BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014O14

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610506.1|  PREDICTED: uncharacterized protein LOC104104...    345   1e-113   Nicotiana tomentosiformis
ref|XP_009765278.1|  PREDICTED: uncharacterized protein LOC104216...    338   4e-111   Nicotiana sylvestris
ref|XP_006351348.1|  PREDICTED: uncharacterized protein LOC102597...    336   2e-110   Solanum tuberosum [potatoes]
ref|XP_006351347.1|  PREDICTED: uncharacterized protein LOC102597...    336   4e-110   Solanum tuberosum [potatoes]
ref|XP_011075114.1|  PREDICTED: uncharacterized protein LOC105159...    331   4e-109   Sesamum indicum [beniseed]
ref|XP_004249287.1|  PREDICTED: uncharacterized protein LOC101263558    333   1e-108   
ref|XP_002276838.1|  PREDICTED: uncharacterized protein LOC100262520    322   3e-105   Vitis vinifera
emb|CBI29160.3|  unnamed protein product                                322   6e-105   Vitis vinifera
gb|EYU39947.1|  hypothetical protein MIMGU_mgv1a009191mg                315   5e-103   Erythranthe guttata [common monkey flower]
ref|XP_006432513.1|  hypothetical protein CICLE_v10001427mg             316   1e-102   Citrus clementina [clementine]
gb|KDO48656.1|  hypothetical protein CISIN_1g0162581mg                  309   1e-102   Citrus sinensis [apfelsine]
emb|CDP10151.1|  unnamed protein product                                312   2e-101   Coffea canephora [robusta coffee]
gb|KHN26422.1|  Polycomb complex protein BMI-1                          310   7e-101   Glycine soja [wild soybean]
ref|XP_003527531.1|  PREDICTED: uncharacterized protein LOC100813844    310   8e-101   Glycine max [soybeans]
ref|XP_007148770.1|  hypothetical protein PHAVU_005G012800g             309   2e-100   Phaseolus vulgaris [French bean]
gb|KHN45782.1|  Polycomb complex protein BMI-1-B                        308   2e-100   Glycine soja [wild soybean]
ref|XP_003522869.1|  PREDICTED: uncharacterized protein LOC100813...    308   5e-100   Glycine max [soybeans]
gb|KDP40599.1|  hypothetical protein JCGZ_24598                         307   4e-99    Jatropha curcas
ref|XP_008231724.1|  PREDICTED: uncharacterized protein LOC103330891    300   3e-97    Prunus mume [ume]
gb|KEH32917.1|  zinc ion-binding protein, putative                      301   3e-97    Medicago truncatula
gb|KEH32916.1|  zinc ion-binding protein, putative                      300   8e-97    Medicago truncatula
ref|XP_002297702.1|  hypothetical protein POPTR_0001s07350g             300   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_002304823.2|  hypothetical protein POPTR_0003s18860g             299   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_007218231.1|  hypothetical protein PRUPE_ppa007956mg             298   2e-96    Prunus persica
ref|XP_004516522.1|  PREDICTED: uncharacterized protein LOC101498396    299   2e-96    Cicer arietinum [garbanzo]
gb|ABK96344.1|  unknown                                                 298   3e-96    Populus trichocarpa x Populus deltoides
gb|KJB67761.1|  hypothetical protein B456_010G208800                    298   5e-96    Gossypium raimondii
ref|XP_008375385.1|  PREDICTED: uncharacterized protein LOC103438629    298   5e-96    
gb|KHF99857.1|  E3 ubiquitin-protein ligase CHFR                        298   6e-96    Gossypium arboreum [tree cotton]
ref|XP_007010628.1|  Zinc ion binding                                   297   8e-96    
ref|XP_010067651.1|  PREDICTED: uncharacterized protein LOC104454492    296   2e-95    Eucalyptus grandis [rose gum]
ref|XP_011034631.1|  PREDICTED: uncharacterized protein LOC105132695    296   3e-95    Populus euphratica
ref|XP_009420238.1|  PREDICTED: uncharacterized protein LOC104000028    294   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004306461.1|  PREDICTED: uncharacterized protein LOC101299030    292   3e-94    Fragaria vesca subsp. vesca
ref|XP_002525579.1|  ubiquitin-protein ligase, putative                 293   7e-94    Ricinus communis
ref|XP_011020515.1|  PREDICTED: uncharacterized protein LOC105122866    291   3e-93    Populus euphratica
ref|XP_008793368.1|  PREDICTED: uncharacterized protein LOC103709685    291   4e-93    
gb|KDO48657.1|  hypothetical protein CISIN_1g0162581mg                  284   8e-93    Citrus sinensis [apfelsine]
gb|KDO48654.1|  hypothetical protein CISIN_1g0162581mg                  283   1e-92    Citrus sinensis [apfelsine]
ref|XP_010276468.1|  PREDICTED: uncharacterized protein LOC104611195    288   4e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010554493.1|  PREDICTED: uncharacterized protein LOC104824200    288   4e-92    Tarenaya hassleriana [spider flower]
gb|EPS69962.1|  hypothetical protein M569_04796                         285   2e-91    Genlisea aurea
ref|XP_006403583.1|  hypothetical protein EUTSA_v10010421mg             288   2e-91    Eutrema salsugineum [saltwater cress]
ref|XP_010515962.1|  PREDICTED: uncharacterized protein LOC104791708    286   8e-91    Camelina sativa [gold-of-pleasure]
dbj|BAH20367.1|  AT3G54360                                              281   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877973.1|  binding protein                                    285   3e-90    
ref|XP_010504239.1|  PREDICTED: uncharacterized protein LOC104781301    285   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010427133.1|  PREDICTED: uncharacterized protein LOC104712035    285   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010533372.1|  PREDICTED: uncharacterized protein LOC104809184    282   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_010091318.1|  E3 ubiquitin-protein ligase CHFR                   284   1e-89    
ref|XP_010921286.1|  PREDICTED: uncharacterized protein LOC105044901    282   1e-89    Elaeis guineensis
ref|NP_191004.1|  zinc ion binding protein                              281   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KCW65831.1|  hypothetical protein EUGRSUZ_G03178                     281   6e-89    Eucalyptus grandis [rose gum]
ref|XP_010938114.1|  PREDICTED: uncharacterized protein LOC105057...    280   2e-88    
ref|XP_010938116.1|  PREDICTED: uncharacterized protein LOC105057...    279   3e-88    
ref|XP_006291209.1|  hypothetical protein CARUB_v10017338mg             279   7e-88    Capsella rubella
ref|XP_010689828.1|  PREDICTED: uncharacterized protein LOC104903488    276   2e-87    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX73486.1|  BnaC08g25170D                                          277   3e-87    
ref|XP_008782756.1|  PREDICTED: uncharacterized protein LOC103702200    277   4e-87    Phoenix dactylifera
emb|CDX67597.1|  BnaA07g16370D                                          276   5e-87    
ref|XP_009103916.1|  PREDICTED: uncharacterized protein LOC103829975    276   5e-87    Brassica rapa
emb|CDX78232.1|  BnaA09g34270D                                          276   7e-87    
dbj|BAJ90412.1|  predicted protein                                      274   1e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009116123.1|  PREDICTED: uncharacterized protein LOC103841350    274   4e-86    Brassica rapa
ref|NP_001048384.1|  Os02g0795300                                       272   5e-86    
ref|NP_001041762.2|  Os01g0104100                                       272   6e-86    
gb|EEC69773.1|  hypothetical protein OsI_00037                          273   2e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_006643640.1|  PREDICTED: uncharacterized protein LOC102704921    270   2e-85    Oryza brachyantha
emb|CDY07544.1|  BnaC06g15200D                                          268   3e-85    Brassica napus [oilseed rape]
ref|XP_004147090.1|  PREDICTED: uncharacterized protein LOC101210945    270   9e-85    Cucumis sativus [cucumbers]
ref|NP_001140913.1|  LOC100272990                                       270   1e-84    Zea mays [maize]
dbj|BAJ86803.1|  predicted protein                                      269   1e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004967927.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    268   3e-84    Setaria italica
ref|XP_002444897.1|  hypothetical protein SORBIDRAFT_07g001060          268   3e-84    Sorghum bicolor [broomcorn]
emb|CDM81302.1|  unnamed protein product                                267   7e-84    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008445920.1|  PREDICTED: uncharacterized protein LOC103488802    268   1e-83    Cucumis melo [Oriental melon]
ref|XP_004978719.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    265   2e-83    Setaria italica
gb|EEC74169.1|  hypothetical protein OsI_09273                          272   1e-82    Oryza sativa Indica Group [Indian rice]
gb|EMS59099.1|  E3 ubiquitin-protein ligase CHFR                        268   4e-82    Triticum urartu
ref|XP_003563481.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR-...    262   7e-82    Brachypodium distachyon [annual false brome]
ref|XP_003559441.1|  PREDICTED: uncharacterized protein LOC100832811    258   2e-80    Brachypodium distachyon [annual false brome]
gb|EMT10100.1|  E3 ubiquitin-protein ligase CHFR                        254   9e-77    
ref|XP_009610509.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    241   5e-74    Nicotiana tomentosiformis
ref|XP_009765281.1|  PREDICTED: E3 ubiquitin-protein ligase CHFR ...    238   8e-73    Nicotiana sylvestris
ref|XP_011075118.1|  PREDICTED: uncharacterized protein LOC105159...    236   2e-72    Sesamum indicum [beniseed]
gb|ACG25350.1|  hypothetical protein                                    233   5e-71    Zea mays [maize]
gb|AFK44885.1|  unknown                                                 207   1e-63    Lotus japonicus
gb|KCW65832.1|  hypothetical protein EUGRSUZ_G03178                     210   1e-62    Eucalyptus grandis [rose gum]
gb|KJB73245.1|  hypothetical protein B456_011G224300                    208   1e-62    Gossypium raimondii
ref|XP_001754304.1|  predicted protein                                  206   3e-60    
ref|XP_002981629.1|  hypothetical protein SELMODRAFT_154638             177   2e-49    Selaginella moellendorffii
gb|KJB73244.1|  hypothetical protein B456_011G224300                    163   3e-45    Gossypium raimondii
ref|XP_010508043.1|  PREDICTED: uncharacterized protein LOC104784688    144   1e-39    
ref|XP_006829772.1|  hypothetical protein AMTR_s00119p00032590        89.7    3e-19    
ref|XP_006829771.1|  hypothetical protein AMTR_s00119p00030390        89.4    1e-17    
ref|XP_005647539.1|  hypothetical protein COCSUDRAFT_63384            80.1    4e-14    Coccomyxa subellipsoidea C-169
ref|XP_005844547.1|  hypothetical protein CHLNCDRAFT_58886            80.1    9e-14    Chlorella variabilis
gb|ACQ82653.1|  At3g54360-like protein                                70.5    1e-12    Solanum hirtum
ref|WP_020179497.1|  hypothetical protein                             67.4    2e-09    Methylopila sp. M107
ref|WP_015282261.1|  hypothetical protein                             63.2    5e-08    Thioflavicoccus mobilis
ref|WP_040555497.1|  hypothetical protein                             62.4    8e-08    
gb|EGM76114.1|  hypothetical protein Rhein_3833                       62.4    9e-08    Rheinheimera sp. A13L
ref|WP_035536799.1|  hypothetical protein                             60.8    4e-07    Hyphomonas oceanitis
ref|XP_002602756.1|  hypothetical protein BRAFLDRAFT_93702            60.8    4e-07    Branchiostoma floridae
ref|WP_040055500.1|  hypothetical protein                             58.9    4e-07    
gb|KDA03220.1|  SEFIR domain-containing protein                       60.5    4e-07    Hyphomonas oceanitis SCH89
gb|KFE68107.1|  TPR repeat protein                                    59.7    8e-07    Hyalangium minutum
ref|WP_035304088.1|  hypothetical protein                             58.9    1e-06    
ref|WP_018302711.1|  hypothetical protein                             58.5    2e-06    Wenxinia marina
ref|WP_034990952.1|  hypothetical protein                             58.2    2e-06    Beijerinckia mobilis
gb|ETK07947.1|  hypothetical protein T231_14820                       57.8    3e-06    Tannerella sp. oral taxon BU063 isolate Cell 6/7/9
ref|WP_034935348.1|  hypothetical protein                             56.2    3e-06    
ref|XP_002588168.1|  hypothetical protein BRAFLDRAFT_68806            57.8    4e-06    Branchiostoma floridae
ref|XP_002602188.1|  hypothetical protein BRAFLDRAFT_216744           55.8    4e-06    Branchiostoma floridae
ref|XP_002602191.1|  hypothetical protein BRAFLDRAFT_76878            57.4    5e-06    Branchiostoma floridae
ref|XP_002946777.1|  hypothetical protein VOLCADRAFT_87094            57.0    5e-06    Volvox carteri f. nagariensis
ref|WP_044189888.1|  hypothetical protein                             57.0    5e-06    
gb|EIC20019.1|  hypothetical protein Thi970DRAFT_03631                57.0    7e-06    Thiorhodovibrio sp. 970
ref|XP_002602757.1|  hypothetical protein BRAFLDRAFT_93703            57.0    7e-06    Branchiostoma floridae
gb|ETK04187.1|  hypothetical protein T229_10280                       56.6    9e-06    Tannerella sp. oral taxon BU063 isolate Cell 5
gb|EXI68493.1|  putative ATPase                                       56.2    1e-05    Candidatus Accumulibacter sp. SK-12
ref|XP_002602181.1|  hypothetical protein BRAFLDRAFT_76869            56.2    1e-05    Branchiostoma floridae
ref|XP_002602180.1|  hypothetical protein BRAFLDRAFT_76868            55.8    2e-05    Branchiostoma floridae
ref|XP_002602179.1|  hypothetical protein BRAFLDRAFT_76867            55.8    2e-05    Branchiostoma floridae
ref|WP_034393722.1|  hypothetical protein                             55.1    2e-05    Candidatus Microthrix parvicella
ref|WP_007820238.1|  hypothetical protein                             53.1    3e-05    
ref|XP_010456431.1|  PREDICTED: gibberellin 20 oxidase 3              54.3    4e-05    Camelina sativa [gold-of-pleasure]
ref|XP_002608109.1|  hypothetical protein BRAFLDRAFT_91413            54.7    4e-05    Branchiostoma floridae
ref|WP_000555981.1|  hypothetical protein                             54.3    5e-05    Vibrio cholerae
ref|WP_044283032.1|  hypothetical protein                             53.9    5e-05    
ref|XP_002602186.1|  hypothetical protein BRAFLDRAFT_121480           54.3    6e-05    Branchiostoma floridae
ref|XP_002591853.1|  hypothetical protein BRAFLDRAFT_125514           54.3    6e-05    Branchiostoma floridae
ref|XP_002589468.1|  hypothetical protein BRAFLDRAFT_80108            54.3    6e-05    Branchiostoma floridae
ref|XP_002588777.1|  hypothetical protein BRAFLDRAFT_89794            53.9    7e-05    Branchiostoma floridae
ref|WP_037485882.1|  hypothetical protein                             53.5    7e-05    
ref|WP_020179495.1|  hypothetical protein                             53.5    7e-05    Methylopila sp. M107
ref|XP_002602184.1|  hypothetical protein BRAFLDRAFT_76872            53.5    9e-05    Branchiostoma floridae
gb|KDB50423.1|  hypothetical protein X805_39860                       53.5    9e-05    Sphaerotilus natans subsp. natans DSM 6575
ref|WP_032479617.1|  hypothetical protein                             51.2    1e-04    
ref|XP_002611483.1|  hypothetical protein BRAFLDRAFT_63882            53.5    1e-04    Branchiostoma floridae
ref|XP_002610632.1|  hypothetical protein BRAFLDRAFT_65821            53.1    1e-04    Branchiostoma floridae
ref|WP_018283462.1|  hypothetical protein                             52.8    1e-04    
ref|WP_002029069.1|  TPR repeat family protein                        51.2    1e-04    
gb|EKM02271.1|  tetratricopeptide repeat family protein               52.4    1e-04    Vibrio cholerae HC-44C1
ref|XP_002611185.1|  hypothetical protein BRAFLDRAFT_88416            53.1    1e-04    Branchiostoma floridae
ref|WP_033929925.1|  hypothetical protein                             52.8    1e-04    
gb|KFE15678.1|  tetratricopeptide repeat family protein               52.8    2e-04    Vibrio cholerae
ref|WP_034995879.1|  hypothetical protein                             52.8    2e-04    
gb|EMP83509.1|  tetratricopeptide repeat family protein               52.4    2e-04    Vibrio cholerae O1 str. 116063
gb|EKL01521.1|  tetratricopeptide repeat family protein               52.4    2e-04    Vibrio cholerae HC-41B1
ref|WP_032483209.1|  hypothetical protein                             52.4    2e-04    
ref|WP_032483688.1|  hypothetical protein                             52.4    2e-04    
ref|WP_032482135.1|  hypothetical protein                             52.8    2e-04    Vibrio cholerae
ref|WP_032482486.1|  hypothetical protein                             52.4    2e-04    Vibrio cholerae
ref|WP_001908540.1|  hypothetical protein                             52.4    2e-04    
ref|XP_002585539.1|  hypothetical protein BRAFLDRAFT_111892           52.8    2e-04    Branchiostoma floridae
ref|XP_002599233.1|  hypothetical protein BRAFLDRAFT_64417            52.8    2e-04    Branchiostoma floridae
gb|KFE11407.1|  tetratricopeptide repeat family protein               51.6    2e-04    Vibrio cholerae
ref|WP_001973313.1|  tetratricopeptide repeat family protein          51.2    2e-04    
ref|WP_002006903.1|  hypothetical protein                             52.4    2e-04    
gb|EKL95138.1|  tetratricopeptide repeat family protein               52.4    2e-04    Vibrio cholerae HC-46B1
ref|XP_002602196.1|  hypothetical protein BRAFLDRAFT_76883            52.4    2e-04    Branchiostoma floridae
gb|KDC50150.1|  hypothetical protein DC53_13475                       52.4    2e-04    Pseudoalteromonas fuliginea
ref|WP_032471735.1|  hypothetical protein                             51.6    2e-04    
ref|WP_032481142.1|  hypothetical protein                             52.0    2e-04    
ref|WP_033030573.1|  hypothetical protein                             52.0    2e-04    
ref|XP_002611217.1|  hypothetical protein BRAFLDRAFT_71177            52.4    3e-04    Branchiostoma floridae
ref|XP_002609227.1|  hypothetical protein BRAFLDRAFT_90681            52.4    3e-04    Branchiostoma floridae
ref|WP_001937111.1|  hypothetical protein                             52.0    3e-04    
ref|WP_041702693.1|  hypothetical protein                             51.6    3e-04    
ref|XP_002591631.1|  hypothetical protein BRAFLDRAFT_80730            52.0    3e-04    Branchiostoma floridae
ref|XP_002608129.1|  hypothetical protein BRAFLDRAFT_91392            52.0    3e-04    Branchiostoma floridae
gb|EKM02159.1|  tetratricopeptide repeat family protein               51.2    4e-04    Vibrio cholerae HC-44C1
ref|XP_002603377.1|  hypothetical protein BRAFLDRAFT_80370            51.6    4e-04    Branchiostoma floridae
ref|WP_000322839.1|  hypothetical protein                             51.2    4e-04    
ref|XP_002591376.1|  hypothetical protein BRAFLDRAFT_93999            51.6    4e-04    Branchiostoma floridae
ref|XP_002589433.1|  hypothetical protein BRAFLDRAFT_80170            51.6    5e-04    Branchiostoma floridae
gb|ACE06324.1|  hypothetical protein Aasi_0966                        51.6    5e-04    Candidatus Amoebophilus asiaticus 5a2
gb|EAR87128.2|  tetratricopeptide repeat protein                      51.2    5e-04    Tetrahymena thermophila SB210
ref|XP_002602759.1|  hypothetical protein BRAFLDRAFT_93705            51.2    5e-04    Branchiostoma floridae
ref|XP_002602194.1|  hypothetical protein BRAFLDRAFT_76881            51.6    5e-04    Branchiostoma floridae
ref|XP_002604150.1|  hypothetical protein BRAFLDRAFT_71558            51.2    5e-04    Branchiostoma floridae
ref|XP_002602178.1|  hypothetical protein BRAFLDRAFT_76866            51.6    5e-04    Branchiostoma floridae
ref|XP_001007373.1|  TPR Domain containing protein                    51.2    5e-04    
ref|XP_002608130.1|  hypothetical protein BRAFLDRAFT_91391            51.2    5e-04    Branchiostoma floridae
ref|WP_032916713.1|  hypothetical protein                             51.2    5e-04    
ref|XP_002611437.1|  hypothetical protein BRAFLDRAFT_63931            51.2    6e-04    Branchiostoma floridae
gb|ACF45059.1|  SEFIR domain protein                                  51.2    7e-04    Pelodictyon phaeoclathratiforme BU-1
gb|ACF47388.1|  TPR repeat-containing protein                         50.8    7e-04    Prosthecochloris aestuarii DSM 271
ref|XP_002611187.1|  hypothetical protein BRAFLDRAFT_88414            50.8    8e-04    Branchiostoma floridae
ref|WP_032471704.1|  hypothetical protein                             50.1    0.001    Vibrio cholerae
ref|WP_032479475.1|  hypothetical protein                             50.1    0.001    Vibrio cholerae
ref|WP_032470287.1|  hypothetical protein                             50.1    0.001    Vibrio cholerae
ref|WP_023767457.1|  peptidase C14                                    50.4    0.001    Mesorhizobium sp. LNHC232B00



