BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014P10

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010325538.1|  PREDICTED: regulator of nonsense transcripts...  80.1    2e-13   Solanum lycopersicum
ref|XP_004245855.1|  PREDICTED: regulator of nonsense transcripts...  80.1    2e-13   Solanum lycopersicum
ref|XP_004244550.1|  PREDICTED: regulator of nonsense transcripts...  79.0    5e-13   Solanum lycopersicum
ref|XP_006362492.1|  PREDICTED: regulator of nonsense transcripts...  78.2    8e-13   Solanum tuberosum [potatoes]
ref|XP_006358610.1|  PREDICTED: regulator of nonsense transcripts...  75.5    5e-12   Solanum tuberosum [potatoes]
emb|CDP13413.1|  unnamed protein product                              74.3    1e-11   Coffea canephora [robusta coffee]
ref|XP_011070275.1|  PREDICTED: regulator of nonsense transcripts...  74.3    1e-11   Sesamum indicum [beniseed]
ref|XP_009619427.1|  PREDICTED: regulator of nonsense transcripts...  73.2    2e-11   Nicotiana tomentosiformis
ref|XP_002279304.2|  PREDICTED: regulator of nonsense transcripts...  73.6    2e-11   Vitis vinifera
ref|XP_006485359.1|  PREDICTED: regulator of nonsense transcripts...  73.6    3e-11   Citrus sinensis [apfelsine]
ref|XP_010677214.1|  PREDICTED: regulator of nonsense transcripts...  73.2    3e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO41060.1|  hypothetical protein CISIN_1g0010542mg                72.4    4e-11   Citrus sinensis [apfelsine]
ref|XP_008229510.1|  PREDICTED: regulator of nonsense transcripts...  72.8    4e-11   Prunus mume [ume]
ref|XP_008229509.1|  PREDICTED: regulator of nonsense transcripts...  72.8    4e-11   Prunus mume [ume]
ref|XP_007210428.1|  hypothetical protein PRUPE_ppa000334mg           72.8    4e-11   Prunus persica
ref|XP_009765593.1|  PREDICTED: regulator of nonsense transcripts...  72.4    4e-11   Nicotiana sylvestris
ref|XP_009626110.1|  PREDICTED: regulator of nonsense transcripts...  72.4    5e-11   Nicotiana tomentosiformis
ref|XP_009626103.1|  PREDICTED: regulator of nonsense transcripts...  72.4    6e-11   Nicotiana tomentosiformis
ref|XP_006436834.1|  hypothetical protein CICLE_v10031552mg           71.6    6e-11   
ref|XP_009369685.1|  PREDICTED: regulator of nonsense transcripts...  71.6    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_009369688.1|  PREDICTED: regulator of nonsense transcripts...  71.6    9e-11   
ref|XP_009369687.1|  PREDICTED: regulator of nonsense transcripts...  71.6    9e-11   
gb|KHG18592.1|  Regulator of nonsense transcripts 1 -like protein     71.6    9e-11   Gossypium arboreum [tree cotton]
ref|XP_009371868.1|  PREDICTED: regulator of nonsense transcripts...  71.6    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_008346508.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008346509.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008346507.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008375865.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008375867.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008375866.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008375864.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_008375863.1|  PREDICTED: regulator of nonsense transcripts...  71.2    1e-10   
ref|XP_004300289.1|  PREDICTED: regulator of nonsense transcripts...  70.9    1e-10   Fragaria vesca subsp. vesca
ref|XP_009398574.1|  PREDICTED: regulator of nonsense transcripts...  70.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398575.1|  PREDICTED: regulator of nonsense transcripts...  70.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009792531.1|  PREDICTED: regulator of nonsense transcripts...  70.5    2e-10   Nicotiana sylvestris
gb|KJB25396.1|  hypothetical protein B456_004G189700                  70.5    2e-10   Gossypium raimondii
gb|KJB25397.1|  hypothetical protein B456_004G189700                  70.5    2e-10   Gossypium raimondii
gb|KHF99302.1|  Regulator of nonsense transcripts 1 -like protein     70.5    2e-10   Gossypium arboreum [tree cotton]
ref|XP_006385597.1|  RNA helicase family protein                      69.7    3e-10   
ref|XP_006368472.1|  RNA helicase family protein                      69.7    4e-10   
ref|XP_002528794.1|  nonsense-mediated mRNA decay protein, putative   69.7    4e-10   Ricinus communis
gb|EYU17850.1|  hypothetical protein MIMGU_mgv1a000580mg              69.3    5e-10   Erythranthe guttata [common monkey flower]
gb|ABK96558.1|  unknown                                               68.9    6e-10   Populus trichocarpa x Populus deltoides
ref|XP_006858514.1|  hypothetical protein AMTR_s00071p00142490        68.9    7e-10   Amborella trichopoda
gb|EYU33046.1|  hypothetical protein MIMGU_mgv1a000320mg              68.9    8e-10   Erythranthe guttata [common monkey flower]
gb|KJB21033.1|  hypothetical protein B456_003G179500                  68.2    1e-09   Gossypium raimondii
ref|XP_011018658.1|  PREDICTED: regulator of nonsense transcripts...  68.2    1e-09   Populus euphratica
ref|XP_010664057.1|  PREDICTED: regulator of nonsense transcripts...  67.4    2e-09   Vitis vinifera
gb|KDP45961.1|  hypothetical protein JCGZ_11864                       67.0    3e-09   Jatropha curcas
ref|XP_008784706.1|  PREDICTED: regulator of nonsense transcripts...  66.6    4e-09   Phoenix dactylifera
