=459

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 18/130 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            + F Q+P+ LP  + + D            E +EV   A  K+K   P        S   
Sbjct  330  LLFFQLPSILPQFEKVDD------------EPVEV---ADDKDKQLPPAAKKSTLESAMA  374

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---KNCC  284
              SL ++P G +G ++VYKSG +KLK+G++L+D++ G+  S  +  + ++T+    K   
Sbjct  375  SLSLGDMPQGQVGSLVVYKSGKMKLKIGDVLFDITQGMQSSFLENAMMVDTLSEDKKKVI  434

Query  283  KLGGIYKHAV  254
            +LG + +  V
Sbjct  435  ELGNLTQKFV  444



>ref|XP_007844173.1| hypothetical protein Moror_6919 [Moniliophthora roreri MCA 2997]
 gb|ESK96411.1| hypothetical protein Moror_6919 [Moniliophthora roreri MCA 2997]
Length=415

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 66/135 (49%), Gaps = 11/135 (8%)
 Frame = -1

Query  637  RMFFIQIPNNLPS--CKSIGDQTTLPAASTKGKEVIEVPTSAKGKEK---VENPPTVLRR  473
            R++F Q P+  PS   K++     L A+ + G + +      K +      + PP    +
Sbjct  254  RLYFFQFPSPFPSFELKNMDVDMALEASVSSGAKRVSFAADVKQESSQVLSQTPP----Q  309

Query  472  RSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGN-ILYDVSPGVGFSSAQEVVAINTVD  296
             S+ +K   L  L  G +GK+ VY+SG VK++L N IL DV+ G   S  Q  V+++ V 
Sbjct  310  PSTEQKTQPLPAL-DGVIGKLEVYRSGAVKMRLANGILLDVTAGTQPSFLQHAVSVDMVQ  368

Query  295  KNCCKLGGIYKHAVV  251
                 LG I KH  V
Sbjct  369  NKMTVLGEINKHFTV  383



>ref|XP_001659518.1| AAEL008794-PA [Aedes aegypti]
 gb|EAT39396.1| AAEL008794-PA [Aedes aegypti]
Length=361

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 24/111 (22%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +F +Q+P+ LP     G   T         EV +  ++  G+E+ +  P          +
Sbjct  244  LFLLQLPDALP-----GKTDT---------EVRKTDSNGAGEEETKPEP----------Q  279

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINT  302
             C++ EL  GY+GK++ Y+SG VKL LGN ++D+S G+     QE+V+I T
Sbjct  280  RCTVRELEEGYIGKVMRYRSGKVKLVLGNTVFDLSMGMDSGFLQELVSITT  330



>gb|KFB40569.1| AGAP004480-PA-like protein [Anopheles sinensis]
Length=358

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 61/111 (55%), Gaps = 20/111 (18%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEV-IEVPTSAKGKEKVENPPTVLRRRSSPK  458
            +F +Q+P+ LP     G++ T+      G E+  E P +A  +E             +P+
Sbjct  233  IFLLQLPDALPGKCDSGEKQTV-----NGHEIKTEAPQAATTEE-------------TPQ  274

Query  457  KGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAIN  305
              C++ +L  G +GK++ Y+SG VKL LG I++D+S G+     QE+V+IN
Sbjct  275  Y-CTVRDLDEGCVGKIIRYRSGKVKLMLGKIMFDISLGMDTGFLQELVSIN  324



>emb|CEG80460.1| hypothetical protein RMATCC62417_14795 [Rhizopus microsporus]
Length=248

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 7/115 (6%)
 Frame = -1

Query  577  TTLPAASTKGKEVIEVPTSAKGK-EKVE-NPPTVLRRRS--SPKKGCSLEELPGGYMGKM  410
            T +P    K +EV E+      K EK+E N P   R+ +        +LE++P G +GK+
Sbjct  117  TVVPKFEAKKQEVEEIKDEEAIKVEKIEQNLPPGARKPTLEDAMASLALEDMPEGQVGKL  176