>ref|XP_009610506.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610507.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610508.1| PREDICTED: uncharacterized protein LOC104104198 isoform X1 [Nicotiana 
tomentosiformis]
Length=409

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N++SAKSRL++CA+DIR Q+ER+GNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  207  VQQAMRAFRAKNIDSAKSRLTMCADDIRGQLERLGNTSELCSQLGAVLGMLGDCCRATGD  266

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYYD+DL+AARS+YF+ALD+R
Sbjct  267  AASAVTYFEESVNFLVKVPKDDLEITHTLSVSLNKIGDLKYYDDDLEAARSHYFKALDVR  326

Query  414  RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLE  235
            RNAIKQ S PSQ IDVA SLAKVADVDRN+GNE  A+DGF+EAI+MLQ L+LNPEEV LE
Sbjct  327  RNAIKQQSAPSQIIDVATSLAKVADVDRNLGNEDAAIDGFEEAIKMLQSLELNPEEVSLE  386

Query  234  QRRLSVLEFLNSQLGKKETNSGS  166
            QRRLSVL+FLNSQ+ KK+  S +
Sbjct  387  QRRLSVLQFLNSQMEKKQAVSSA  409



>ref|XP_009765278.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765279.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765280.1| PREDICTED: uncharacterized protein LOC104216841 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRANN++SAKSRL++CA+DIR Q+ER+GNTSELCSQLG VLGMLGDCCRATGD
Sbjct  207  VQQAMRAFRANNIDSAKSRLTMCADDIRGQLERLGNTSELCSQLGVVLGMLGDCCRATGD  266

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYYD+DL+AARS+Y +ALD+R
Sbjct  267  AASAVIYFEESVNFLVKVPKDDLEITHTLSVSLNKIGDLKYYDDDLEAARSHYIKALDVR  326

Query  414  RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLE  235
            RNAIKQ S PSQ IDVA SLAKVADVDRN+GNE  A+DGF+EAI+MLQ L+LNPEE  LE
Sbjct  327  RNAIKQQSAPSQIIDVATSLAKVADVDRNLGNEDAAIDGFEEAIKMLQSLELNPEEASLE  386

Query  234  QRRLSVLEFLNSQLGKKETNSGS  166
            QRRLSVL+FLNSQ+  K+  S +
Sbjct  387  QRRLSVLQFLNSQMENKQPVSSA  409



>ref|XP_006351348.1| PREDICTED: uncharacterized protein LOC102597556 isoform X2 [Solanum 
tuberosum]
Length=400

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRANN++SAKSR ++CA+DIREQ++RMGNTSELCSQLGAVLGMLGDC RATGD
Sbjct  202  VQQAMRAFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLGAVLGMLGDCSRATGD  261

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESVNFLLKVPKDD+EITHTLSVSLNKIGDLKYY  DLQAARS+YF+ALD+R
Sbjct  262  AVSAVAYFEESVNFLLKVPKDDVEITHTLSVSLNKIGDLKYYAGDLQAARSHYFRALDVR  321

Query  414  RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLE  235
            RNAIKQ S PSQ +DVA+SLAKVAD+DRN+G+E TAV+GFQ+ I++LQ L+L PEEV LE
Sbjct  322  RNAIKQPSVPSQIVDVAISLAKVADIDRNLGDEDTAVEGFQKGIKLLQSLELKPEEVSLE  381

Query  234  QRRLSVLEFLNSQLGKKET  178
            QRRLSVLEFLNSQL KKET
Sbjct  382  QRRLSVLEFLNSQLEKKET  400



>ref|XP_006351347.1| PREDICTED: uncharacterized protein LOC102597556 isoform X1 [Solanum 
tuberosum]
Length=415

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRANN++SAKSR ++CA+DIREQ++RMGNTSELCSQLGAVLGMLGDC RATGD
Sbjct  217  VQQAMRAFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLGAVLGMLGDCSRATGD  276

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESVNFLLKVPKDD+EITHTLSVSLNKIGDLKYY  DLQAARS+YF+ALD+R
Sbjct  277  AVSAVAYFEESVNFLLKVPKDDVEITHTLSVSLNKIGDLKYYAGDLQAARSHYFRALDVR  336

Query  414  RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLE  235
            RNAIKQ S PSQ +DVA+SLAKVAD+DRN+G+E TAV+GFQ+ I++LQ L+L PEEV LE
Sbjct  337  RNAIKQPSVPSQIVDVAISLAKVADIDRNLGDEDTAVEGFQKGIKLLQSLELKPEEVSLE  396

Query  234  QRRLSVLEFLNSQLGKKET  178
            QRRLSVLEFLNSQL KKET
Sbjct  397  QRRLSVLEFLNSQLEKKET  415



>ref|XP_011075114.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075115.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075116.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
 ref|XP_011075117.1| PREDICTED: uncharacterized protein LOC105159671 isoform X1 [Sesamum 
indicum]
Length=353

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RANN+ESAKSR SICAED+REQ+E+MGNT ELCSQLGAVLGMLGDCCRATGD
Sbjct  156  MQQAMRALRANNIESAKSRFSICAEDVREQLEKMGNTPELCSQLGAVLGMLGDCCRATGD  215

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SA+ YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYY+ DLQA RSYYFQALD+R
Sbjct  216  ASSAISYFEESVNFLMKVPKDDLEITHTLSVSLNKIGDLKYYEGDLQATRSYYFQALDVR  275

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+  HS  PSQ IDVA+SLAKVADVDRN+GNE TA+ GFQ+AI++L+ L ++ E+ GL
Sbjct  276  RNAMNNHSSVPSQVIDVAISLAKVADVDRNLGNEDTAIAGFQDAIKLLESLTVSAEDAGL  335

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVLEF+NSQLGKK
Sbjct  336  EQRRLSVLEFVNSQLGKK  353



>ref|XP_004249287.1| PREDICTED: uncharacterized protein LOC101263558 [Solanum lycopersicum]
Length=443

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRANN++SAKSR ++CA+DIREQ++RMGNTSELCSQLGAVLGMLGDC RATGD
Sbjct  245  VQQAMRAFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLGAVLGMLGDCSRATGD  304

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESVNFLLKVPKDD+EITHTLSVSLNKIGDLKYY  DLQ ARS+YF+ALD+R
Sbjct  305  AVSAVAYFEESVNFLLKVPKDDVEITHTLSVSLNKIGDLKYYAGDLQTARSHYFRALDVR  364

Query  414  RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLE  235
            RNAIKQ S PSQ +DVA+SLAKVAD+DRN+G+E TAV+GFQE I++LQ L+L PEEV LE
Sbjct  365  RNAIKQQSVPSQVVDVAISLAKVADIDRNLGDEDTAVEGFQEGIKLLQSLELKPEEVSLE  424

Query  234  QRRLSVLEFLNSQLGKKET  178
            QRR SVLEFLNSQL K ET
Sbjct  425  QRRQSVLEFLNSQLEKNET  443



>ref|XP_002276838.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659029.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659030.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
 ref|XP_010659031.1| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]
Length=369

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V HAMRAFRANNVESAKSRLSICAEDIR Q+E++GNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  170  VQHAMRAFRANNVESAKSRLSICAEDIRGQLEKLGNTSELCSQLGAVLGMLGDCCRATGD  229

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV+FL K+P DDLEITHTLSVSLNKIGDLKYYD DL+AARSYY Q+LD+R
Sbjct  230  ADSAVTYFEESVDFLRKLPADDLEITHTLSVSLNKIGDLKYYDGDLEAARSYYSQSLDVR  289

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNAIK  S  PSQ +DVAVSLAKVADV+RN+GNE  A++GF+EAI++L+ L L+ EE GL
Sbjct  290  RNAIKDRSNVPSQILDVAVSLAKVADVNRNVGNEDVAINGFEEAIKLLESLTLSSEEAGL  349

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRRLSV+EFLN Q+ +K T
Sbjct  350  EQRRLSVMEFLNKQIAEKTT  369



>emb|CBI29160.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   322 bits (825),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 178/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V HAMRAFRANNVESAKSRLSICAEDIR Q+E++GNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  195  VQHAMRAFRANNVESAKSRLSICAEDIRGQLEKLGNTSELCSQLGAVLGMLGDCCRATGD  254