ref|XP_010919834.1|  PREDICTED: regulator of nonsense transcripts...  66.2    6e-09   Elaeis guineensis
ref|XP_010110516.1|  Regulator of nonsense transcripts 1-like pro...  65.9    7e-09   Morus notabilis
ref|XP_011032015.1|  PREDICTED: regulator of nonsense transcripts...  65.9    7e-09   Populus euphratica
ref|XP_007039605.1|  Regulator of nonsense transcripts 1              65.5    1e-08   
ref|XP_010269894.1|  PREDICTED: regulator of nonsense transcripts...  63.9    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_004150168.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  62.8    8e-08   
ref|XP_008448746.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  62.4    9e-08   Cucumis melo [Oriental melon]
ref|XP_004163978.1|  PREDICTED: regulator of nonsense transcripts...  62.4    9e-08   
ref|XP_008651597.1|  PREDICTED: uncharacterized protein LOC100304...  62.0    1e-07   Zea mays [maize]
ref|XP_008651596.1|  PREDICTED: uncharacterized protein LOC100304...  62.0    1e-07   Zea mays [maize]
ref|XP_008651595.1|  PREDICTED: uncharacterized protein LOC100304...  62.0    1e-07   
ref|XP_008651594.1|  PREDICTED: uncharacterized protein LOC100304...  62.0    1e-07   Zea mays [maize]
ref|NP_001159153.1|  uncharacterized protein LOC100304236             60.5    2e-07   
ref|XP_010530003.1|  PREDICTED: regulator of nonsense transcripts...  59.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_010530005.1|  PREDICTED: regulator of nonsense transcripts...  59.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_010530004.1|  PREDICTED: regulator of nonsense transcripts...  59.7    8e-07   Tarenaya hassleriana [spider flower]
ref|XP_010933539.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  59.3    1e-06   Elaeis guineensis
ref|XP_004511759.1|  PREDICTED: regulator of nonsense transcripts...  58.5    2e-06   Cicer arietinum [garbanzo]
ref|XP_009397656.1|  PREDICTED: regulator of nonsense transcripts...  58.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518678.1|  PREDICTED: regulator of nonsense transcripts...  58.2    2e-06   Tarenaya hassleriana [spider flower]
gb|KJB37673.1|  hypothetical protein B456_006G215300                  58.2    3e-06   Gossypium raimondii
gb|KJB37672.1|  hypothetical protein B456_006G215300                  58.2    3e-06   Gossypium raimondii
ref|XP_010518677.1|  PREDICTED: regulator of nonsense transcripts...  58.2    3e-06   Tarenaya hassleriana [spider flower]
gb|KGN55800.1|  hypothetical protein Csa_3G016940                     57.8    3e-06   Cucumis sativus [cucumbers]
ref|XP_010055383.1|  PREDICTED: regulator of nonsense transcripts...  57.8    4e-06   Eucalyptus grandis [rose gum]
ref|XP_007156615.1|  hypothetical protein PHAVU_002G003300g           57.4    5e-06   Phaseolus vulgaris [French bean]
ref|XP_003611424.1|  Regulator of nonsense transcripts-like protein   57.4    5e-06   Medicago truncatula
gb|KHN34876.1|  Regulator of nonsense transcripts 1 like              57.0    6e-06   Glycine soja [wild soybean]
ref|XP_008668400.1|  PREDICTED: uncharacterized protein LOC100383...  57.0    6e-06   Zea mays [maize]
ref|XP_008668399.1|  PREDICTED: uncharacterized protein LOC100383...  57.0    6e-06   Zea mays [maize]
ref|XP_006590595.1|  PREDICTED: regulator of nonsense transcripts...  57.0    6e-06   Glycine max [soybeans]
ref|XP_010481386.1|  PREDICTED: regulator of nonsense transcripts...  57.0    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010494909.1|  PREDICTED: regulator of nonsense transcripts...  57.0    7e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001169419.1|  uncharacterized protein LOC100383288             55.5    1e-05   
ref|XP_002460731.1|  hypothetical protein SORBIDRAFT_02g033940        56.2    1e-05   Sorghum bicolor [broomcorn]
tpg|DAA40911.1|  TPA: hypothetical protein ZEAMMB73_425956            55.8    1e-05   
gb|KFK31413.1|  hypothetical protein AALP_AA6G108800                  55.8    1e-05   Arabis alpina [alpine rockcress]
ref|XP_004957770.1|  PREDICTED: regulator of nonsense transcripts...  55.5    2e-05   Setaria italica
ref|XP_009341225.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_009341224.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_009341223.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_003517385.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-05   Glycine max [soybeans]
dbj|BAB10240.1|  prematurely terminated mRNA decay factor-like pr...  55.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199512.2|  Regulator of nonsense transcripts 1-like protein    55.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAL92018.1|  UPF1                                                  55.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658577.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-05   Oryza brachyantha
ref|XP_010274587.1|  PREDICTED: regulator of nonsense transcripts...  53.9    7e-05   Nelumbo nucifera [Indian lotus]
gb|KHG01127.1|  Regulator of nonsense transcripts 1 -like protein     53.5    1e-04   Gossypium arboreum [tree cotton]
ref|XP_006282104.1|  hypothetical protein CARUB_v10028351mg           51.2    6e-04   Capsella rubella
ref|XP_003563076.1|  PREDICTED: regulator of nonsense transcripts...  50.8    8e-04   Brachypodium distachyon [annual false brome]