Query  409  LVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD---KNCCKLGGIYKHAV  254
            +VYKSG +K++ GNIL DV+ G+  S  + V+ ++      K   +LG I +  V
Sbjct  177  IVYKSGKMKMQFGNILLDVTQGMHSSFLENVMVVDHESEETKKAIELGHIVQKFV  231



>gb|EIF46806.1| dna-directed rna polymerase iii subunit c4 [Brettanomyces bruxellensis 
AWRI1499]
Length=332

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 8/121 (7%)
 Frame = -1

Query  631  FFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKKG  452
             F+Q P  LP  +  G      A S K K  ++     K   K E    +LR R + +K 
Sbjct  210  MFVQFPALLPEFEDAG------ADSGKSKVAVKXEDGEKSS-KQEAAXRILRERGA-EKT  261

Query  451  CSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLGG  272
               ++LP G +GK+  +KSG V +K+GN+ +DV  G      Q +V I+  +  C  LG 
Sbjct  262  EKQKKLPXGIIGKLRYHKSGKVSMKIGNVXFDVMRGAPGBFRQXIVGIDKNNTKCYDLGS  321

Query  271  I  269
            +
Sbjct  322  V  322



>gb|AAH66421.2| Zgc:56407 [Danio rerio]
Length=381

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (51%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGD--QTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P++LP      D   T     S+ G+ +++               T  +  S  
Sbjct  252  LLFMQLPDSLPGQPPTSDVRPTKTEVQSSDGQTMMQK--------------TETQEESPE  297

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
            +  C L++L  G +GKMLV KSG V+L LGN+  DV+ G   +  QE+V++NT  +  + 
Sbjct  298  ENTCCLKDLQEGLVGKMLVRKSGRVQLVLGNVTLDVALGTPCAFLQELVSVNTEGRRGDM  357

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  358  SVLGHV-KHKLV  368



>gb|AAI53605.1| Zgc:56407 [Danio rerio]
Length=381

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGD--QTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P++LP      D   T     S+ G+ +++     K + + E+P          
Sbjct  252  LLFMQLPDSLPGQPPTSDVRPTKTEVQSSDGQTMMQ-----KTETQEESPE---------  297

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
            +  C L++L  G +GKMLV KSG V+L LGN+  DV+ G   +  QE+V++NT  +  + 
Sbjct  298  ENTCCLKDLQEGLVGKMLVRKSGRVQLVLGNVTLDVALGTPCAFLQELVSVNTEGRRGDM  357

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  358  SVLGHV-KHKLV  368



>ref|NP_956581.1| DNA-directed RNA polymerase III subunit RPC4 [Danio rerio]
 gb|AAH49426.1| Zgc:56407 [Danio rerio]
Length=381

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGD--QTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P++LP      D   T     S+ G+ +++     K + + E+P          
Sbjct  252  LLFMQLPDSLPGQPPTSDVRPTKTEVQSSDGQTMMQ-----KTETQEESPE---------  297

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
            +  C L++L  G +GKMLV KSG V+L LGN+  DV+ G   +  QE+V++NT  +  + 
Sbjct  298  ENTCCLKDLQEGLVGKMLVRKSGRVQLVLGNVTLDVALGTPCAFLQELVSVNTEGRRGDM  357

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  358  SVLGHV-KHKLV  368



>ref|XP_005811751.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Xiphophorus maculatus]
Length=386

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 13/109 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FF+Q P+ LP   S   +  L      GK      T AK  ++V           +   
Sbjct  253  LFFMQFPDCLPGRHS-APKADLHHGGASGKPS---KTDAKSAQQVSG---------NMDG  299

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAI  308
               L E P G++GK+ + KSG V+LKLG+++ DVS G  FS  Q++V++
Sbjct  300  SLVLSEFPEGFLGKLQIRKSGKVELKLGDVILDVSEGAAFSFLQQLVSV  348



>ref|XP_009055984.1| hypothetical protein LOTGIDRAFT_232725 [Lottia gigantea]
 gb|ESO93285.1| hypothetical protein LOTGIDRAFT_232725 [Lottia gigantea]
Length=364