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV+FL K+P DDLEITHTLSVSLNKIGDLKYYD DL+AARSYY Q+LD+R
Sbjct  255  ADSAVTYFEESVDFLRKLPADDLEITHTLSVSLNKIGDLKYYDGDLEAARSYYSQSLDVR  314

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNAIK  S  PSQ +DVAVSLAKVADV+RN+GNE  A++GF+EAI++L+ L L+ EE GL
Sbjct  315  RNAIKDRSNVPSQILDVAVSLAKVADVNRNVGNEDVAINGFEEAIKLLESLTLSSEEAGL  374

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRRLSV+EFLN Q+ +K T
Sbjct  375  EQRRLSVMEFLNKQIAEKTT  394



>gb|EYU39947.1| hypothetical protein MIMGU_mgv1a009191mg [Erythranthe guttata]
Length=350

 Score =   315 bits (808),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RANN+ESAKSRLS+CAED+REQ+E  GNT ELCSQLGAV GMLGDCCR+TGD
Sbjct  153  MQQAMRALRANNIESAKSRLSVCAEDVREQLEMTGNTPELCSQLGAVFGMLGDCCRSTGD  212

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SA+ YFEESVNFL+K+PKDDLEITHTLSVSLNKIGDLKYY+ DL AARSYYFQALD+R
Sbjct  213  ASSAISYFEESVNFLMKLPKDDLEITHTLSVSLNKIGDLKYYEGDLSAARSYYFQALDVR  272

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNAI  HS  PSQ IDVA+SLAKVADVD+N+ NE  A   FQEAI++L+ L +  E+V L
Sbjct  273  RNAINHHSAVPSQVIDVAISLAKVADVDKNLENEDKATANFQEAIKLLESLTVKAEDVSL  332

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVLEFLNSQLGKK
Sbjct  333  EQRRLSVLEFLNSQLGKK  350



>ref|XP_006432513.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006432514.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 ref|XP_006471276.1| PREDICTED: uncharacterized protein LOC102626165 [Citrus sinensis]
 gb|ESR45753.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
 gb|ESR45754.1| hypothetical protein CICLE_v10001427mg [Citrus clementina]
Length=392

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+C EDIR+Q+ERMGNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  187  VQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGD  246

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A +AV YF +SV FL+K+P DDLEI HTLSVSLNKIGDLKYY  DLQAARSYY ++L++R
Sbjct  247  ADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVR  306

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K+HS  PSQ +DVAVSLAKVADVDR+IGNE  AVDGFQEAI+ L+ L L PEE GL
Sbjct  307  RDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKQLESLTLKPEEAGL  366

Query  237  EQRRLSVLEFLNSQLGKKETNS  172
            EQRRLSVLEFLN+QL +K   S
Sbjct  367  EQRRLSVLEFLNNQLSEKSPES  388



>gb|KDO48656.1| hypothetical protein CISIN_1g0162581mg, partial [Citrus sinensis]
Length=200

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -3

Query  756  AFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVK  577
            AFRA NVESAKSRLS+C EDIR+Q+ERMGNTSELCSQLGAVLGMLGDCCRA GDA +AV 
Sbjct  1    AFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVA  60

Query  576  YFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ  397
            YF +SV FL+K+P DDLEI HTLSVSLNKIGDLKYY  DLQAARSYY ++L++RR+A+K+
Sbjct  61   YFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKR  120

Query  396  HSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLS  220
            HS  PSQ +DVAVSLAKVADVDR+IGNE  AVDGFQEAI+ L+ L L PEE GLEQRRLS
Sbjct  121  HSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRRLS  180

Query  219  VLEFLNSQLGKKETNS  172
            VLEFLN+QL +K   S
Sbjct  181  VLEFLNNQLSEKPPES  196



>emb|CDP10151.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  A+RAFRANN+ESAKSRLS+CA+DIREQ++R+GNT+ELCSQLGAVLGMLGDCCRA+GD
Sbjct  171  VQQALRAFRANNLESAKSRLSLCADDIREQLQRIGNTAELCSQLGAVLGMLGDCCRASGD  230

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASA+ YF+ESV FL KVPKDDLE+THTLSVSLNKIGDLKYYD DLQAARSYYF+ALD+R
Sbjct  231  AASAITYFDESVVFLSKVPKDDLEVTHTLSVSLNKIGDLKYYDGDLQAARSYYFRALDVR  290

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AIK+HS  PSQ +D+A+SLAKVADVDRN+GNE  A+ GFQEAI+ L+ L L+ EE+  
Sbjct  291  RDAIKRHSSIPSQILDIAISLAKVADVDRNLGNEDAAIGGFQEAIKSLESLTLSSEEIVQ  350

Query  237  EQRRLSVLEFLNSQLGKKET  178
            +Q+RLSVLEFLN+QL  K +
Sbjct  351  QQKRLSVLEFLNNQLMNKPS  370



>gb|KHN26422.1| Polycomb complex protein BMI-1 [Glycine soja]
Length=365

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAEDIR+Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  160  VQQAMRAFRAQNLESAKSRLNLCAEDIRDQLEKVGNTSELCSQLGAVLGMLGDCCRAMGD  219

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYF++L++R
Sbjct  220  ASSAVAYFEESVQFLSKLPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFKSLNVR  279

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ +K +S  PSQ +DVAVSLAKVADVDRN+G+EK A DGFQEAI++L+ L L  E  GL
Sbjct  280  RDVVKHNSNVPSQVLDVAVSLAKVADVDRNLGDEKLATDGFQEAIDLLESLTLKSEASGL  339

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRR SVL+FL SQL  K+
Sbjct  340  EQRRQSVLDFLRSQLPDKQ  358



>ref|XP_003527531.1| PREDICTED: uncharacterized protein LOC100813844 [Glycine max]
Length=367

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAEDIR+Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  162  VQQAMRAFRAQNLESAKSRLNLCAEDIRDQLEKVGNTSELCSQLGAVLGMLGDCCRAMGD  221

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYF++L++R
Sbjct  222  ASSAVAYFEESVQFLSKLPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFKSLNVR  281

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ +K +S  PSQ +DVAVSLAKVADVDRN+G+EK A DGFQEAI++L+ L L  E  GL
Sbjct  282  RDVVKHNSNVPSQVLDVAVSLAKVADVDRNLGDEKLATDGFQEAIDLLESLTLKSEASGL  341

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRR SVL+FL SQL  K+
Sbjct  342  EQRRQSVLDFLRSQLPDKQ  360



>ref|XP_007148770.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
 gb|ESW20764.1| hypothetical protein PHAVU_005G012800g [Phaseolus vulgaris]
Length=367

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAEDIR+Q+E++GNTS+LCSQLGAVLGMLGDCCRA GD
Sbjct  162  VQQAMRAFRAQNLESAKSRLNLCAEDIRDQLEKVGNTSDLCSQLGAVLGMLGDCCRAMGD  221

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+PKDD+EITHTLSVSLNKIGDLKYYD DLQAARSYYF++LD+R
Sbjct  222  ASSAVSYFEESVQFLTKLPKDDMEITHTLSVSLNKIGDLKYYDGDLQAARSYYFKSLDVR  281

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ +KQ+S  PSQ +DVAVSLAKVADVDRNIG EK A DGFQEAI++L+ L L  E  GL
Sbjct  282  RDVVKQNSNVPSQVLDVAVSLAKVADVDRNIGEEKLATDGFQEAIDLLESLTLKSEASGL  341

Query  237  EQRRLSVLEFLNSQLGKKE  181
            E RR SVL+FL SQL  K+
Sbjct  342  EHRRQSVLDFLRSQLPDKQ  360



>gb|KHN45782.1| Polycomb complex protein BMI-1-B [Glycine soja]
Length=339

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL+ CAEDIR+Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  134  VQQAMRAFRAQNLESAKSRLNFCAEDIRDQLEKVGNTSELCSQLGAVLGMLGDCCRAMGD  193

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DLQAARSYYF++L++R
Sbjct  194  ASSAVAYFEESVQFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFKSLNVR  253

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K +S  PSQ +DVAVSLAKVADVDRN+G+EK A DGFQEAI++L+ L L  E  GL
Sbjct  254  RDAVKHNSNVPSQVLDVAVSLAKVADVDRNLGDEKLATDGFQEAIDLLESLTLKSEASGL  313

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRR SV++FL SQL  K+
Sbjct  314  EQRRQSVIDFLRSQLPDKQ  332



>ref|XP_003522869.1| PREDICTED: uncharacterized protein LOC100813258 isoform X1 [Glycine 
max]
 ref|XP_006578395.1| PREDICTED: uncharacterized protein LOC100813258 isoform X2 [Glycine 
max]
Length=367

 Score =   308 bits (790),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL+ CAEDIR+Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  162  VQQAMRAFRAQNLESAKSRLNFCAEDIRDQLEKVGNTSELCSQLGAVLGMLGDCCRAMGD  221

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DLQAARSYYF++L++R
Sbjct  222  ASSAVAYFEESVQFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFKSLNVR  281

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K +S  PSQ +DVAVSLAKVADVDRN+G+EK A DGFQEAI++L+ L L  E  GL
Sbjct  282  RDAVKHNSNVPSQVLDVAVSLAKVADVDRNLGDEKLATDGFQEAIDLLESLTLKSEASGL  341

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRR SV++FL SQL  K+
Sbjct  342  EQRRQSVIDFLRSQLPDKQ  360



>gb|KDP40599.1| hypothetical protein JCGZ_24598 [Jatropha curcas]
Length=393

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLSICAEDIR Q+E  GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  194  VQQAMRAFRAQNVESAKSRLSICAEDIRGQIETTGNTSELCSQLGAVLGMLGDCCRAMGD  253

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV YFEESV FL K+P DD EITHTLSVSLNKIGDLKYYD DL+AARSYYF++L++R
Sbjct  254  SSSAVAYFEESVEFLSKLPTDDQEITHTLSVSLNKIGDLKYYDGDLEAARSYYFRSLNVR  313

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AIKQH+   SQT+DVAVSLAKVAD DR++G E  A+D FQEAI++L+ L L PEE  L
Sbjct  314  RDAIKQHTDVSSQTLDVAVSLAKVADADRSLGKEDAALDRFQEAIKLLESLSLKPEEAAL  373

Query  237  EQRRLSVLEFLNSQLGKKE  181
            E+RRLSVLEFLNSQL +K+
Sbjct  374  EKRRLSVLEFLNSQLAEKK  392



>ref|XP_008231724.1| PREDICTED: uncharacterized protein LOC103330891 [Prunus mume]
Length=350

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL +CAEDIR Q+E MGNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  151  VQQAMRAFRAQNIESAKSRLCLCAEDIRGQLETMGNTSELCSQLGAVLGMLGDCCRATGD  210

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+P++D EITHTL++SLNKIGDLKYYD DL+AARSYYFQ+L++R
Sbjct  211  AGSAVSYFEESVEFLSKLPRNDQEITHTLTISLNKIGDLKYYDGDLKAARSYYFQSLNVR  270

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K     PSQ +D+AVS AKVADVDRN+G+E  A+D FQE I++L+ L L  E+ GL
Sbjct  271  RDAVKDDPNVPSQILDLAVSFAKVADVDRNLGDEDVAIDEFQEGIKLLESLTLKSEDTGL  330

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRRLSVLEFL SQ+ +K+T
Sbjct  331  EQRRLSVLEFLKSQIAEKQT  350



>gb|KEH32917.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=366

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAED+R Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  161  VQQAMRAFRAQNLESAKSRLNLCAEDVRSQIEKVGNTSELCSQLGAVLGMLGDCCRAMGD  220

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DLQAARSYYFQ+L++R
Sbjct  221  SSSAVTYFEESVEFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFQSLNVR  280

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ +K +S   SQ +DVAVSLAKVADVD+++G+EK+A DGFQEAI++L+ L L  E  GL
Sbjct  281  RDVVKNNSNVSSQVLDVAVSLAKVADVDKSLGDEKSASDGFQEAIDLLESLTLKSEASGL  340

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVL+FL SQ   K+
Sbjct  341  EQRRLSVLDFLRSQKANKQ  359



>gb|KEH32916.1| zinc ion-binding protein, putative [Medicago truncatula]
Length=379

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAED+R Q+E++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  174  VQQAMRAFRAQNLESAKSRLNLCAEDVRSQIEKVGNTSELCSQLGAVLGMLGDCCRAMGD  233

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DLQAARSYYFQ+L++R
Sbjct  234  SSSAVTYFEESVEFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFQSLNVR  293

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ +K +S   SQ +DVAVSLAKVADVD+++G+EK+A DGFQEAI++L+ L L  E  GL
Sbjct  294  RDVVKNNSNVSSQVLDVAVSLAKVADVDKSLGDEKSASDGFQEAIDLLESLTLKSEASGL  353

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVL+FL SQ   K+
Sbjct  354  EQRRLSVLDFLRSQKANKQ  372



>ref|XP_002297702.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
 gb|EEE82507.1| hypothetical protein POPTR_0001s07350g [Populus trichocarpa]
Length=363

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESA+SRLS+CAEDIR Q+E  G+TSELCSQLGAVLGMLGDCCR+ GD
Sbjct  163  VQQAMRAFRAQNVESARSRLSLCAEDIRGQIEIAGSTSELCSQLGAVLGMLGDCCRSMGD  222

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+P  DLEI HTLSVSLNKIGDLKYYD DL+AARSYY ++L++R
Sbjct  223  AGSAVSYFEESVEFLSKLPAADLEIMHTLSVSLNKIGDLKYYDGDLEAARSYYIRSLNVR  282

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AIK H S  SQT+DVAVSLAKVADVDR IGNE  A+D F++AI++L+ L L PEE GL
Sbjct  283  RDAIKHHPSVSSQTLDVAVSLAKVADVDRTIGNEDAALDRFRDAIKLLESLTLKPEEAGL  342

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            EQRRLSVLEFLN+QL +K++ 
Sbjct  343  EQRRLSVLEFLNTQLAEKQSG  363



>ref|XP_002304823.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
 gb|EEE79802.2| hypothetical protein POPTR_0003s18860g [Populus trichocarpa]
Length=371

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR ++E +GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  163  VQQAMRAFRAQNVESAKSRLSLCAEDIRGRIETVGNTSELCSQLGAVLGMLGDCCRAVGD  222

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+   DLEITHT SVSLNKIGDLKYYD DL+AARSYY ++L++R
Sbjct  223  AGSAVTYFEESVEFLSKLAAADLEITHTHSVSLNKIGDLKYYDGDLEAARSYYMRSLNVR  282

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AIK H S  SQT+DVAVSLAKVAD DR+IGNE  A+D F EAI++L+ L L PEE GL
Sbjct  283  RDAIKHHPSVSSQTLDVAVSLAKVADADRSIGNEDAALDRFHEAIKLLESLTLKPEEAGL  342

Query  237  EQRRLSVLEFLNSQLGKKETNSGS  166
            EQRRLSVLEFLN+QL +K+++  S
Sbjct  343  EQRRLSVLEFLNNQLAEKQSDCTS  366



>ref|XP_007218231.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
 gb|EMJ19430.1| hypothetical protein PRUPE_ppa007956mg [Prunus persica]
Length=350