>ref|XP_010325538.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Solanum lycopersicum]
Length=1261

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGY++ + +D+SQNHFGMSNA+ LHSQ +LNPLYSQPFGHYN+QP+N+
Sbjct  1188  QAGYSDPSQEDSSQNHFGMSNANPLHSQSLLNPLYSQPFGHYNTQPLNM  1236



>ref|XP_004245855.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Solanum lycopersicum]
Length=1274

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGY++ + +D+SQNHFGMSNA+ LHSQ +LNPLYSQPFGHYN+QP+N+
Sbjct  1201  QAGYSDPSQEDSSQNHFGMSNANPLHSQSLLNPLYSQPFGHYNTQPLNM  1249



>ref|XP_004244550.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
lycopersicum]
Length=1264

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLEnsqpqqqqap  585
             QAGYN+   DD SQNHFGMSN ++L SQ +LNP+YSQPF HYN+QP+NL++SQPQQQQ P
Sbjct  1191  QAGYNDPLQDDGSQNHFGMSNVNSLQSQSLLNPIYSQPFAHYNTQPLNLQSSQPQQQQGP  1250

Query  584   qgqgsqnQKLQYSS  543
             QGQ  QNQKLQY+S
Sbjct  1251  QGQCFQNQKLQYNS  1264



>ref|XP_006362492.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
tuberosum]
Length=1264

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGYN+ + DD SQNHFGMSN ++L SQ +LNP+YSQPF HYN+QP+NL
Sbjct  1191  QAGYNDPSQDDGSQNHFGMSNVNSLQSQSLLNPIYSQPFAHYNTQPLNL  1239



>ref|XP_006358610.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Solanum 
tuberosum]
Length=1267

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGY++ + +D+ QNHFGMSNA+ L SQ +LNPLYSQPFGHYN+QP+N+
Sbjct  1199  QAGYSDPSQEDSPQNHFGMSNANPLQSQSLLNPLYSQPFGHYNTQPLNM  1247



>emb|CDP13413.1| unnamed protein product [Coffea canephora]
Length=1281

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DD SQNHFG+ N++ L SQ +LNPLYSQPFGHYN+QP+N+
Sbjct  1208  QAGFNDPSQDDTSQNHFGVPNSNPLQSQSMLNPLYSQPFGHYNTQPLNV  1256



>ref|XP_011070275.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Sesamum 
indicum]
Length=1276

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QA +NE + D+ASQNHFG+++A+ L SQG+LNPLYSQPF HYN+QP+N+
Sbjct  1204  QAAFNEQSQDEASQNHFGVASANPLQSQGLLNPLYSQPFAHYNTQPLNV  1252



>ref|XP_009619427.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
tomentosiformis]
Length=569

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
            QAGYN+ + DD+SQNHFGMSNA+ L SQ +LNPLYSQPF HYN+Q +N+
Sbjct  496  QAGYNDPSQDDSSQNHFGMSNANPLQSQSLLNPLYSQPFAHYNTQLLNM  544



>ref|XP_002279304.2| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Vitis vinifera]
 emb|CBI33955.3| unnamed protein product [Vitis vinifera]
Length=1267

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQ+HFG++N + L SQG++NPLYSQPF HYN+QP+NL
Sbjct  1189  QVGFNDPSQDDASQSHFGVANPNPLQSQGLMNPLYSQPFAHYNTQPLNL  1237



>ref|XP_006485359.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Citrus 
sinensis]
Length=1274

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGYNE   DDASQ+HFG+ N + L +QG++N LYSQPF HYNSQP+NL
Sbjct  1204  QAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSLYSQPFAHYNSQPLNL  1252



>ref|XP_010677214.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Beta 
vulgaris subsp. vulgaris]
Length=1292

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + DD SQ HFG+ NA+ L SQG++NPLYSQPF HYN+QPMNL+
Sbjct  1214  QVGFNDPSQDDNSQGHFGVGNANPLQSQGLMNPLYSQPFTHYNTQPMNLQ  1263



>gb|KDO41060.1| hypothetical protein CISIN_1g0010542mg, partial [Citrus sinensis]
Length=664

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
            QAGYNE   DDASQ+HFG+ N + L +QG++N LYSQPF HYNSQP+NL
Sbjct  594  QAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSLYSQPFAHYNSQPLNL  642



>ref|XP_008229510.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Prunus mume]
Length=1272

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1199  QVGFNDPSQDDASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1247



>ref|XP_008229509.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Prunus mume]
Length=1274

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1201  QVGFNDPSQDDASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1249



>ref|XP_007210428.1| hypothetical protein PRUPE_ppa000334mg [Prunus persica]
 gb|EMJ11627.1| hypothetical protein PRUPE_ppa000334mg [Prunus persica]
Length=1276

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1201  QVGFNDPSQDDASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1249



>ref|XP_009765593.1| PREDICTED: regulator of nonsense transcripts 1 homolog, partial 
[Nicotiana sylvestris]
Length=600

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
            QAGYN+ + DD+SQNHF MSN + L SQ +LNPLYSQPF HYN+QP++++
Sbjct  527  QAGYNDPSQDDSSQNHFSMSNVNPLQSQSLLNPLYSQPFAHYNTQPLHMQ  576