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 17/130 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            + F Q+P+ LP       Q +   + T         T+   K   E   TV  R S+   
Sbjct  239  LIFFQLPDTLPGLPPTRKQDSDKPSDTST-------TTDSNKTDTE---TVSDRLST---  285

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVD--KNCCK  281
             CSL +   G +GK+ + KSG ++L +GN+  DV+ G      QEVV++NT D   + C 
Sbjct  286  -CSLADFSEGQIGKLQIRKSGKIELLIGNVKLDVTAGTPSGFLQEVVSVNTADGTGSMCV  344

Query  280  LGGIYKHAVV  251
            LG I KH ++
Sbjct  345  LGHI-KHRLI  353



>emb|CEP10166.1| hypothetical protein [Parasitella parasitica]
Length=659

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 64/127 (50%), Gaps = 14/127 (11%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENP-PTVLRRRS---  467
            + + Q+P  +P  + + D+  +       +E+       K +   ENP PT   + +   
Sbjct  346  LLYFQLPTVVPIFEKLKDEEKIDVDMEAKEEI-------KAETITENPLPTAAIKSTLLD  398

Query  466  SPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV---D  296
                  SL+++P G +GK++VYKSG VK++LG+IL DV+ G+  +  + V+ ++     D
Sbjct  399  DAMANMSLDDMPDGKIGKLIVYKSGKVKMQLGSILLDVNQGMQSTFLENVMVVDHETHPD  458

Query  295  KNCCKLG  275
              C   G
Sbjct  459  DECMFFG  465



>ref|XP_008608135.1| hypothetical protein SDRG_04249 [Saprolegnia diclina VS20]
 gb|EQC38543.1| hypothetical protein SDRG_04249 [Saprolegnia diclina VS20]
Length=331

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 19/128 (15%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FFIQ+P  LP  +         A       V      A+G E  +N             
Sbjct  214  LFFIQLPTTLPYAQKTATA----AKDDDDAPVKPANKDAEGLELYDN-------------  256

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCKLG  275
              +L  +P G++GK+ ++KSG   L LG+  +D++P    +  +E+V+++T D+    LG
Sbjct  257  --ALNTMPSGFLGKIQIHKSGKAVLVLGDKTFDIAPAQPPTFYEELVSMDTKDRLLSHLG  314

Query  274  GIYKHAVV  251
             I  H VV
Sbjct  315  PIANHLVV  322



>dbj|GAM22143.1| hypothetical protein SAMD00019534_053180 [Acytostelium subglobosum 
LB1]
Length=468

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 67/159 (42%), Gaps = 34/159 (21%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKS-----IGDQTTL--------------------PAASTKGKEVIE  533
             +FFIQ+P +LPS ++     +    TL                    PA+++ G E  E
Sbjct  305  HLFFIQLPTSLPSTQTRPIMNMNQMPTLLGKPAAMAPPAKPAAGVAKPPASTSSGLESNE  364

Query  532  VPTSAKGKEKVENPPTVLRRRSSP-----KKGCSLEELPGGYMGKMLVYKSGGVKLKLGN  368
              TS    EK    P + +    P         +L+ LP G +G + +YKSG   L++G 
Sbjct  365  TTTSIDSAEK----PVLNKHSFVPMIYPGDFTNTLKSLPSGRLGNLKIYKSGKAILRIGE  420

Query  367  ILYDVSPGVGFSSAQEVVAINTVDKNCCKLGGIYKHAVV  251
            I YDVS G      +EV  I      C  LG   +H V+
Sbjct  421  IDYDVSAGNKLKFLEEVKCITHEGPTCYNLGTPAQHLVL  459



>ref|XP_009523026.1| hypothetical protein PHYSODRAFT_245995 [Phytophthora sojae]
 gb|EGZ20309.1| hypothetical protein PHYSODRAFT_245995 [Phytophthora sojae]
Length=353

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 68/138 (49%), Gaps = 18/138 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIG-------DQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLR  476
            +FFIQ+P  LP  K+         D+    A ++K +        AK  +K +    V  
Sbjct  215  LFFIQMPTTLPLAKATAKAASTDEDEPMEDAEASKDQ--------AKESKKADESVYVSA  266