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIR Q+E MGNTSELCSQLGAVLGMLGDC RATGD
Sbjct  151  VQQAMRAFRAQNIESAKSRLSLCAEDIRGQLETMGNTSELCSQLGAVLGMLGDCSRATGD  210

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+P++D EITHTLS+SLNKIGDLKYYD DL+AARSYYFQ+L++R
Sbjct  211  AGSAVSYFEESVEFLSKLPRNDQEITHTLSISLNKIGDLKYYDGDLKAARSYYFQSLNVR  270

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K     PSQ +D+AVS AKVADVDRN+G+E  A+D FQE I++L+ L L  E+ GL
Sbjct  271  RDAVKDDPNVPSQILDLAVSFAKVADVDRNLGDEDVAIDEFQEGIKLLESLTLKSEDTGL  330

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRRLSVLEFL SQ+ +K+T
Sbjct  331  EQRRLSVLEFLKSQIVEKQT  350



>ref|XP_004516522.1| PREDICTED: uncharacterized protein LOC101498396 [Cicer arietinum]
Length=365

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CAED+R Q+E++GNTSELCSQLGAVLGMLGDCCRA G+
Sbjct  160  VQQAMRAFRAQNLESAKSRLNLCAEDVRNQIEKVGNTSELCSQLGAVLGMLGDCCRAMGN  219

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DL AARSYYFQ+L++R
Sbjct  220  SSSAVTYFEESVEFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLPAARSYYFQSLNVR  279

Query  414  RNAIKQHSQPS-QTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R  +K +S  S Q +DVAVSLAKVADVD+N+G+EK+A DGFQEAI+ML+ L L  +  GL
Sbjct  280  REFVKNNSNVSPQVLDVAVSLAKVADVDKNLGDEKSASDGFQEAIDMLESLTLKSDASGL  339

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVL+FL SQL  K+
Sbjct  340  EQRRLSVLDFLRSQLTDKQ  358



>gb|ABK96344.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR ++E +GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  163  VQQAMRAFRAQNVESAKSRLSLCAEDIRGRIETVGNTSELCSQLGAVLGMLGDCCRAVGD  222

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+   DLEITHT SVSLNKIGDLKYYD DL+AARSYY ++L++R
Sbjct  223  AGSAVTYFEESVEFLSKLAAADLEITHTHSVSLNKIGDLKYYDGDLEAARSYYMRSLNVR  282

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AIK H S  SQT+DVAVSLAKVAD DR+IGNE  A+D F EAI++L+ L L PEE GL
Sbjct  283  RDAIKHHPSVSSQTLDVAVSLAKVADADRSIGNEDAALDRFHEAIKLLESLTLKPEEAGL  342

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            EQRRLSVLEFLN+QL +K+++
Sbjct  343  EQRRLSVLEFLNNQLAEKQSD  363



>gb|KJB67761.1| hypothetical protein B456_010G208800 [Gossypium raimondii]
Length=365

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 168/202 (83%), Gaps = 1/202 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL +CAEDIR+Q+E+ GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  157  VQQAMRAFRAQNIESAKSRLIMCAEDIRDQLEKTGNTSELCSQLGAVLGMLGDCCRAMGD  216

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AA+A+ YFEESV FL K+P DDLEITHTLSVSLNKIGDLKYYD DLQA+RSYYF++L +R
Sbjct  217  AAAAINYFEESVEFLTKLPADDLEITHTLSVSLNKIGDLKYYDGDLQASRSYYFRSLGVR  276

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ IK H    SQ +DVAVSLAKVADVDR +G E  AVDGFQE I++L+ L L  EE GL
Sbjct  277  RDVIKNHPGVASQILDVAVSLAKVADVDRTLGKEDVAVDGFQEGIKLLESLTLKSEEAGL  336

Query  237  EQRRLSVLEFLNSQLGKKETNS  172
            E RRLSVL FL SQL +K++ +
Sbjct  337  EPRRLSVLGFLKSQLEEKQSEA  358



>ref|XP_008375385.1| PREDICTED: uncharacterized protein LOC103438629 [Malus domestica]
Length=364

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIR Q+E MGNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  151  VQQAMRAFRAQNIESAKSRLSLCAEDIRGQLETMGNTSELCSQLGAVLGMLGDCCRATGD  210

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+P++D EI HTLS+SLNKIGDLKYYD DL++ARSYYFQ+L++R
Sbjct  211  AGSAVSYFEESVEFLXKLPRNDREIMHTLSISLNKIGDLKYYDGDLKSARSYYFQSLNVR  270

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K     PSQ +D+AVS AKVADVDRN+G+E  AVD F+E I++L+ L L  EE  L
Sbjct  271  RDAVKHDPNVPSQILDLAVSFAKVADVDRNLGDEDVAVDEFEEGIKLLESLTLKSEESAL  330

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            EQRRLSV+EFL SQ+ +K+T+
Sbjct  331  EQRRLSVMEFLKSQIAEKQTS  351



>gb|KHF99857.1| E3 ubiquitin-protein ligase CHFR [Gossypium arboreum]
Length=365

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL +CAEDIR+Q+E+MGNTSELCSQLGAVLG+LGDCCRA GD
Sbjct  157  VQQAMRAFRAQNIESAKSRLIMCAEDIRDQLEKMGNTSELCSQLGAVLGILGDCCRAMGD  216

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AA+A+ YFEESV FL K+P DDLEITHTLSVSLNKIGDLKYYD DLQA+RSYYF++L +R
Sbjct  217  AAAAINYFEESVEFLTKLPADDLEITHTLSVSLNKIGDLKYYDGDLQASRSYYFRSLGVR  276

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ IK H    SQ +DVAVSLAKVADVDR +G E  AVDGFQE I++L+ L L  EE GL
Sbjct  277  RDVIKNHPGVASQILDVAVSLAKVADVDRTLGKEDVAVDGFQEGIKLLESLTLKSEEAGL  336

Query  237  EQRRLSVLEFLNSQLGKKE  181
            E RRLSVL FL SQL +K+
Sbjct  337  EPRRLSVLAFLKSQLEEKQ  355



>ref|XP_007010628.1| Zinc ion binding [Theobroma cacao]
 gb|EOY19438.1| Zinc ion binding [Theobroma cacao]
Length=366

 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 170/202 (84%), Gaps = 1/202 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIR+Q++++GNTSELCSQLGAVLGMLGDCCRA GD
Sbjct  157  VQQAMRAFRAQNIESAKSRLSMCAEDIRDQLDKVGNTSELCSQLGAVLGMLGDCCRAMGD  216

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A +A+ YFEESV FL K+P DDLEITHTLSVSLNKIGDLKYYD DLQAARSYYF++L +R
Sbjct  217  AGAAINYFEESVEFLTKLPTDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFRSLGVR  276

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ IK + +  SQ +DVAVSLAKVADVDR +G +  AVDGFQEAI ML+ L L  EE GL
Sbjct  277  RDVIKHNPRVSSQILDVAVSLAKVADVDRTLGKDDVAVDGFQEAITMLESLTLKSEETGL  336

Query  237  EQRRLSVLEFLNSQLGKKETNS  172
            + RR SVLEFL +QL +K++ +
Sbjct  337  QARRHSVLEFLKTQLAEKQSEA  358



>ref|XP_010067651.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 ref|XP_010067652.1| PREDICTED: uncharacterized protein LOC104454492 [Eucalyptus grandis]
 gb|KCW65829.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
 gb|KCW65830.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=366

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR+Q+ R G+TSELCSQLGAVLGMLGDCCRA GD
Sbjct  166  VQQAMRAFRAQNVESAKSRLSVCAEDIRDQITRTGSTSELCSQLGAVLGMLGDCCRAIGD  225

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESV FL K+P DD+EITHTLSVSLNKIGDLKYYD DLQAARSYY ++L++R
Sbjct  226  AASAVTYFEESVGFLEKLPADDMEITHTLSVSLNKIGDLKYYDGDLQAARSYYDRSLNVR  285

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            ++A K     PSQ +DVAVSLAKVADVDR++GNE  A  GFQE I++L+ L L  E++GL
Sbjct  286  QDAAKDSPDVPSQILDVAVSLAKVADVDRSLGNENNATQGFQEGIKLLESLTLKSEDIGL  345

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVLEFL SQL +KE 
Sbjct  346  EQRRQSVLEFLKSQLVEKEP  365



>ref|XP_011034631.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034632.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
 ref|XP_011034633.1| PREDICTED: uncharacterized protein LOC105132695 [Populus euphratica]
Length=363

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESA+SRLS+CAEDIR Q+E  GNTSELCSQLGAVLGMLGDCCR+ GD
Sbjct  163  VQQAMRAFRAQNVESARSRLSLCAEDIRGQIEIAGNTSELCSQLGAVLGMLGDCCRSMGD  222

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEES  FL K+P  DLEI HTLSVSLNKIGDLKYYD DL+AARSYY ++L++R
Sbjct  223  AGSAVTYFEESAEFLSKLPAADLEIMHTLSVSLNKIGDLKYYDGDLEAARSYYVRSLNVR  282

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
             +AIK H S  SQT+DVAVSLAKVADVDR IGNE  A+D F+EAI++L+ L L PEE GL
Sbjct  283  CDAIKHHPSVSSQTLDVAVSLAKVADVDRTIGNEDAALDRFREAIKLLESLTLKPEEAGL  342

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            EQRRLSVLEFLN+QL +K+++
Sbjct  343  EQRRLSVLEFLNNQLTEKQSS  363



>ref|XP_009420238.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420239.1| PREDICTED: uncharacterized protein LOC104000028 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   294 bits (753),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFR  N+ESAKSRLSICAEDIR+Q++  G+T +LCSQLGAVLG+LGDCCRA GD
Sbjct  159  VQQAMRAFRGKNIESAKSRLSICAEDIRDQLQTSGDTPDLCSQLGAVLGLLGDCCRAMGD  218

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV Y+EESV FL K+P  DLE+ HTLSVSLNKIGDL+YYD DLQ+ARSYY ++LD+R
Sbjct  219  ASSAVGYYEESVEFLSKLPAKDLELVHTLSVSLNKIGDLRYYDGDLQSARSYYAKSLDVR  278

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+H+   SQ +D+A+SLAKVADVDRN+GNE  A+DGF+EAI  L+ LKL P E GL
Sbjct  279  RNAVKEHTNLSSQVVDLAISLAKVADVDRNLGNEDVAIDGFKEAISWLESLKLEPSEAGL  338

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVLEFL++QL +KE 
Sbjct  339  EQRRQSVLEFLSNQLAEKEP  358



>ref|XP_004306461.1| PREDICTED: uncharacterized protein LOC101299030 [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL +CA+DIR Q+E MGNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  141  VQQAMRAFRAQNIESAKSRLCLCAQDIRGQLETMGNTSELCSQLGAVLGMLGDCCRATGD  200

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SAV YFEESV FL K+P +D EITHTLS+SLNKIGDLKYYD DLQAARSYYF++LD+R
Sbjct  201  ASSAVTYFEESVEFLSKLPGNDQEITHTLSISLNKIGDLKYYDGDLQAARSYYFKSLDVR  260

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K     PSQ +D+AVS AKVADVDR++GNE  A++ FQE I++L+ L L  E+ GL
Sbjct  261  RDAVKHDPNVPSQILDLAVSFAKVADVDRSLGNEDVAINEFQEGIKLLESLTLKSEDTGL  320

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVLEFL +Q+ +K
Sbjct  321  EQRRLSVLEFLKNQVVEK  338



>ref|XP_002525579.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36838.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=392

 Score =   293 bits (751),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 167/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V HAMRAFRA N ESAKSRLS+CAEDIR Q+E  GNT ELCSQLGAVLGMLGDCCRA GD
Sbjct  189  VQHAMRAFRAKNFESAKSRLSLCAEDIRGQIEAAGNTPELCSQLGAVLGMLGDCCRAMGD  248

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K P DD E+ HTLSVSLNKIGDLKYYD DL+AA+SYY ++L++R
Sbjct  249  AGSAVAYFEESVEFLSKFPTDDQEVMHTLSVSLNKIGDLKYYDGDLEAAKSYYSRSLNVR  308

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+AI+ H    SQ++DVAVSLAKVAD DR++GNE  AV  FQEAI++L+ L L PEE  L
Sbjct  309  RDAIEHHPHVSSQSLDVAVSLAKVADADRSLGNEDAAVSRFQEAIKLLESLTLKPEEAAL  368

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            +QRRLSVLEFLN+QL +K+++
Sbjct  369  DQRRLSVLEFLNNQLAEKQSD  389



>ref|XP_011020515.1| PREDICTED: uncharacterized protein LOC105122866 [Populus euphratica]
Length=363

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 169/201 (84%), Gaps = 1/201 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR ++E +GNT+ELCSQLGAVLGMLGDCCRA GD
Sbjct  163  VQQAMRAFRAQNVESAKSRLSLCAEDIRGRIETVGNTTELCSQLGAVLGMLGDCCRAVGD  222

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SAV YFEESV FL K+   DLEITHT SVSLNKIGDLKYYD DL+AARSYY ++L++R
Sbjct  223  AGSAVTYFEESVEFLSKLSAADLEITHTHSVSLNKIGDLKYYDGDLEAARSYYMRSLNVR  282

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
             +AIK H S  SQ++DVAVSLAKVAD DR+IGNE TA D F EAI++L+ L L PEE GL
Sbjct  283  CDAIKHHPSVSSQSLDVAVSLAKVADADRSIGNEDTARDRFHEAIKLLESLTLKPEEAGL  342

Query  237  EQRRLSVLEFLNSQLGKKETN  175
            EQRRLSVLEFL +QL +K+++
Sbjct  343  EQRRLSVLEFLKNQLAEKQSD  363



>ref|XP_008793368.1| PREDICTED: uncharacterized protein LOC103709685 [Phoenix dactylifera]
Length=378

 Score =   291 bits (745),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 167/200 (84%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CA DIREQ++   NTSELCSQLGAVLGMLGDCCRA GD
Sbjct  172  VQQAMRAFRAQNIESAKSRLSLCAADIREQLQTSDNTSELCSQLGAVLGMLGDCCRAMGD  231

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              SAV Y+EESV FL K+P +DLE+ HTLSVSLNKIGDL+YYD DL++A++YY Q+LD+R
Sbjct  232  TGSAVTYYEESVEFLSKLPAEDLELVHTLSVSLNKIGDLRYYDGDLKSAKTYYTQSLDVR  291

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+H    SQ +DVA+SLAKVADVDRN+G+E  AVDGF+EAIE L+ LKL+  E GL
Sbjct  292  RNAVKEHPNVSSQVVDVAISLAKVADVDRNLGSEDVAVDGFEEAIECLESLKLDSNEAGL  351

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVL+FL+SQL  K T
Sbjct  352  EQRRRSVLDFLHSQLADKHT  371