>ref|XP_009626110.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Nicotiana tomentosiformis]
Length=1269

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGYN  + DD SQNHFGMSNAS L SQ  LNPLYSQPF HYN+QP N+
Sbjct  1198  QAGYNNPSQDDGSQNHFGMSNAS-LQSQSSLNPLYSQPFAHYNTQPFNM  1245



>ref|XP_009626103.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=1273

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGYN  + DD SQNHFGMSNAS L SQ  LNPLYSQPF HYN+QP N+
Sbjct  1202  QAGYNNPSQDDGSQNHFGMSNAS-LQSQSSLNPLYSQPFAHYNTQPFNM  1249



>ref|XP_006436834.1| hypothetical protein CICLE_v10031552mg [Citrus clementina]
 gb|ESR50074.1| hypothetical protein CICLE_v10031552mg [Citrus clementina]
Length=440

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
            QAGYNE   DDASQ+HFG+ N + L +QG++N LYSQPF HYNSQP+NL
Sbjct  370  QAGYNEPTQDDASQSHFGVVNPNALQTQGMMNSLYSQPFAHYNSQPLNL  418



>ref|XP_009369685.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=1285

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL+
Sbjct  1202  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNLQ  1251



>ref|XP_009369688.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=1283

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL+
Sbjct  1200  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNLQ  1249



>ref|XP_009369687.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=1284

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL+
Sbjct  1201  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNLQ  1250



>gb|KHG18592.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1236

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DDASQ+HFG+SN + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1166  QAGFNDPSHDDASQSHFGVSNPNQLQSQGLMNSLYSQPFSHYNTQPLNL  1214



>ref|XP_009371868.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Pyrus 
x bretschneideri]
Length=1293

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL+
Sbjct  1210  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNLQ  1259



>ref|XP_008346508.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Malus domestica]
Length=1282

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1201  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1249



>ref|XP_008346509.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Malus domestica]
Length=1281

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1200  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1248



>ref|XP_008346507.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Malus domestica]
Length=1283

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1202  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1250



>ref|XP_008375865.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Malus domestica]
Length=1271

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1197  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1245



>ref|XP_008375867.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X5 [Malus domestica]
Length=1115

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1041  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1089



>ref|XP_008375866.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X4 [Malus domestica]
Length=1270

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1196  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1244



>ref|XP_008375864.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Malus domestica]
Length=1272

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1198  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1246



>ref|XP_008375863.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Malus domestica]
Length=1273

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + D+ASQNH+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1199  QVGFNDPSQDEASQNHYGVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1247



>ref|XP_004300289.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Fragaria 
vesca subsp. vesca]
Length=1277

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q GYN+ + DD SQNH+G+ NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1206  QVGYNDPSQDDGSQNHYGVGNANALQSQGYMNSLYSQPFTHYNTQPMNL  1254



>ref|XP_009398574.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1269

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QAG+N+ + D++SQ+HFGM   S+L SQ +LNPLYSQPF HYN+QP NL+
Sbjct  1202  QAGFNDPSQDESSQSHFGMGGPSSLQSQALLNPLYSQPFAHYNAQPQNLQ  1251



>ref|XP_009398575.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1268

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QAG+N+ + D++SQ+HFGM   S+L SQ +LNPLYSQPF HYN+QP NL+
Sbjct  1201  QAGFNDPSQDESSQSHFGMGGPSSLQSQALLNPLYSQPFAHYNAQPQNLQ  1250



>ref|XP_009792531.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nicotiana 
sylvestris]
Length=1272

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAGYN  + DD  QNHFGMSNAS L SQ  LNPLYSQPF HYN+QP N+
Sbjct  1202  QAGYNNPSQDDGPQNHFGMSNAS-LQSQSSLNPLYSQPFAHYNTQPFNM  1249



>gb|KJB25396.1| hypothetical protein B456_004G189700 [Gossypium raimondii]
Length=1263

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DDASQ+HFG +N + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1192  QAGFNDPSQDDASQSHFGAANPNQLQSQGLMNSLYSQPFAHYNTQPLNL  1240



>gb|KJB25397.1| hypothetical protein B456_004G189700 [Gossypium raimondii]
Length=1192

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DDASQ+HFG +N + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1121  QAGFNDPSQDDASQSHFGAANPNQLQSQGLMNSLYSQPFAHYNTQPLNL  1169



>gb|KHF99302.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1262

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DDASQ+HFG +N + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1191  QAGFNDPSQDDASQSHFGAANPNQLQSQGLMNSLYSQPFAHYNTQPLNL  1239



>ref|XP_006385597.1| RNA helicase family protein [Populus trichocarpa]
 gb|ERP63394.1| RNA helicase family protein [Populus trichocarpa]
Length=1242

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q GYN+ + DDASQ+HFG++N + L SQG++N LYSQPFGHYN+Q +NL
Sbjct  1172  QVGYNDPSQDDASQSHFGIANPNQLQSQGLMNSLYSQPFGHYNTQQLNL  1220



>ref|XP_006368472.1| RNA helicase family protein [Populus trichocarpa]
 gb|ERP65041.1| RNA helicase family protein [Populus trichocarpa]
Length=1256

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQ+HFG++N + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1186  QVGFNDPSQDDASQSHFGIANPNQLQSQGLMNSLYSQPFAHYNTQPVNL  1234