Query  475  RRSSPKKGC---SLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAIN  305
               +   G    S+E  PGG++GK+ V+KSG + L LG+  ++++     S  +EV  +N
Sbjct  267  AEIAEDDGVFDHSIETAPGGFIGKICVHKSGKMVLMLGDKQFEIATAQTPSFCEEVYVVN  326

Query  304  TVDKNCCKLGGIYKHAVV  251
            T +K+   LG + +H VV
Sbjct  327  TTEKHLSILGNVERHLVV  344



>ref|XP_008280515.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Stegastes 
partitus]
Length=386

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 19/132 (14%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            +FF+Q+P++LP      +   +     S  G+ V+ + T ++ +E  EN           
Sbjct  257  LFFVQLPDSLPGQPPTKEHRPVKTEVQSEDGQSVL-LKTESQEEEAEEN-----------  304

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NC  287
               C+L++L  G +GKMLV KSG V+L LG++  DVS G   S  QE+V+I T  K  N 
Sbjct  305  --SCNLKDLREGVIGKMLVRKSGRVQLILGHVTLDVSLGTSCSFFQELVSIGTEGKTGNL  362

Query  286  CKLGGIYKHAVV  251
              LG + KH +V
Sbjct  363  TVLGNV-KHKMV  373



>ref|XP_009569702.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 [Cuculus 
canorus]
 gb|KFO71531.1| DNA-directed RNA polymerase III subunit RPC4 [Cuculus canorus]
Length=396

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQ--TTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P+ LP      D     +   + +G+ ++     ++  ++ EN           
Sbjct  264  LLFLQLPDTLPGQPPTHDTKPIKMELQNEEGQMMVVKQEKSQEAKQAEN-----------  312

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
               C+L +LP G +GK+L+ KSG V+L LGN+  DV+ G   S  QE+V+++  D    +
Sbjct  313  --ICTLADLPEGQVGKLLIRKSGKVQLVLGNVTLDVTMGTPCSFLQELVSVSIGDNRTGE  370

Query  280  L--GGIYKHAVV  251
            +   G  KH +V
Sbjct  371  MIVLGHVKHKLV  382



>ref|XP_010765095.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4, partial 
[Notothenia coriiceps]
Length=319

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 67/130 (52%), Gaps = 15/130 (12%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSPKK  455
            +FFIQ+P+ LP     G   T+     K +   E   S   K       T  +   + + 
Sbjct  190  LFFIQMPDTLP-----GQPPTMEHRPVKTEVQSEDGQSVLLK-------TESQEEEAEEN  237

Query  454  GCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDK--NCCK  281
             C+L++L  G +GKMLV KSG V+L LG++  DVS G   S  QE+V+I++  +  +   
Sbjct  238  NCNLKDLREGLVGKMLVRKSGRVQLILGHVTLDVSLGTSCSFLQELVSIHSEGRTGDLTI  297

Query  280  LGGIYKHAVV  251
            LG + KH +V
Sbjct  298  LGNV-KHKMV  306



>ref|XP_002386188.1| hypothetical protein MPER_15665 [Moniliophthora perniciosa FA553]
 gb|EEB87118.1| hypothetical protein MPER_15665 [Moniliophthora perniciosa FA553]
Length=134

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 3/76 (4%)
 Frame = -1

Query  469  SSPKKGCSLEELPG--GYMGKMLVYKSGGVKLKLGN-ILYDVSPGVGFSSAQEVVAINTV  299
            S P      + LP   G +GK+ VY+SG VK++L N IL D++ G   S  Q  V+++TV
Sbjct  27   SQPSTEQKTQSLPALDGVIGKLEVYRSGAVKMRLANGILLDITAGTQPSFLQHAVSVDTV  86

Query  298  DKNCCKLGGIYKHAVV  251
                  LG I KH  V
Sbjct  87   QNKMAVLGEINKHFTV  102



>ref|XP_009903334.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III 
subunit RPC4 [Picoides pubescens]
Length=386