>gb|KDO48657.1| hypothetical protein CISIN_1g0162581mg, partial [Citrus sinensis]
Length=200

 Score =   284 bits (726),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 158/185 (85%), Gaps = 1/185 (1%)
 Frame = -3

Query  756  AFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVK  577
            AFRA NVESAKSRLS+C EDIR+Q+ERMGNTSELCSQLGAVLGMLGDCCRA GDA +AV 
Sbjct  1    AFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVA  60

Query  576  YFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ  397
            YF +SV FL+K+P DDLEI HTLSVSLNKIGDLKYY  DLQAARSYY ++L++RR+A+K+
Sbjct  61   YFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKR  120

Query  396  HSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLS  220
            HS  PSQ +DVAVSLAKVADVDR+IGNE  AVDGFQEAI+ L+ L L PEE GLEQR   
Sbjct  121  HSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRF  180

Query  219  VLEFL  205
            + + L
Sbjct  181  LFQLL  185



>gb|KDO48654.1| hypothetical protein CISIN_1g0162581mg, partial [Citrus sinensis]
 gb|KDO48655.1| hypothetical protein CISIN_1g0162581mg, partial [Citrus sinensis]
Length=200

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  756  AFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVK  577
            AFRA NVESAKSRLS+C EDIR+Q+ERMGNTSELCSQLGAVLGMLGDCCRA GDA +AV 
Sbjct  1    AFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVA  60

Query  576  YFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ  397
            YF +SV FL+K+P DDLEI HTLSVSLNKIGDLKYY  DLQAARSYY ++L++RR+A+K+
Sbjct  61   YFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKR  120

Query  396  HSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQR  229
            HS  PSQ +DVAVSLAKVADVDR+IGNE  AVDGFQEAI+ L+ L L PEE GLEQR
Sbjct  121  HSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQR  177



>ref|XP_010276468.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276469.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
 ref|XP_010276470.1| PREDICTED: uncharacterized protein LOC104611195 [Nelumbo nucifera]
Length=362

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIREQ+ER+GNT ELCSQLGAVLGMLGDCCR+ GD
Sbjct  160  VQQAMRAFRAQNIESAKSRLSLCAEDIREQLERLGNTPELCSQLGAVLGMLGDCCRSMGD  219

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            +  A+ ++EESV+FL K+  DDLE+TH LSVSLNKIGDLKYYD ++QAARSYY ++LD+R
Sbjct  220  SGCAISFYEESVDFLSKLSMDDLEVTHALSVSLNKIGDLKYYDGNIQAARSYYNRSLDVR  279

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNAIK  S  PSQ +DVAVSLAKVAD +R++GNE  A+ GF+EAI+ L+ L L+P+E GL
Sbjct  280  RNAIKDRSDVPSQVLDVAVSLAKVADAERSLGNEDLALRGFEEAIKCLESLSLSPKETGL  339

Query  237  EQRRLSVLEFLNSQL  193
            EQRRLSVLEFL++QL
Sbjct  340  EQRRLSVLEFLHNQL  354



>ref|XP_010554493.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554494.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
 ref|XP_010554495.1| PREDICTED: uncharacterized protein LOC104824200 [Tarenaya hassleriana]
Length=367

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N ESAKSRL++CAEDIR+Q+ERMGNT ELCSQLGAVLGMLGDC RA GD
Sbjct  162  VQQAMRAFRAQNFESAKSRLTMCAEDIRDQLERMGNTPELCSQLGAVLGMLGDCSRAMGD  221

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEESV FL+K+P DDLEITHTLSVSLNKIGDLKYYD DLQAARSYYF++L++R
Sbjct  222  SSSAVNHFEESVEFLMKLPIDDLEITHTLSVSLNKIGDLKYYDGDLQAARSYYFRSLNVR  281

Query  414  RNAIKQHS-QPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVADVDR + NE  A++GF+E I++L+ LKL+ ++  L
Sbjct  282  RDAMKLHPDSPSQILDVAVSLAKVADVDRTLQNEGEAINGFKEGIKLLE-LKLDSKDSAL  340

Query  237  EQRRLSVLEFLNSQLGKKETNSG  169
            +QRR+SVLEFL SQ  + + +S 
Sbjct  341  DQRRISVLEFLKSQAAEGKPDSA  363



>gb|EPS69962.1| hypothetical protein M569_04796, partial [Genlisea aurea]
Length=307

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RANN+ESAKSRLS+CAEDIREQ+E+MG+T+ELCSQLGAVLGMLGDCCR+TGD
Sbjct  112  MQQAMRALRANNIESAKSRLSMCAEDIREQLEKMGHTAELCSQLGAVLGMLGDCCRSTGD  171

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ YF+ESV+FL +VPK + EITHTLSVSLNKIGDLKYY+ DL+AAR +Y+QALD+R
Sbjct  172  AKSAILYFKESVSFLTEVPKGNPEITHTLSVSLNKIGDLKYYEGDLEAARRHYWQALDVR  231

Query  414  RNAIK-QHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+ I+ Q + PSQ +DVA+SLAKVADVDRN+G E  AV GF+EAI +L  + +  EE+GL
Sbjct  232  RDEIRHQTASPSQVMDVAISLAKVADVDRNLGKEDAAVAGFREAIAVLNSMAIGDEEIGL  291

Query  237  EQRRLSVLEFLNSQL  193
            +QRR+SV+EF++SQL
Sbjct  292  QQRRVSVVEFVSSQL  306



>ref|XP_006403583.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
 gb|ESQ45036.1| hypothetical protein EUTSA_v10010421mg [Eutrema salsugineum]
Length=408

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  202  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  261

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYY +AL++R
Sbjct  262  SSSAVNHFEESIEFLMKLPMDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYCRALNVR  321

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A DGF+E +++L+ LKL+ E+  L
Sbjct  322  RDAMKHHPNAPSQILDVAVSLAKVADIDRSLQNEDAATDGFKEGMKLLESLKLDSEDSAL  381

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVLEFL  Q+ K E
Sbjct  382  EQRRLSVLEFLKKQVEKPE  400



>ref|XP_010515962.1| PREDICTED: uncharacterized protein LOC104791708 [Camelina sativa]
Length=408

 Score =   286 bits (732),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  203  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  262

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P +DLEITHTLSVSLNKIGDLKYYD+DLQAARSYY++AL++R
Sbjct  263  SSSAVNHFEESIEFLMKLPMNDLEITHTLSVSLNKIGDLKYYDQDLQAARSYYYRALNVR  322

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A DGF+E +++L+ LKL+ E+  L
Sbjct  323  RDAMKHHPHAPSQILDVAVSLAKVADIDRSLQNEDAATDGFKEGMKLLETLKLDSEDSAL  382

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVLEFL  Q+ K E
Sbjct  383  EQRRLSVLEFLKKQVEKPE  401



>dbj|BAH20367.1| AT3G54360 [Arabidopsis thaliana]
Length=292

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  90   VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  149

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAVK+FEESV FL+K+P +DLEITHTLSVSLNKIGDLKYYDEDLQAARSYY +AL++R
Sbjct  150  SSSAVKHFEESVEFLMKLPLNDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYDRALNVR  209

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR + NE  A DGF+E + +L+ LKL+ E+  L
Sbjct  210  RDAMKHHPNAPSQILDVAVSLAKVADIDRTLQNEVAATDGFKEGMRLLESLKLDSEDSAL  269

Query  237  EQRRLSVLEFLNSQL  193
            EQRRLSVLEFL  Q+
Sbjct  270  EQRRLSVLEFLKKQV  284



>ref|XP_002877973.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54232.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  210  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  269

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAVK+FEESV FL+K+P +DLEITHTLSVSLNKIGDLKYYDEDLQAARSYY +AL++R
Sbjct  270  SSSAVKHFEESVEFLMKLPLNDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYDRALNVR  329

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR + NE  A DGF+E +++L+ LKL+ E+  L
Sbjct  330  RDAMKHHPNAPSQILDVAVSLAKVADIDRTLQNEVAATDGFKEGMKLLESLKLDSEDSAL  389

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVLEFL  Q+ K E
Sbjct  390  EQRRLSVLEFLKKQVEKPE  408



>ref|XP_010504239.1| PREDICTED: uncharacterized protein LOC104781301 [Camelina sativa]
Length=417

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  212  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  271

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P +DLEITHTLSVSLNKIGDLKYYD+DLQAARSYY++AL++R
Sbjct  272  SSSAVNHFEESIEFLMKLPMNDLEITHTLSVSLNKIGDLKYYDQDLQAARSYYYRALNVR  331

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A DGF+E +++L+ LKL+ ++  L
Sbjct  332  RDAMKHHPHAPSQILDVAVSLAKVADIDRSLQNEDAATDGFKEGMKLLESLKLDSDDSAL  391

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVLEFL  Q+ K E
Sbjct  392  EQRRLSVLEFLKKQVEKPE  410



>ref|XP_010427133.1| PREDICTED: uncharacterized protein LOC104712035 [Camelina sativa]
Length=417

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  212  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  271

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P +DLEITHTLSVSLNKIGDLKYYD+DLQAARSYY +AL++R
Sbjct  272  SSSAVNHFEESIEFLMKLPMNDLEITHTLSVSLNKIGDLKYYDQDLQAARSYYHRALNVR  331

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A DGF+E +++L+ LKL+ E+  L
Sbjct  332  RDAMKHHPHAPSQVLDVAVSLAKVADIDRSLQNEDAATDGFKEGMKLLESLKLDSEDSAL  391

Query  237  EQRRLSVLEFLNSQLGKKE  181
            EQRRLSVLEFL  Q+ K E
Sbjct  392  EQRRLSVLEFLKKQVEKPE  410



>ref|XP_010533372.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
 ref|XP_010533373.1| PREDICTED: uncharacterized protein LOC104809184 [Tarenaya hassleriana]
Length=364

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N  SAKSRL+ICAEDIR+Q+E+M NT ELCSQLGAVLGMLGDC RA GD
Sbjct  160  VQQAMRAFRAQNFGSAKSRLTICAEDIRDQLEKMDNTPELCSQLGAVLGMLGDCSRAMGD  219

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEESV FL+K+P DD+EITHTLSVSLNKIGDLKYYD DLQAARSYYF++L++R
Sbjct  220  SSSAVSHFEESVEFLMKLPMDDMEITHTLSVSLNKIGDLKYYDGDLQAARSYYFRSLNVR  279

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+  H    SQ +DVAVSLAKVAD+DR + +E  A+ GF+E I++L+ L L PE+  L
Sbjct  280  RDAVNLHPDASSQVVDVAVSLAKVADLDRTLQDEDGAIHGFKEGIQLLKSLNLEPEDSAL  339

Query  237  EQRRLSVLEFLNSQLGKKETNSG  169
            +QRRLSVLEFL SQ+ +++  S 
Sbjct  340  QQRRLSVLEFLESQVAERKPESA  362



>ref|XP_010091318.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
 gb|EXB44292.1| E3 ubiquitin-protein ligase CHFR [Morus notabilis]
Length=438

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V HAMRA RA N ESAKSRLS+CAEDIR+Q+E+MG+TS+LCSQLGAVLGMLGDCCRATGD
Sbjct  166  VQHAMRALRAQNFESAKSRLSLCAEDIRDQLEKMGHTSDLCSQLGAVLGMLGDCCRATGD  225

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ YFEESV FL K+P+DDLEITHTLSVSLNKIGDLKYY  DLQAARSYYF++L++R
Sbjct  226  ADSAISYFEESVEFLSKLPRDDLEITHTLSVSLNKIGDLKYYAGDLQAARSYYFRSLNVR  285

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K +    SQ +D+AVSLAKVADVDR++GNE  AV+GF+EAI++++ LKL PEE GL
Sbjct  286  RDAVKNNPNVSSQILDLAVSLAKVADVDRSLGNEDVAVNGFEEAIKLVEPLKLKPEETGL  345

Query  237  EQR  229
            EQR
Sbjct  346  EQR  348



>ref|XP_010921286.1| PREDICTED: uncharacterized protein LOC105044901 [Elaeis guineensis]
Length=395

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 165/200 (83%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIREQ++   +TS+LC QLGAVLGMLGDCCRA GD
Sbjct  189  VQQAMRAFRAQNIESAKSRLSLCAEDIREQLQTSDDTSDLCLQLGAVLGMLGDCCRAIGD  248

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              SAV Y+EESV FL K+P  DLE+ HTLSVSLNKIGDL YYD DL++A+ YY ++LD+R
Sbjct  249  TGSAVTYYEESVEFLSKLPAKDLELVHTLSVSLNKIGDLSYYDGDLESAKIYYIRSLDVR  308

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+HS   SQ +D+AVSLAKVADVDRN+GNE  A+DGFQEAI+ L+ LKL+  E GL
Sbjct  309  RNAVKEHSNASSQVVDLAVSLAKVADVDRNLGNEDVAIDGFQEAIKCLESLKLDSNEAGL  368

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQR  SVL+FL+SQL  K+T
Sbjct  369  EQRCHSVLDFLHSQLADKQT  388



>ref|NP_191004.1| zinc ion binding protein [Arabidopsis thaliana]
 gb|AAK95259.1|AF410273_1 AT3g54360/T12E18_50 [Arabidopsis thaliana]
 emb|CAB81801.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM63273.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAN18187.1| At3g54360/T12E18_50 [Arabidopsis thaliana]
 gb|AEE79220.1| zinc ion binding protein [Arabidopsis thaliana]
Length=405

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 1/195 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  203  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRAMGD  262

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAVK+FEESV FL+K+P +DLEITHTLSVSLNKIGDLKYYDEDLQAARSYY +AL++R
Sbjct  263  SSSAVKHFEESVEFLMKLPLNDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYDRALNVR  322

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H   PSQ +DVAVSLAKVAD+DR + NE  A DGF+E + +L+ LKL+ E+  L
Sbjct  323  RDAMKHHPNAPSQILDVAVSLAKVADIDRTLQNEVAATDGFKEGMRLLESLKLDSEDSAL  382

Query  237  EQRRLSVLEFLNSQL  193
            EQRRLSVLEFL  Q+
Sbjct  383  EQRRLSVLEFLKKQV  397



>gb|KCW65831.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=396

 Score =   281 bits (718),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 168/231 (73%), Gaps = 31/231 (13%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR+Q+ R G+TSELCSQLGAVLGMLGDCCRA GD
Sbjct  166  VQQAMRAFRAQNVESAKSRLSVCAEDIRDQITRTGSTSELCSQLGAVLGMLGDCCRAIGD  225

Query  594  AASAVKYFEESVNFLLKVPKDDLE------------------------------ITHTLS  505
            AASAV YFEESV FL K+P DD+E                              ITHTLS
Sbjct  226  AASAVTYFEESVGFLEKLPADDMEVIAWYLVDIVLTLYSITLSLSVHVKLASMQITHTLS  285

Query  504  VSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQ-PSQTIDVAVSLAKVADVDRN  328
            VSLNKIGDLKYYD DLQAARSYY ++L++R++A K     PSQ +DVAVSLAKVADVDR+
Sbjct  286  VSLNKIGDLKYYDGDLQAARSYYDRSLNVRQDAAKDSPDVPSQILDVAVSLAKVADVDRS  345