>ref|XP_002528794.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis]
 gb|EEF33616.1| nonsense-mediated mRNA decay protein, putative [Ricinus communis]
Length=1280

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DD SQNHFG++N + L SQG++N LYSQPF HYN+QP+N+
Sbjct  1211  QIGFNDASQDDVSQNHFGIANPNPLQSQGLMNSLYSQPFAHYNTQPLNM  1259



>gb|EYU17850.1| hypothetical protein MIMGU_mgv1a000580mg [Erythranthe guttata]
Length=1060

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 3/50 (6%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QA YN+ + DDASQNHFG   AS L SQ +LNPLYSQPF HYNSQP+N++
Sbjct  994   QAPYNDQSQDDASQNHFG---ASQLQSQSLLNPLYSQPFAHYNSQPINVQ  1040



>gb|ABK96558.1| unknown [Populus trichocarpa x Populus deltoides]
Length=582

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
            Q G+N+ + DDASQ+HFG++N + L SQG++N LYSQPF HYN+QP+NL
Sbjct  512  QVGFNDPSQDDASQSHFGITNPNQLQSQGLMNSLYSQPFAHYNTQPVNL  560



>ref|XP_006858514.1| hypothetical protein AMTR_s00071p00142490 [Amborella trichopoda]
 gb|ERN19981.1| hypothetical protein AMTR_s00071p00142490 [Amborella trichopoda]
Length=1252

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + DD+SQ HFGM+    L SQG++NPLYSQPF  YN+QP+N++
Sbjct  1185  QVGFNDPSQDDSSQTHFGMAGPGPLQSQGVMNPLYSQPFTQYNTQPLNMQ  1234



>gb|EYU33046.1| hypothetical protein MIMGU_mgv1a000320mg [Erythranthe guttata]
Length=1260

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 3/50 (6%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QA YN+ + DDASQNHFG   AS L SQ +LNPLYSQPF HYNSQP+N++
Sbjct  1194  QAPYNDQSQDDASQNHFG---ASQLQSQSLLNPLYSQPFAHYNSQPINVQ  1240



>gb|KJB21033.1| hypothetical protein B456_003G179500 [Gossypium raimondii]
Length=1262

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+N+ + DDASQ+HFG+SN + L SQG++N LYSQ F HYN+QP+NL
Sbjct  1192  QAGFNDPSHDDASQSHFGVSNPNQLQSQGLMNSLYSQSFSHYNTQPLNL  1240



>ref|XP_011018658.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Populus 
euphratica]
Length=1266

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQ+HFG++  + L SQG++N LYSQPF HYN+QP+NL
Sbjct  1196  QVGFNDPSQDDASQSHFGITTPNQLQSQGLMNSLYSQPFAHYNTQPVNL  1244



>ref|XP_010664057.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Vitis vinifera]
Length=1272

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 5/54 (9%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQ-----GILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQ+HFG++N + L SQ     G++NPLYSQPF HYN+QP+NL
Sbjct  1189  QVGFNDPSQDDASQSHFGVANPNPLQSQVPDLQGLMNPLYSQPFAHYNTQPLNL  1242



>gb|KDP45961.1| hypothetical protein JCGZ_11864 [Jatropha curcas]
Length=1270

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + D++SQ+HFG++N + L SQG++N LYSQPF HYN+QP+NL+
Sbjct  1201  QIGFNDPSQDESSQSHFGIANPNPLQSQGLMNSLYSQPFAHYNTQPLNLQ  1250



>ref|XP_008784706.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Phoenix 
dactylifera]
Length=1262

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QAG N+ + D++SQ+HF M+    L SQG++NPLYSQPF HYN+QP NL+
Sbjct  1195  QAGINDPSQDESSQSHFSMTGPGPLQSQGLMNPLYSQPFAHYNTQPQNLQ  1244



>ref|XP_010919834.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Elaeis 
guineensis]
Length=1263

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QAG N+ + D++SQ+HF M+    L SQG++NPLYSQPF HYN+QP NL+
Sbjct  1196  QAGLNDPSQDESSQSHFSMTGPGPLQSQGLMNPLYSQPFTHYNTQPQNLQ  1245



>ref|XP_010110516.1| Regulator of nonsense transcripts 1-like protein [Morus notabilis]
 gb|EXC26734.1| Regulator of nonsense transcripts 1-like protein [Morus notabilis]
Length=1267

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q   N+ + DDASQ+H+G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1197  QVCMNDPSQDDASQSHYGVANANQLQSQGFMNSLYSQPFTHYNTQPMNL  1245



>ref|XP_011032015.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Populus 
euphratica]
Length=1265

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DDASQ+ FG++N + L SQG++N LYSQPFGHYN+Q +NL
Sbjct  1195  QVGFNDPSQDDASQSQFGIANPNQLQSQGLMNSLYSQPFGHYNTQQLNL  1243



>ref|XP_007039605.1| Regulator of nonsense transcripts 1 [Theobroma cacao]
 gb|EOY24106.1| Regulator of nonsense transcripts 1 [Theobroma cacao]
Length=1266

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQP  627
             Q G+N+ + DDASQ+HFG++N + L SQG++N LYSQPF HYN+QP
Sbjct  1195  QVGFNDPSQDDASQSHFGVANPNQLQSQGLMNSLYSQPFAHYNTQP  1240



>ref|XP_010269894.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Nelumbo 
nucifera]
Length=1274