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (48%), Gaps = 17/132 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P+ LP      D   +     + +G+ V+     ++   + EN           
Sbjct  254  LLFLQLPDTLPGLPPTHDTKPIKTELQNEEGQMVVVKQEKSQEARQAEN-----------  302

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
               C+L +LP G +GK+L+ KSG V+L LG +  DV+ G   S  QE+V++   D    +
Sbjct  303  --TCTLADLPEGQVGKLLIRKSGKVQLVLGKVTLDVTMGTPCSFLQELVSVGIGDNRTGE  360

Query  280  L--GGIYKHAVV  251
            +   G  KH +V
Sbjct  361  MIVLGHVKHKLV  372



>ref|XP_002735290.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4-like 
[Saccoglossus kowalevskii]
Length=418

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (51%), Gaps = 17/132 (13%)
 Frame = -1

Query  637  RMFFIQIPNNLPSCKSIGDQTTLPAASTKGKEVIEVPTSAKGKE-KVENPPTVLRRRSSP  461
            ++ F Q P+ LP+         +P +  +  EV   P + +G + K +        +S P
Sbjct  289  QLLFFQFPDTLPA---------VPLS--RDGEVAAKPETQRGMQGKKDKSTDKEEEKSDP  337

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTV--DKNC  287
               C+L+ +   Y+GK+ V KSG  +L LGN++ DV+ G      Q++V+I T   +KN 
Sbjct  338  --NCTLKNISESYIGKLQVLKSGKTRLVLGNVVLDVNMGTPCGFLQDLVSIKTKEDEKNL  395

Query  286  CKLGGIYKHAVV  251
              LG I KH +V
Sbjct  396  SVLGHI-KHRLV  406



>ref|XP_011200476.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X2 [Bactrocera dorsalis]
Length=371

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 8/87 (9%)
 Frame = -1

Query  499  ENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQE  320
            +NPP        P K  S+++L  G +G++L YKSG VKL LGN  +D++ G+     Q+
Sbjct  269  QNPPAT----KPPTKRTSMKDLEEGKIGRLLRYKSGKVKLVLGNTYFDLNMGIETGFLQD  324

Query  319  VVAINTVDK----NCCKLGGIYKHAVV  251
            +++INT  +    N   LG I     V
Sbjct  325  LMSINTNREERSGNMINLGSIQAKLTV  351



>gb|EMC81482.1| DNA-directed RNA polymerase III subunit RPC4, partial [Columba 
livia]
Length=345

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 63/132 (48%), Gaps = 17/132 (13%)
 Frame = -1

Query  634  MFFIQIPNNLPSCKSIGDQTTLPA--ASTKGKEVIEVPTSAKGKEKVENPPTVLRRRSSP  461
            + F+Q+P+ LP      D   +     + +G+ V+     ++   + EN           
Sbjct  213  LLFLQLPDTLPGQPPTHDTKPIKTELQNEEGQVVVVKQEKSQEARQAEN-----------  261

Query  460  KKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQEVVAINTVDKNCCK  281
               C+L +LP G +GK+LV KSG V+L LG +  DV+ G   S  QE+V++   D    +
Sbjct  262  --TCTLADLPEGQVGKLLVRKSGKVQLVLGKVTLDVTMGTPCSFLQELVSVGIGDNRTGE  319

Query  280  L--GGIYKHAVV  251
            +   G  KH +V
Sbjct  320  MIVLGHVKHKLV  331



>ref|XP_011200475.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform 
X1 [Bactrocera dorsalis]
Length=401

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 8/87 (9%)
 Frame = -1

Query  499  ENPPTVLRRRSSPKKGCSLEELPGGYMGKMLVYKSGGVKLKLGNILYDVSPGVGFSSAQE  320
            +NPP        P K  S+++L  G +G++L YKSG VKL LGN  +D++ G+     Q+
Sbjct  299  QNPPAT----KPPTKRTSMKDLEEGKIGRLLRYKSGKVKLVLGNTYFDLNMGIETGFLQD  354

Query  319  VVAINTVDK----NCCKLGGIYKHAVV  251
            +++INT  +    N   LG I     V
Sbjct  355  LMSINTNREERSGNMINLGSIQAKLTV  381



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630