Query  327  IGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETN  175
            +GNE  A  GFQE I++L+ L L  E++GLEQRR SVLEFL SQL +KE  
Sbjct  346  LGNENNATQGFQEGIKLLESLTLKSEDIGLEQRRQSVLEFLKSQLVEKEPK  396



>ref|XP_010938114.1| PREDICTED: uncharacterized protein LOC105057260 isoform X1 [Elaeis 
guineensis]
Length=405

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RA N+ESAKSRLS+CA DIREQ++   NTSELCSQLGAVLGMLGDCCRA GD
Sbjct  199  LQQAMRALRAQNMESAKSRLSLCAADIREQLQTSDNTSELCSQLGAVLGMLGDCCRAMGD  258

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              SAV  +EESV FL K+P +DLE+ HTLSVSLNKIGDL+YYD DL++A++YY Q+LD+R
Sbjct  259  TGSAVTCYEESVEFLSKLPAEDLELIHTLSVSLNKIGDLRYYDGDLKSAKAYYKQSLDVR  318

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+H    SQ +D+AVSLAKVADVDR++G+E  AVDGFQEAIE L+ LKL+  E GL
Sbjct  319  RNAVKEHPNVSSQVVDLAVSLAKVADVDRSLGSEDVAVDGFQEAIECLESLKLDSNEAGL  378

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVL+FL+ QL  K T
Sbjct  379  EQRRCSVLDFLHGQLADKHT  398



>ref|XP_010938116.1| PREDICTED: uncharacterized protein LOC105057260 isoform X2 [Elaeis 
guineensis]
Length=396

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 164/200 (82%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RA N+ESAKSRLS+CA DIREQ++   NTSELCSQLGAVLGMLGDCCRA GD
Sbjct  190  LQQAMRALRAQNMESAKSRLSLCAADIREQLQTSDNTSELCSQLGAVLGMLGDCCRAMGD  249

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              SAV  +EESV FL K+P +DLE+ HTLSVSLNKIGDL+YYD DL++A++YY Q+LD+R
Sbjct  250  TGSAVTCYEESVEFLSKLPAEDLELIHTLSVSLNKIGDLRYYDGDLKSAKAYYKQSLDVR  309

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+H    SQ +D+AVSLAKVADVDR++G+E  AVDGFQEAIE L+ LKL+  E GL
Sbjct  310  RNAVKEHPNVSSQVVDLAVSLAKVADVDRSLGSEDVAVDGFQEAIECLESLKLDSNEAGL  369

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVL+FL+ QL  K T
Sbjct  370  EQRRCSVLDFLHGQLADKHT  389



>ref|XP_006291209.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
 gb|EOA24107.1| hypothetical protein CARUB_v10017338mg [Capsella rubella]
Length=415

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 168/202 (83%), Gaps = 1/202 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N ESAKSRL++C EDIR+Q+ R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  210  VQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQLGAVLGMLGDCSRALGD  269

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAVK+FEES+ FL+K+P +DLEITHTLSVSLNKIGDLKYYDE+L+AARS+Y +AL +R
Sbjct  270  SSSAVKHFEESIEFLMKLPMNDLEITHTLSVSLNKIGDLKYYDEELEAARSFYDRALKVR  329

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K H + PSQ +DVAVSLAKVAD+DR++ NE  A DGF+E +++L+ LKL+  +  L
Sbjct  330  RDAVKHHPNSPSQILDVAVSLAKVADIDRSLQNEDAATDGFEEGMKLLESLKLDSGDSAL  389

Query  237  EQRRLSVLEFLNSQLGKKETNS  172
            EQRRLSVLEFL  Q+ K E ++
Sbjct  390  EQRRLSVLEFLKKQVEKPEQSA  411



>ref|XP_010689828.1| PREDICTED: uncharacterized protein LOC104903488 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 163/199 (82%), Gaps = 1/199 (1%)
 Frame = -3

Query  768  HAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAA  589
             AMRAFRA NVESAK+RLS+CA DIRE++E   N  ELCSQLGAVLG+LGDCCRA GD+A
Sbjct  162  QAMRAFRAQNVESAKARLSLCAVDIREELEESSNKPELCSQLGAVLGVLGDCCRAMGDSA  221

Query  588  SAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRN  409
            SA+ YFEESV FL + P +D+EI HTLSVSLNKIGDLKYYD DLQA+R+YYF++LD+RRN
Sbjct  222  SAITYFEESVEFLSQSPSEDMEIIHTLSVSLNKIGDLKYYDGDLQASRTYYFRSLDVRRN  281

Query  408  AIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQ  232
            A+K H    S T+DVAVSLAKVADVDR + NE+ A  GF+EAI +L+ LK++  EV LEQ
Sbjct  282  ALKNHCDSASLTLDVAVSLAKVADVDRGLSNEEGASAGFREAINLLESLKIDSSEVALEQ  341

Query  231  RRLSVLEFLNSQLGKKETN  175
            RR SVLEFLN Q+ +K+ +
Sbjct  342  RRQSVLEFLNGQIAEKQPD  360



>emb|CDX73486.1| BnaC08g25170D [Brassica napus]
Length=409

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 165/198 (83%), Gaps = 2/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q++R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  206  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLKREGNTPELCSQLGAVLGMLGDCSRAMGD  265

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P DDLEITHTLSVSLNKIGDLKYY +DL+AARSYY +AL++R
Sbjct  266  SSSAVSHFEESIEFLMKLPMDDLEITHTLSVSLNKIGDLKYYGQDLEAARSYYCRALNVR  325

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR + NE  A DGF+E +++L+ LKL+ E+   
Sbjct  326  RDAMKHHPNAPSQILDVAVSLAKVADIDRALQNEDAATDGFKEGMKLLESLKLDSEDSAA  385

Query  240  LEQRRLSVLEFLNSQLGK  187
            LEQRRLSVLEFL  Q+ K
Sbjct  386  LEQRRLSVLEFLKKQVEK  403



>ref|XP_008782756.1| PREDICTED: uncharacterized protein LOC103702200 [Phoenix dactylifera]
Length=428

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF A N+ESAKSRL +CAEDIREQ++   +TS+LCSQLGAVLGMLGDCCRA GD
Sbjct  223  VQQAMRAFHAQNIESAKSRLCLCAEDIREQLQASDSTSDLCSQLGAVLGMLGDCCRALGD  282

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              SAV Y+EESV FL K+P  DLE+ HTLSVSLNKIGDL YYD DL++A++YY ++LD+R
Sbjct  283  TGSAVTYYEESVEFLSKLPAKDLELVHTLSVSLNKIGDLSYYDGDLESAKNYYTRSLDVR  342

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNAIK+HS   SQ +D+AVSLAKVADVDRN+GNE  A+DGF EAI  L+ LKL+  E  L
Sbjct  343  RNAIKEHSNVSSQVVDLAVSLAKVADVDRNLGNEDVAIDGFHEAINCLESLKLDSNEASL  402

Query  237  EQRRLSVLEFLNSQLGKKET  178
            EQRR SVL+FL+++L  K+T
Sbjct  403  EQRRHSVLDFLHNELANKQT  422



>emb|CDX67597.1| BnaA07g16370D [Brassica napus]
Length=401

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q+ER GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  195  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLEREGNTPELCSQLGAVLGMLGDCSRAMGD  254

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P  DLEITHTLSVSLNKIGD+KY D DLQAARSYY +AL++R
Sbjct  255  SSSAVNHFEESIEFLMKLPMHDLEITHTLSVSLNKIGDVKYNDGDLQAARSYYIRALNVR  314

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A+DGF+E +++L  LKL+ E+   
Sbjct  315  RDAMKLHPNAPSQILDVAVSLAKVADIDRSLTNEDAAIDGFKEGMKLLDSLKLDSEDSAA  374

Query  240  LEQRRLSVLEFLNSQLGKKETNS  172
            LEQRRLSV+EFL  Q+ K E ++
Sbjct  375  LEQRRLSVMEFLKKQVEKPEQSA  397



>ref|XP_009103916.1| PREDICTED: uncharacterized protein LOC103829975 [Brassica rapa]
Length=401

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q+ER GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  195  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLEREGNTPELCSQLGAVLGMLGDCSRAMGD  254

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P  DLEITHTLSVSLNKIGD+KY D DLQAARSYY +AL++R
Sbjct  255  SSSAVNHFEESIEFLMKLPMHDLEITHTLSVSLNKIGDVKYNDGDLQAARSYYIRALNVR  314

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A+DGF+E +++L  LKL+ E+   
Sbjct  315  RDAMKLHPNAPSQILDVAVSLAKVADIDRSLTNEDAAIDGFKEGMKLLDSLKLDSEDSAA  374

Query  240  LEQRRLSVLEFLNSQLGKKETNS  172
            LEQRRLSV+EFL  Q+ K E ++
Sbjct  375  LEQRRLSVMEFLKKQVEKPEQSA  397



>emb|CDX78232.1| BnaA09g34270D [Brassica napus]
Length=409

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 165/198 (83%), Gaps = 2/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q++R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  206  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLKREGNTPELCSQLGAVLGMLGDCSRAMGD  265

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P DDLEITHTLSVSLNKIGDLKYY +DL+AARSYY +AL++R
Sbjct  266  SSSAVNHFEESIEFLMKLPMDDLEITHTLSVSLNKIGDLKYYGQDLEAARSYYCRALNVR  325

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR + NE  A DGF+E +++L+ LKL+ E+   
Sbjct  326  RDAMKHHPNAPSQILDVAVSLAKVADIDRALQNEDAATDGFKEGMKLLESLKLDSEDSAP  385

Query  240  LEQRRLSVLEFLNSQLGK  187
            LEQRRLSVLEFL  Q+ K
Sbjct  386  LEQRRLSVLEFLKKQVEK  403



>dbj|BAJ90412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  179  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  238

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+KY+EES   L K+PK DLE+ HTLSVSLNK+GDL+YYD DLQ+ARSYY ++LD+R
Sbjct  239  APSAIKYYEESAELLSKLPKKDLELVHTLSVSLNKVGDLRYYDGDLQSARSYYARSLDVR  298

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL  E+ GL
Sbjct  299  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNEDAAVEGFEEAIKCLEKLKLESEQAGL  358

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRR SVL+FL  QL +K
Sbjct  359  EQRRRSVLDFLQKQLHEK  376



>ref|XP_009116123.1| PREDICTED: uncharacterized protein LOC103841350 [Brassica rapa]
Length=409

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 165/198 (83%), Gaps = 2/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDIR+Q++R GNT ELCSQLGAVLGMLGDC RA GD
Sbjct  206  VQQAMRAFQAQNYESAKSRLAMCTEDIRDQLKREGNTPELCSQLGAVLGMLGDCSRAMGD  265

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P DDLEITHTLSVSLNKIGDLKYY +DL+AARSYY +AL++R
Sbjct  266  SSSAVNHFEESIEFLMKLPMDDLEITHTLSVSLNKIGDLKYYGQDLEAARSYYCRALNVR  325

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR + +E  A DGF+E +++L+ LKL+ E+   
Sbjct  326  RDAMKHHPNAPSQILDVAVSLAKVADIDRALQHEDAATDGFKEGMKLLESLKLDSEDSAP  385

Query  240  LEQRRLSVLEFLNSQLGK  187
            LEQRRLSVLEFL  Q+ K
Sbjct  386  LEQRRLSVLEFLKKQVEK  403



>ref|NP_001048384.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAD19269.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10298.1| Os02g0795300 [Oryza sativa Japonica Group]
 dbj|BAG92291.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92078.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57969.1| hypothetical protein OsJ_08709 [Oryza sativa Japonica Group]
Length=365

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  ELCSQLGAVLGMLGDCCR  GD
Sbjct  168  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSKEDNQELCSQLGAVLGMLGDCCRTLGD  227

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+PK DLE+ HTLSVSLNKIGDL YYD DL +ARSYY ++LD+R
Sbjct  228  APSAITYYEESAEFLSKLPKKDLELVHTLSVSLNKIGDLCYYDGDLHSARSYYARSLDVR  287

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K+HS   SQ IDVA SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL   E  L
Sbjct  288  RSAVKEHSAVASQVIDVATSLAKVADVDRNLGNESMAVEGFEEAIKCLENLKLESGEASL  347

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL  QL  K
Sbjct  348  EQRRLSVLDFLQKQLDDK  365



>ref|NP_001041762.2| Os01g0104100 [Oryza sativa Japonica Group]
 dbj|BAD44834.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG96566.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53706.1| hypothetical protein OsJ_00033 [Oryza sativa Japonica Group]
 dbj|BAF03676.2| Os01g0104100 [Oryza sativa Japonica Group]
Length=363

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CA+DIRE+++   +  ELCSQLGAVLGMLGDCCR  GD
Sbjct  166  VQQAMRAFRAQNIESAKSRLSMCAQDIREELKSKQDNQELCSQLGAVLGMLGDCCRTLGD  225

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+PK DLE+ HTLSVSLNKIGDL+YYD DL +ARSYY ++LD+R
Sbjct  226  APSAITYYEESAEFLSKLPKKDLELVHTLSVSLNKIGDLRYYDGDLHSARSYYARSLDVR  285

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A K+HS   SQ IDVA SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL   E  L
Sbjct  286  RSAAKEHSAVASQVIDVATSLAKVADVDRNLGNESMAVEGFEEAIKCLENLKLESGEASL  345

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL  QL  K
Sbjct  346  EQRRLSVLDFLQKQLDDK  363



>gb|EEC69773.1| hypothetical protein OsI_00037 [Oryza sativa Indica Group]
Length=409

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CA+DIRE+++   +  ELCSQLGAVLGMLGDCCR  GD
Sbjct  212  VQQAMRAFRAQNIESAKSRLSMCAQDIREELKSKQDNQELCSQLGAVLGMLGDCCRTLGD  271

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+PK DLE+ HTLSVSLNKIGDL+YYD DL +ARSYY ++LD+R
Sbjct  272  APSAITYYEESAEFLSKLPKKDLELVHTLSVSLNKIGDLRYYDGDLHSARSYYARSLDVR  331

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A K+HS   SQ IDVA SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL   E  L
Sbjct  332  RSAAKEHSAVASQVIDVATSLAKVADVDRNLGNESMAVEGFEEAIKCLENLKLESGEASL  391

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL  QL  K
Sbjct  392  EQRRLSVLDFLQKQLDDK  409



>ref|XP_006643640.1| PREDICTED: uncharacterized protein LOC102704921 [Oryza brachyantha]
Length=361

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESA+SRLS+CAEDIRE+++   +  EL SQLGAVLGMLGDCCR  GD
Sbjct  164  VQQAMRAFRAQNIESARSRLSMCAEDIREELKSKEDNQELSSQLGAVLGMLGDCCRTLGD  223