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+N+ + +D SQ HFG+   + L SQG++NPLYSQPF  YN+QP+NL+
Sbjct  1198  QVGFNDPSQEDTSQAHFGVGGPNPLQSQGLMNPLYSQPFTQYNTQPLNLQ  1247



>ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Cucumis sativus]
Length=1246

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++ ++D+ASQ+H+ ++NA+ L SQG++N LYSQPF HYN+QP  L
Sbjct  1175  QVGFSDPSLDEASQSHYNVTNANPLQSQGMMNSLYSQPFAHYNTQPSTL  1223



>ref|XP_008448746.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Cucumis melo]
Length=1268

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++ ++D+ASQ+H+ ++NA+ L SQG++N LYSQPF HYN+QP  L
Sbjct  1197  QVGFSDPSLDEASQSHYNVTNANPLQSQGMMNSLYSQPFAHYNTQPSTL  1245



>ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis 
sativus]
Length=1268

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++ ++D+ASQ+H+ ++NA+ L SQG++N LYSQPF HYN+QP  L
Sbjct  1197  QVGFSDPSLDEASQSHYNVTNANPLQSQGMMNSLYSQPFAHYNTQPSTL  1245



>ref|XP_008651597.1| PREDICTED: uncharacterized protein LOC100304236 isoform X4 [Zea 
mays]
 tpg|DAA62799.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1251

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q GYN+ + D++SQ H+GM+ A  LHSQ ++NPLYSQ + HYN+QP +L+
Sbjct  1198  QVGYNDPSQDESSQIHYGMAAAGPLHSQSMMNPLYSQSYAHYNTQPHSLQ  1247



>ref|XP_008651596.1| PREDICTED: uncharacterized protein LOC100304236 isoform X3 [Zea 
mays]
Length=1252

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q GYN+ + D++SQ H+GM+ A  LHSQ ++NPLYSQ + HYN+QP +L+
Sbjct  1199  QVGYNDPSQDESSQIHYGMAAAGPLHSQSMMNPLYSQSYAHYNTQPHSLQ  1248



>ref|XP_008651595.1| PREDICTED: uncharacterized protein LOC100304236 isoform X2 [Zea 
mays]
 tpg|DAA62797.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1272

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q GYN+ + D++SQ H+GM+ A  LHSQ ++NPLYSQ + HYN+QP +L+
Sbjct  1219  QVGYNDPSQDESSQIHYGMAAAGPLHSQSMMNPLYSQSYAHYNTQPHSLQ  1268



>ref|XP_008651594.1| PREDICTED: uncharacterized protein LOC100304236 isoform X1 [Zea 
mays]
 tpg|DAA62796.1| TPA: hypothetical protein ZEAMMB73_068361 [Zea mays]
Length=1273

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q GYN+ + D++SQ H+GM+ A  LHSQ ++NPLYSQ + HYN+QP +L+
Sbjct  1220  QVGYNDPSQDESSQIHYGMAAAGPLHSQSMMNPLYSQSYAHYNTQPHSLQ  1269



>ref|NP_001159153.1| uncharacterized protein LOC100304236 [Zea mays]
 gb|ACN25242.1| unknown [Zea mays]
Length=252

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
            Q GYN+ + D++SQ H+GM+ A  LHSQ ++NPLYSQ + HYN+QP +L+
Sbjct  199  QVGYNDPSQDESSQIHYGMAAAGPLHSQSMMNPLYSQSYAHYNTQPHSLQ  248



>ref|XP_010530003.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Tarenaya hassleriana]
Length=1258

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  +N +G++N S L +QG+ N LYSQPF HYN+QP+NL
Sbjct  1189  QAGFTDPSQDDGQKNQYGVNNPSHLQAQGLPNSLYSQPFSHYNTQPLNL  1237



>ref|XP_010530005.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Tarenaya hassleriana]
Length=1251

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  +N +G++N S L +QG+ N LYSQPF HYN+QP+NL
Sbjct  1182  QAGFTDPSQDDGQKNQYGVNNPSHLQAQGLPNSLYSQPFSHYNTQPLNL  1230



>ref|XP_010530004.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Tarenaya hassleriana]
Length=1254

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  +N +G++N S L +QG+ N LYSQPF HYN+QP+NL
Sbjct  1185  QAGFTDPSQDDGQKNQYGVNNPSHLQAQGLPNSLYSQPFSHYNTQPLNL  1233



>ref|XP_010933539.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
1 homolog [Elaeis guineensis]
Length=1267

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             QAG+N+ + D++SQ+HF M+  + + SQG++N LYSQPF HYN+QP NL+
Sbjct  1201  QAGFNDPSQDESSQSHFSMAGPA-IQSQGLMNSLYSQPFTHYNAQPQNLQ  1249



>ref|XP_004511759.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Cicer arietinum]
Length=1259

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++   DDA+QNHF ++NA+ L SQ  +N LYSQPF HYN+QP+N+
Sbjct  1192  QVGFSDPLQDDATQNHFNVANANPLQSQ--MNSLYSQPFAHYNTQPLNM  1238



>ref|XP_009397656.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=1268

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAG+N  + D++SQ+HF M+   +L SQG LNPLYSQPF HYN+
Sbjct  1201  QAGFNGPSQDESSQSHFSMAGTGSLQSQGPLNPLYSQPFAHYNA  1244



>ref|XP_010518678.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Tarenaya hassleriana]
Length=1246

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+   + D+  QN +G+SN S L SQG+LN LYSQPF HY   P+NL
Sbjct  1177  QAGFPNASQDNVQQNQYGVSNPSHLQSQGVLNSLYSQPFSHYKMHPLNL  1225



>gb|KJB37673.1| hypothetical protein B456_006G215300 [Gossypium raimondii]
Length=1106

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+++ + DDAS++HFG+ N + L SQG LN LYSQPF  +N QP+NL+
Sbjct  1041  QVGFSDPSQDDASRSHFGV-NPNQLQSQGFLNSLYSQPFAQFNKQPLNLQ  1089



>gb|KJB37672.1| hypothetical protein B456_006G215300 [Gossypium raimondii]
Length=1251

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+++ + DDAS++HFG+ N + L SQG LN LYSQPF  +N QP+NL+
Sbjct  1186  QVGFSDPSQDDASRSHFGV-NPNQLQSQGFLNSLYSQPFAQFNKQPLNLQ  1234



>ref|XP_010518677.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Tarenaya hassleriana]
Length=1249

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+   + D+  QN +G+SN S L SQG+LN LYSQPF HY   P+NL
Sbjct  1180  QAGFPNASQDNVQQNQYGVSNPSHLQSQGVLNSLYSQPFSHYKMHPLNL  1228



>gb|KGN55800.1| hypothetical protein Csa_3G016940 [Cucumis sativus]
Length=1269

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQ-GILNPLYSQPFGHYNSQPMNL  618
             Q G+++ ++D+ASQ+H+ ++NA+ L SQ G++N LYSQPF HYN+QP  L
Sbjct  1197  QVGFSDPSLDEASQSHYNVTNANPLQSQQGMMNSLYSQPFAHYNTQPSTL  1246



>ref|XP_010055383.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Eucalyptus 
grandis]
 gb|KCW71841.1| hypothetical protein EUGRSUZ_E00323 [Eucalyptus grandis]
Length=1269

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G++E + DD SQ+HFGMS  S L +QG++N LYSQPF  Y  QP+NL
Sbjct  1200  QVGFSEPSQDDPSQSHFGMS--SQLQTQGLMNSLYSQPFTQYGMQPLNL  1246



>ref|XP_007156615.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
 gb|ESW28609.1| hypothetical protein PHAVU_002G003300g [Phaseolus vulgaris]
Length=1268

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPM  624
             Q G+N+   DD++Q+HFG++NA+ L SQ  +N LYSQPF HYN+QP+
Sbjct  1201  QVGFNDPLQDDSTQSHFGVANANPLQSQ--MNSLYSQPFAHYNTQPL  1245



>ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula]
 gb|AES94382.1| regulator of nonsense transcripts protein [Medicago truncatula]
Length=1253

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++   DDA+QNHF ++N++ L SQ  +N LYSQPF HYN+QP+N+
Sbjct  1186  QVGFSDPLQDDATQNHFNVANSNPLQSQ--MNSLYSQPFAHYNTQPLNM  1232



>gb|KHN34876.1| Regulator of nonsense transcripts 1 like [Glycine soja]
Length=1158

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++   DDA+Q+HF ++NA+ L SQ  +N LYSQPF HYN+QP+N+
Sbjct  1091  QVGFSDPLQDDATQSHFSVANANPLQSQ--MNSLYSQPFAHYNTQPLNM  1137



>ref|XP_008668400.1| PREDICTED: uncharacterized protein LOC100383288 isoform X2 [Zea 
mays]
Length=1273

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + D++SQ H+GM+ A  L SQG++NPLYSQ + HYN+
Sbjct  1220  QAGYNDPSQDESSQIHYGMAAAGPLQSQGMMNPLYSQSYAHYNT  1263



>ref|XP_008668399.1| PREDICTED: uncharacterized protein LOC100383288 isoform X1 [Zea 
mays]
Length=1274

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + D++SQ H+GM+ A  L SQG++NPLYSQ + HYN+
Sbjct  1221  QAGYNDPSQDESSQIHYGMAAAGPLQSQGMMNPLYSQSYAHYNT  1264



>ref|XP_006590595.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine 
max]
Length=1268

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+++   DDA+Q+HF ++NA+ L SQ  +N LYSQPF HYN+QP+N+
Sbjct  1201  QVGFSDPLQDDATQSHFSVANANPLQSQ--MNSLYSQPFAHYNTQPLNM  1247



>ref|XP_010481386.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Camelina 
sativa]
Length=1248

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN FG++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1180  QAGFIDTSQDDGQQNPFGVNNPN-LQSQGLPNSLYSQPFSHYNTQPLNL  1227



>ref|XP_010494909.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Camelina 
sativa]
Length=1248

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN FG++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1180  QAGFIDTSQDDGQQNPFGVNNPN-LQSQGLPNSLYSQPFSHYNTQPLNL  1227



>ref|NP_001169419.1| uncharacterized protein LOC100383288 [Zea mays]
 gb|ACN33707.1| unknown [Zea mays]
Length=252

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
            QAGYN+ + D++SQ H+GM+ A  L SQG++NPLYSQ + HYN+
Sbjct  199  QAGYNDPSQDESSQIHYGMAAAGPLQSQGMMNPLYSQSYAHYNT  242



>ref|XP_002460731.1| hypothetical protein SORBIDRAFT_02g033940 [Sorghum bicolor]
 gb|EER97252.1| hypothetical protein SORBIDRAFT_02g033940 [Sorghum bicolor]
Length=1269