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+PK DLE+ HTLSVSLNKIGDL+YYD DLQ+ARSYY ++LD+R
Sbjct  224  APSAITYYEESSEFLSKLPKKDLELVHTLSVSLNKIGDLRYYDGDLQSARSYYARSLDVR  283

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K+HS   SQ ID+A SLAKVAD DRN+GNE  AV+GF+EAI+ L+ LK++ EE  L
Sbjct  284  RSAVKEHSAVASQVIDLATSLAKVADADRNLGNESMAVEGFEEAIKCLEKLKIDSEEASL  343

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL+ QL  K
Sbjct  344  EQRRLSVLDFLHKQLDDK  361



>emb|CDY07544.1| BnaC06g15200D [Brassica napus]
Length=298

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+A N ESAKSRL++C EDI+ Q+ R GNT ELCSQLGAVLGMLGDC  A GD
Sbjct  92   VQQAMRAFQAQNYESAKSRLAMCTEDIQYQLGREGNTPELCSQLGAVLGMLGDCSGAMGD  151

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            ++SAV +FEES+ FL+K+P DDLEITHTLSVSLNKIGD+KY   DLQAARSYY +AL++R
Sbjct  152  SSSAVNHFEESIEFLMKLPMDDLEITHTLSVSLNKIGDVKYNVGDLQAARSYYIRALNVR  211

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEE-VG  241
            R+A+K H   PSQ +DVAVSLAKVAD+DR++ NE  A+DGF+E +++L+ LKL+ E+ V 
Sbjct  212  RDAMKHHPNAPSQILDVAVSLAKVADIDRSLTNEDAAIDGFKEGMKLLESLKLDSEDSVP  271

Query  240  LEQRRLSVLEFLNSQLGKKETNS  172
            LEQRRLSV+EFL  Q+ K E ++
Sbjct  272  LEQRRLSVMEFLKKQVEKPEQSA  294



>ref|XP_004147090.1| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus]
 ref|XP_004161939.1| PREDICTED: uncharacterized LOC101210945 [Cucumis sativus]
 gb|KGN51585.1| hypothetical protein Csa_5G581690 [Cucumis sativus]
Length=404

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRAFRA N+ESAKSRL++C EDIR+Q+E+MG++ ELCSQLGAVLG LGDCCRA GD
Sbjct  200  IQQAMRAFRAQNIESAKSRLTVCVEDIRDQLEKMGSSPELCSQLGAVLGTLGDCCRAAGD  259

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASA+K+FEESV FL K+P+   EITHTLSVSLNKIGDLKYY+ DL+AARSYY ++L++R
Sbjct  260  AASAIKHFEESVEFLSKLPEKTHEITHTLSVSLNKIGDLKYYEGDLEAARSYYLRSLNVR  319

Query  414  RNAIKQHS-QPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            ++A K H   P+Q +DVAVSLAKVADVD  +GNE  AVD FQE I++L+ L LN E   L
Sbjct  320  QDASKHHPDDPAQILDVAVSLAKVADVDSGLGNEDMAVDRFQEGIKLLESLSLNSENPAL  379

Query  237  EQRRLSVLEFLNSQLGKKE  181
            + RR SV++FL  QL +++
Sbjct  380  QHRRESVMKFLEGQLAERQ  398



>ref|NP_001140913.1| LOC100272990 [Zea mays]
 ref|XP_008672386.1| PREDICTED: LOC100272990 isoform X1 [Zea mays]
 gb|ACF84952.1| unknown [Zea mays]
 tpg|DAA53866.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 1 [Zea mays]
 tpg|DAA53867.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 2 [Zea mays]
 tpg|DAA53868.1| TPA: putative RING zinc finger domain and TPR repeat-containing 
protein domain protein isoform 3 [Zea mays]
Length=379

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CA+DIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  182  VQQAMRAFRARNIESAKSRLTMCADDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  241

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              +A+ Y+EES  FL K P  DLE+ HTLSVSLNKIGDL+YYD DLQ+AR+YY ++LD+R
Sbjct  242  VPAAITYYEESAEFLSKPPAKDLELVHTLSVSLNKIGDLRYYDGDLQSARNYYARSLDVR  301

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+HS   SQ ID+A SLAKVADVDRN+GNE TAV+GF+EAI  L+ LKL+ E+  L
Sbjct  302  RNAVKEHSAVASQVIDLATSLAKVADVDRNLGNESTAVEGFEEAIRCLEKLKLDSEQTTL  361

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL++QL  K
Sbjct  362  EQRRLSVLDFLHNQLADK  379



>dbj|BAJ86803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDC R  GD
Sbjct  179  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSSEDNLDLCSQLGAVLGMLGDCRRTLGD  238

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+KY+EES   L K+PK DLE+ HTLSVSLNK+GDL+YYD DLQ+ARSYY ++LD+R
Sbjct  239  APSAIKYYEESAELLSKLPKKDLELVHTLSVSLNKVGDLRYYDGDLQSARSYYARSLDVR  298

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL  E+ GL
Sbjct  299  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNEDAAVEGFEEAIKCLEKLKLESEQAGL  358

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRR SVL+FL  QL +K
Sbjct  359  EQRRRSVLDFLQKQLHEK  376



>ref|XP_004967927.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=379

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CA+DIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  182  VQQAMRAFRAQNIESAKSRLTMCADDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  241

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+P  DLE+ HTLSVSLNKIGDL+YYD +LQ+AR+YY ++LD+R
Sbjct  242  APSAITYYEESSEFLSKLPTKDLELVHTLSVSLNKIGDLRYYDGNLQSARNYYARSLDVR  301

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+HS   SQ ID+A SLAKVADV+RN+GNE  AV+GF+EAI+ L+ LKL+ E+  L
Sbjct  302  RNAVKEHSAVASQVIDLATSLAKVADVERNLGNESAAVEGFEEAIQCLEKLKLDSEQANL  361

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL++QL  K
Sbjct  362  EQRRLSVLDFLHNQLADK  379



>ref|XP_002444897.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
 gb|EES14392.1| hypothetical protein SORBIDRAFT_07g001060 [Sorghum bicolor]
Length=382

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CA+DIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  185  VQQAMRAFRAKNIESAKSRLTMCADDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  244

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            + SA+ ++EES   L K+P  DLE+ HTLSVSLNKIGDL+YYD DLQ+AR+YY ++LD+R
Sbjct  245  SPSAITHYEESAEILSKLPTKDLELVHTLSVSLNKIGDLRYYDGDLQSARNYYARSLDVR  304

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RNA+K+HS   SQ ID+A SLAKVADVDRN+GNE TAV GF+EAI+ L+ LKL+ E+  L
Sbjct  305  RNAVKEHSAVASQVIDLATSLAKVADVDRNLGNESTAVQGFEEAIQCLEKLKLDSEQASL  364

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL++QL  K
Sbjct  365  EQRRLSVLDFLHNQLADK  382



>emb|CDM81302.1| unnamed protein product [Triticum aestivum]
Length=373

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  176  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  235

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES   L K+PK DLE+ HTLSVSLNK+GDL+YY  DLQ+ARSYY ++LD+R
Sbjct  236  APSAITYYEESAELLSKLPKKDLELVHTLSVSLNKVGDLRYYGGDLQSARSYYARSLDVR  295

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL+ E+  L
Sbjct  296  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNEDAAVEGFEEAIKCLEKLKLDSEQASL  355

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRR SVL+FL  QL  K
Sbjct  356  EQRRRSVLDFLQKQLHDK  373



>ref|XP_008445920.1| PREDICTED: uncharacterized protein LOC103488802 [Cucumis melo]
Length=404

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRAFRA N+ESAKSRL++C EDIR+Q+E+MG++ ELCSQLGAVLG LGDCCRA GD
Sbjct  200  IQQAMRAFRAQNIESAKSRLTVCVEDIRDQLEKMGSSPELCSQLGAVLGTLGDCCRAAGD  259

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASA+K+FEESV FL K+P+   EITHTLSVSLNKIGDLKYY+ DL+AARSYY ++L++R
Sbjct  260  AASAIKHFEESVEFLSKLPEKTHEITHTLSVSLNKIGDLKYYEGDLEAARSYYLRSLNVR  319

Query  414  RNAIKQHS-QPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            ++A K H   P+Q +DVAVSLAKVADVD  +GNE  AVD FQE I++L+ L LN E   L
Sbjct  320  QDASKHHPDDPAQILDVAVSLAKVADVDSGLGNEDMAVDRFQEGIKLLESLSLNSENPAL  379

Query  237  EQRRLSVLEFLNSQLGKKE  181
            + R  SVL+FL  QL +++
Sbjct  380  QHRGESVLKFLEGQLAERQ  398



>ref|XP_004978719.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Setaria italica]
Length=361

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ SAKSRLS+CAEDIRE+++   +  +L SQLGAVLGMLGDCCR  GD
Sbjct  164  VQQAMRAFRAQNIGSAKSRLSMCAEDIREELKSSEDNLDLRSQLGAVLGMLGDCCRTLGD  223

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            + SA+ Y+EES  FL K+P  DLE+ HTLSVSLNKIGDL+YYD +LQ+ARSYY ++LD+R
Sbjct  224  SPSAITYYEESAEFLSKLPVKDLELVHTLSVSLNKIGDLRYYDGNLQSARSYYARSLDVR  283

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE TAV GF+EAIE L+ LKL  E+  L
Sbjct  284  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNESTAVKGFKEAIECLEKLKLGSEQASL  343

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL++QL  K
Sbjct  344  EQRRLSVLDFLHNQLADK  361



>gb|EEC74169.1| hypothetical protein OsI_09273 [Oryza sativa Indica Group]
Length=655

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  ELCSQLGAVLGMLGDCCR  GD
Sbjct  458  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSKEDNQELCSQLGAVLGMLGDCCRTLGD  517

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES  FL K+PK DLE+ HTLSVSLNKIGDL YYD DL +ARSYY ++LD+R
Sbjct  518  APSAITYYEESAEFLSKLPKKDLELVHTLSVSLNKIGDLCYYDGDLHSARSYYARSLDVR  577

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            R+A+K+HS   SQ IDVA SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL   E  L
Sbjct  578  RSAVKEHSAVASQVIDVATSLAKVADVDRNLGNESMAVEGFEEAIKCLENLKLESGEASL  637

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRRLSVL+FL  QL  K
Sbjct  638  EQRRLSVLDFLQKQLDDK  655



>gb|EMS59099.1| E3 ubiquitin-protein ligase CHFR [Triticum urartu]
Length=573

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  275  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  334

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES   L K+PK DLE+ HTLSVSLNK+GDL+YY  DLQ+ARSYY ++LD+R
Sbjct  335  APSAITYYEESAELLSKLPKKDLELVHTLSVSLNKVGDLRYYGGDLQSARSYYARSLDVR  394

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL+ E+  L
Sbjct  395  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNEDAAVEGFEEAIKCLEKLKLDSEQASL  454

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRR SVL+FL  QL  K
Sbjct  455  EQRRRSVLDFLQKQLHDK  472



>ref|XP_003563481.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Brachypodium 
distachyon]
Length=379

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  182  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSAEDNLDLCSQLGAVLGMLGDCCRTLGD  241

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SA+ Y+EES  FL K+P  DLE+ HTLSVSLNK+GDL+YY  DLQ+ARSYY ++L +R
Sbjct  242  ASSAITYYEESAEFLSKLPTKDLELVHTLSVSLNKVGDLRYYGGDLQSARSYYARSLSVR  301

Query  414  RNAIKQH-SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            + A+K+H S  SQ ID+A SLAKVADVDRN+GN+  AV+GF+EAI+ L+ L L+ E+ GL
Sbjct  302  QKAVKEHPSVASQVIDLATSLAKVADVDRNLGNQDAAVEGFEEAIKSLEKLNLDSEQAGL  361

Query  237  EQRRLSVLEFLNSQLGKK  184
            EQRR SVL+FL+ QL  K
Sbjct  362  EQRRRSVLDFLHKQLDSK  379



>ref|XP_003559441.1| PREDICTED: uncharacterized protein LOC100832811 [Brachypodium 
distachyon]
Length=380

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  181  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSAEDNLDLCSQLGAVLGMLGDCCRTLGD  240

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SA+ Y+EES  FL K+P  DLE+ HTLSVSLNK+GDL+YY  DLQ+ARSYY ++L +R
Sbjct  241  ASSAITYYEESAEFLSKLPTKDLELVHTLSVSLNKVGDLRYYGGDLQSARSYYARSLSVR  300

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKL-NPEEVG  241
            + A+K+HS   SQ ID+A SLAKVADVDRN+GN++ AV+GF+EAI+ L+ L L + E+ G
Sbjct  301  QRAVKEHSSVASQVIDLATSLAKVADVDRNLGNQEAAVEGFEEAIKCLEKLNLEDSEQAG  360

Query  240  LEQRRLSVLEFLNSQLGKK  184
            LEQRR SVL+FL+ QL  K
Sbjct  361  LEQRRRSVLDFLHKQLDAK  379



>gb|EMT10100.1| E3 ubiquitin-protein ligase CHFR [Aegilops tauschii]
Length=540

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRLS+CAEDIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  317  VQQAMRAFRAQNIESAKSRLSMCAEDIREELKSSQDNLDLCSQLGAVLGMLGDCCRTLGD  376

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A SA+ Y+EES   L K+PK DLE+ HTLSVSLNK+GDL+YY  DLQ+ARSYY ++LD+R
Sbjct  377  APSAITYYEESAELLSKLPKKDLELVHTLSVSLNKVGDLRYYGGDLQSARSYYARSLDVR  436

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGL  238
            RN++K+HS   SQ ID+A SLAKVADVDRN+GNE  AV+GF+EAI+ L+ LKL+ E+  L
Sbjct  437  RNSVKEHSAVASQVIDLATSLAKVADVDRNLGNEDAAVEGFEEAIKCLEKLKLDSEQANL  496

Query  237  EQR  229
            EQR
Sbjct  497  EQR  499



>ref|XP_009610509.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
tomentosiformis]
Length=347

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N++SAKSRL++CA+DIR Q+ER+GNTSELCSQLGAVLGMLGDCCRATGD
Sbjct  207  VQQAMRAFRAKNIDSAKSRLTMCADDIRGQLERLGNTSELCSQLGAVLGMLGDCCRATGD  266

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYYD+DL+AARS+YF+ALD+R
Sbjct  267  AASAVTYFEESVNFLVKVPKDDLEITHTLSVSLNKIGDLKYYDDDLEAARSHYFKALDVR  326

Query  414  RNAIKQHSQPSQ  379
            RNAIKQ S PSQ
Sbjct  327  RNAIKQQSAPSQ  338



>ref|XP_009765281.1| PREDICTED: E3 ubiquitin-protein ligase CHFR isoform X2 [Nicotiana 
sylvestris]
Length=347

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRANN++SAKSRL++CA+DIR Q+ER+GNTSELCSQLG VLGMLGDCCRATGD
Sbjct  207  VQQAMRAFRANNIDSAKSRLTMCADDIRGQLERLGNTSELCSQLGVVLGMLGDCCRATGD  266