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + DD+SQ H+GM+ A  L SQ ++NPLYSQ + HYN+
Sbjct  1216  QAGYNDPSQDDSSQIHYGMAAAGPLQSQSMMNPLYSQSYAHYNT  1259



>tpg|DAA40911.1| TPA: hypothetical protein ZEAMMB73_425956 [Zea mays]
Length=395

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  764  QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
            QAGYN+ + D++SQ H+GM+ A  L SQG++NPLYSQ + HYN+
Sbjct  342  QAGYNDPSQDESSQIHYGMAAAGPLQSQGMMNPLYSQSYAHYNT  385



>gb|KFK31413.1| hypothetical protein AALP_AA6G108800 [Arabis alpina]
Length=1247

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN FG++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1179  QAGFIDSSQDDGQQNPFGVNNPN-LQSQGLPNSLYSQPFSHYNAQPLNL  1226



>ref|XP_004957770.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Setaria 
italica]
Length=1277

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + D++SQ H+GM++A  L SQ ++NPLYSQ + HYN+
Sbjct  1224  QAGYNDPSQDESSQMHYGMASAGPLQSQSMMNPLYSQSYAHYNT  1267



>ref|XP_009341225.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=1264

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q  + ++  +D SQ+  G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1195  QGLFTQVGFNDPSQD--GVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1241



>ref|XP_009341224.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=1266

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q  + ++  +D SQ+  G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1197  QGLFTQVGFNDPSQD--GVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1243



>ref|XP_009341223.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=1267

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q  + ++  +D SQ+  G++NA+ L SQG +N LYSQPF HYN+QPMNL
Sbjct  1198  QGLFTQVGFNDPSQD--GVANANQLQSQGFMNSLYSQPFAHYNTQPMNL  1244



>ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine 
max]
Length=1266

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+ +   DDA+Q+HF ++NA+ L SQ  ++ LYSQPF HYN+QP+N+
Sbjct  1199  QVGFTDPLQDDATQSHFSVANANPLQSQ--MSSLYSQPFAHYNTQPLNM  1245



>dbj|BAB10240.1| prematurely terminated mRNA decay factor-like protein [Arabidopsis 
thaliana]
Length=1235

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN +G++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1167  QAGFIDSSQDDGQQNPYGVNNPN-LQSQGLPNSLYSQPFAHYNTQPLNL  1214



>ref|NP_199512.2| Regulator of nonsense transcripts 1-like protein [Arabidopsis 
thaliana]
 sp|Q9FJR0.2|RENT1_ARATH RecName: Full=Regulator of nonsense transcripts 1 homolog; AltName: 
Full=ATP-dependent helicase UPF1 [Arabidopsis thaliana]
 gb|AED95457.1| Regulator of nonsense transcripts 1-like protein [Arabidopsis 
thaliana]
Length=1254

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN +G++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1186  QAGFIDSSQDDGQQNPYGVNNPN-LQSQGLPNSLYSQPFAHYNTQPLNL  1233



>gb|AAL92018.1| UPF1 [Arabidopsis thaliana]
Length=1243

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN +G++N + L SQG+ N LYSQPF HYN+QP+NL
Sbjct  1175  QAGFIDSSQDDGQQNPYGVNNPN-LQSQGLPNSLYSQPFAHYNTQPLNL  1222



>ref|XP_006658577.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Oryza 
brachyantha]
Length=1174

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + D++SQ HFGM+    L SQ ++NPLYSQ + HYN+
Sbjct  1121  QAGYNDPSQDESSQMHFGMAGPGPLQSQAMMNPLYSQSYAHYNT  1164



>ref|XP_010274587.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform 
X1 [Nelumbo nucifera]
Length=1259

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             Q G+N+ + DD SQ HF +   + L SQ ++NPLYSQ F  YN+QP++L
Sbjct  1191  QVGFNDPSQDDTSQAHFSVGAPNPLQSQDMMNPLYSQSFTQYNTQPLSL  1239



>gb|KHG01127.1| Regulator of nonsense transcripts 1 -like protein [Gossypium 
arboreum]
Length=1215

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNLE  615
             Q G+++ + DDASQ+H G+ N + L SQG +N LYSQP   +N QP+NL+
Sbjct  1145  QVGFSDPSQDDASQSHCGV-NPNQLQSQGFMNSLYSQPLAQFNKQPLNLQ  1193



>ref|XP_006282104.1| hypothetical protein CARUB_v10028351mg [Capsella rubella]
 gb|EOA15002.1| hypothetical protein CARUB_v10028351mg [Capsella rubella]
Length=1252

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNSQPMNL  618
             QAG+ + + DD  QN F ++N + L SQG  N LYSQPF HYN+QP+NL
Sbjct  1184  QAGFIDSSQDDGQQNPFVVNNPN-LQSQGPPNSLYSQPFSHYNTQPLNL  1231



>ref|XP_003563076.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Brachypodium 
distachyon]
Length=1267

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  764   QAGYNELAIDDASQNHFGMSNASTLHSQGILNPLYSQPFGHYNS  633
             QAGYN+ + D++SQ H+GM     L SQ ++NP+YSQ + HYN+
Sbjct  1214  QAGYNDPSQDESSQMHYGMGAPGHLQSQSMMNPMYSQSYAHYNT  1257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890