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYYD+DL+AARS+Y +ALD+R
Sbjct  267  AASAVIYFEESVNFLVKVPKDDLEITHTLSVSLNKIGDLKYYDDDLEAARSHYIKALDVR  326

Query  414  RNAIKQHSQPSQ  379
            RNAIKQ S PSQ
Sbjct  327  RNAIKQQSAPSQ  338



>ref|XP_011075118.1| PREDICTED: uncharacterized protein LOC105159671 isoform X2 [Sesamum 
indicum]
Length=314

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            +  AMRA RANN+ESAKSR SICAED+REQ+E+MGNT ELCSQLGAVLGMLGDCCRATGD
Sbjct  156  MQQAMRALRANNIESAKSRFSICAEDVREQLEKMGNTPELCSQLGAVLGMLGDCCRATGD  215

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            A+SA+ YFEESVNFL+KVPKDDLEITHTLSVSLNKIGDLKYY+ DLQA RSYYFQALD+R
Sbjct  216  ASSAISYFEESVNFLMKVPKDDLEITHTLSVSLNKIGDLKYYEGDLQATRSYYFQALDVR  275

Query  414  RNAIKQHSQ-PSQTI  373
            RNA+  HS  PSQ +
Sbjct  276  RNAMNNHSSVPSQYV  290



>gb|ACG25350.1| hypothetical protein [Zea mays]
Length=351

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA N+ESAKSRL++CA+DIRE+++   +  +LCSQLGAVLGMLGDCCR  GD
Sbjct  182  VQQAMRAFRARNIESAKSRLTMCADDIREELKSSEDNLDLCSQLGAVLGMLGDCCRTLGD  241

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
              +A+ Y+EES  FL K P  DLE+ HTLSVSLNKIGDL+YYD DLQ+ARSYY ++LD+R
Sbjct  242  VPAAITYYEESAEFLSKPPAKDLELVHTLSVSLNKIGDLRYYDGDLQSARSYYARSLDVR  301

Query  414  RNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQ  271
            RNA+K+HS   SQ ID+A SLAKVADVDRN+GNE TAV+GF++  + L+
Sbjct  302  RNAVKEHSAVASQVIDLATSLAKVADVDRNLGNESTAVEGFRKQFDALR  350



>gb|AFK44885.1| unknown [Lotus japonicus]
Length=157

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -3

Query  627  MLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAA  448
            MLGDCCRA GDA+SAV YFEESV FL K+PKDDLEITHTLSVSLNKIGDLKYYD DL+AA
Sbjct  1    MLGDCCRAIGDASSAVTYFEESVEFLSKLPKDDLEITHTLSVSLNKIGDLKYYDGDLRAA  60

Query  447  RSYYFQALDIRRNAIKQHSQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQ  271
            RSYYFQ+L++RR+ +K +S   SQ +DVAVSLAKVADVDRNIG+EK A DGFQEAI++L+
Sbjct  61   RSYYFQSLNVRRDVMKHNSNVTSQVLDVAVSLAKVADVDRNIGDEKLATDGFQEAIDLLE  120

Query  270  CLKLNPEEVGLEQRRLSVLEFLNSQLGKK  184
             L L  E  GLEQRRLSVL+FL +QL  K
Sbjct  121  SLSLESEGSGLEQRRLSVLDFLRNQLADK  149



>gb|KCW65832.1| hypothetical protein EUGRSUZ_G03178 [Eucalyptus grandis]
Length=301

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAFRA NVESAKSRLS+CAEDIR+Q+ R G+TSELCSQLGAVLGMLGDCCRA GD
Sbjct  166  VQQAMRAFRAQNVESAKSRLSVCAEDIRDQITRTGSTSELCSQLGAVLGMLGDCCRAIGD  225

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
            AASAV YFEESV FL K+P DD+EITHTLSVSLNKIGDLKYYD DLQAARSYY ++L++R
Sbjct  226  AASAVTYFEESVGFLEKLPADDMEITHTLSVSLNKIGDLKYYDGDLQAARSYYDRSLNVR  285

Query  414  RNAIK  400
            ++A K
Sbjct  286  QDAAK  290



>gb|KJB73245.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=254

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  696  IREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEIT  517
            +++ + + GNTSE CSQLGAVLGMLGDCCRA GD+ASA+ YFEESV FL K+P DDLEIT
Sbjct  103  VQQAMRKTGNTSEFCSQLGAVLGMLGDCCRAMGDSASAINYFEESVEFLTKLPTDDLEIT  162

Query  516  HTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQ-PSQTIDVAVSLAKVAD  340
            H LSVSLNKIGDLKYYD DLQAARSYY ++L +RR+ IK +S   SQ ID+AVSLAKVAD
Sbjct  163  HALSVSLNKIGDLKYYDGDLQAARSYYLRSLGVRRDVIKNNSGVASQVIDIAVSLAKVAD  222

Query  339  VDRNIGNEKTAVDGFQEAIEMLQ  271
            VDR +G +  A+DGFQEAI++L+
Sbjct  223  VDRILGKDDEAIDGFQEAIKLLR  245



>ref|XP_001754304.1| predicted protein [Physcomitrella patens]
 gb|EDQ80754.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 5/198 (3%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            V  AMRAF+ NN+ESAK+RL +C ED RE++ R G TS  CSQLGA+LGMLGDCC A  D
Sbjct  171  VQQAMRAFQGNNLESAKARLGLCIEDSREEMSRSGATSTNCSQLGALLGMLGDCCGAMKD  230

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIR  415
               A+  +EESV  L K+P  D+E+ H LSVSLNK+GDLKYY ++L+AAR++Y +AL++R
Sbjct  231  VDGAIASYEESVELLTKLPDRDIEVVHALSVSLNKLGDLKYYAQELKAARAFYARALNVR  290

Query  414  RNAIKQHSQPSQ-TIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNP---EE  247
              A    +  +   +DVAVSLAKVADVD  +GNE  A +GFQ+A++ LQ L L P   + 
Sbjct  291  LEATSDFTTLAPLVLDVAVSLAKVADVDVALGNESAASEGFQDALKKLQNL-LPPKTADA  349

Query  246  VGLEQRRLSVLEFLNSQL  193
              LE++RLSV+ FL +QL
Sbjct  350  ASLEKKRLSVMTFLQNQL  367



>ref|XP_002981629.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
 gb|EFJ17444.1| hypothetical protein SELMODRAFT_154638 [Selaginella moellendorffii]
Length=338

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 133/197 (68%), Gaps = 5/197 (3%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            + HAMRAF+A N+ES+K+RL +C ED RE +E  G ++E+CSQ GAVLG+LGDC RA GD
Sbjct  122  LQHAMRAFQAQNLESSKARLDLCVEDTREMMETKGASAEVCSQHGAVLGLLGDCLRAMGD  181

Query  594  AASAVKYFEESVNFLLKVPKDDL--EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALD  421
               A+  + ESV+ L  +   D+  EI H LSVSLNK+GDLKYY +DL+ A + Y QAL 
Sbjct  182  LDGAMDKYAESVSVLQAITGVDVNAEIVHALSVSLNKLGDLKYYADDLECALALYKQALQ  241

Query  420  IR-RNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKL--NPE  250
            +R R    ++   +++IDV VSLAKVADV R +G +  A +GF  AI  L+ L    +P 
Sbjct  242  VRDRAQAGRNDLSAESIDVVVSLAKVADVQRAMGRDSEAAEGFTAAITRLEHLTCPPSPR  301

Query  249  EVGLEQRRLSVLEFLNS  199
            +  L +RR SVL FL++
Sbjct  302  DESLNKRRASVLGFLHA  318



>gb|KJB73244.1| hypothetical protein B456_011G224300, partial [Gossypium raimondii]
Length=228

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  696  IREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEIT  517
            +++ + + GNTSE CSQLGAVLGMLGDCCRA GD+ASA+ YFEESV FL K+P DDLEIT
Sbjct  103  VQQAMRKTGNTSEFCSQLGAVLGMLGDCCRAMGDSASAINYFEESVEFLTKLPTDDLEIT  162

Query  516  HTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVS  358
            H LSVSLNKIGDLKYYD DLQAARSYY ++L +RR+ IK +S  +  + +  S
Sbjct  163  HALSVSLNKIGDLKYYDGDLQAARSYYLRSLGVRRDVIKNNSGVASQMSIEFS  215



>ref|XP_010508043.1| PREDICTED: uncharacterized protein LOC104784688 [Camelina sativa]
Length=110

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -3

Query  735  ESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVN  556
            ESAKSRL++C EDIR+Q+ R GNT EL SQLGAVLGMLG C R  GD++SAV +FEES+ 
Sbjct  5    ESAKSRLAMCTEDIRDQLGREGNTPELSSQLGAVLGMLGGCSREMGDSSSAVNHFEESIE  64

Query  555  FLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAAR  445
            FL+K+P +DLEIT+TL VSLNKIGDLKYYD+DLQ+ +
Sbjct  65   FLMKLPMNDLEITYTLYVSLNKIGDLKYYDQDLQSCK  101



>ref|XP_006829772.1| hypothetical protein AMTR_s00119p00032590 [Amborella trichopoda]
 gb|ERM97188.1| hypothetical protein AMTR_s00119p00032590 [Amborella trichopoda]
Length=74

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -3

Query  375  IDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQ  196
            +D+AVSLAKVADVDR++GNE  A++GFQEAI+ L+ LKL+  EV LE+RRLSVLEFL+ Q
Sbjct  2    VDIAVSLAKVADVDRSLGNEGMAINGFQEAIKCLESLKLDANEVALEKRRLSVLEFLHGQ  61

Query  195  LGKKET  178
            L ++E 
Sbjct  62   LAEREN  67



>ref|XP_006829771.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
 gb|ERM97187.1| hypothetical protein AMTR_s00119p00030390 [Amborella trichopoda]
Length=221

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  774  VHHAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDC  613
            V  AMRAF+A N++SA+SRLS+C EDIR+Q+ER G TSELCSQLGAVLGMLGDC
Sbjct  163  VQQAMRAFQAQNLKSAESRLSLCTEDIRDQIERSGCTSELCSQLGAVLGMLGDC  216



>ref|XP_005647539.1| hypothetical protein COCSUDRAFT_63384 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22995.1| hypothetical protein COCSUDRAFT_63384 [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 14/178 (8%)
 Frame = -3

Query  765  AMRAFRANNVESAKSRLSICAE---DIREQVERMGNTSELCSQLGAVLGMLGDCCRATGD  595
            A+R+    N  +A  R + C E    + E     G + E C +LG + G  G C +  G+
Sbjct  105  ALRSMAGGNFTAAAVRFARCRERLVTLAEASGANGWSEETCCRLGDIWGSQGMCEQRLGN  164

Query  594  AASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD----EDLQAARSYYFQA  427
              +A + F++S+  L K P    ++ H L+VS NK+GDL Y +    ++L+ ARS Y +A
Sbjct  165  LVAAEECFKDSLGVLQKSPVRSSQVAHALAVSHNKLGDLHYSNSNSKQELELARSNYREA  224

Query  426  LDIRRNAIKQHSQP-------SQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEML  274
            L IR +A     Q        S  +++  SL KVAD++  +GN + A +   +A + L
Sbjct  225  LAIREHAFDAPRQGDDSSADVSAALNLVTSLLKVADIEEVLGNGQAASECLAKADDAL  282



>ref|XP_005844547.1| hypothetical protein CHLNCDRAFT_58886 [Chlorella variabilis]
 gb|EFN52445.1| hypothetical protein CHLNCDRAFT_58886 [Chlorella variabilis]
Length=439

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYY  469
            +LGAV G LGDCCRA GDA   +++++ SV  LL+   DD E    LSVSLNK+G+L++ 
Sbjct  243  RLGAVSGCLGDCCRAEGDADGTLRHYQCSVE-LLRAAGDDPEAQQALSVSLNKVGELRHM  301

Query  468  DEDLQAARSYYFQALDIRRN  409
              +L+AA   Y QAL +RR 
Sbjct  302  QGELEAAAELYAQALQLRRG  321



>gb|ACQ82653.1| At3g54360-like protein, partial [Solanum hirtum]
 gb|ACQ82654.1| At3g54360-like protein, partial [Solanum quitoense]
 gb|ACQ82655.1| At3g54360-like protein, partial [Solanum quitoense]
 gb|ACQ82656.1| At3g54360-like protein, partial [Solanum hirtum]
Length=40

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  756  AFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGA  637
            AFRANN++SAKSR ++CA+DIREQ++RMGNTSELCSQL A
Sbjct  1    AFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLEA  40



>ref|WP_020179497.1| hypothetical protein [Methylopila sp. M107]
Length=1355

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 77/152 (51%), Gaps = 4/152 (3%)
 Frame = -3

Query  660   ELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEIT---HTLSVSLNK  490
             E    +   L  +GD    +GDAA A+K +EE ++   K+   D   T     +SVSL++
Sbjct  910   EWRRDVSVALNKIGDLLAQSGDAAGALKAYEEDLDIARKLAASDEANTVWRRDVSVSLDR  969

Query  489   IGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQT-IDVAVSLAKVADVDRNIGNEK  313
             IGD++    D   +   Y +ALDIRR  +      +Q   DV++SL K+ DV    G+  
Sbjct  970   IGDVRLRGGDTAGSLKAYEEALDIRRVLVAMDEANTQWRRDVSISLNKIGDVQLRAGDAT  1029

Query  312   TAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSV  217
              A+  F++A++M + L    E     +R LSV
Sbjct  1030  RALRAFEDALDMRRKLAATDEANTGWRRDLSV  1061


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEIT---HTLSVSLNKIGDLKYYDE  463
             L  +GD     GDA  A++ FE++++   K+   D   T     LSVSLNKIGDL+    
Sbjct  1015  LNKIGDVQLRAGDATRALRAFEDALDMRRKLAATDEANTGWRRDLSVSLNKIGDLRLRAG  1074

Query  462   DLQAARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
             D   A   Y + LDI R+ A K  +      D+++SL KV DV    G+   A+  + E 
Sbjct  1075  DATRALGAYEEGLDIVRKLAAKDKANTGWRRDLSISLNKVGDVQLRAGDTAGALKSYDEG  1134

Query  285   IEMLQCL  265
             +++ + L
Sbjct  1135  LDIAREL  1141


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 72/144 (50%), Gaps = 5/144 (3%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEIT---HTLSVSLNKIGDLK  475
             L   L  +GD     GDA  A+  +EE ++ + K+   D   T     LS+SLNK+GD++
Sbjct  1059  LSVSLNKIGDLRLRAGDATRALGAYEEGLDIVRKLAAKDKANTGWRRDLSISLNKVGDVQ  1118

Query  474   YYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDG  298
                 D   A   Y + LDI R  +   S  ++   DV+VSL+K+ DV     +   AV  
Sbjct  1119  LRAGDTAGALKSYDEGLDIARELVGTDSSNTEWRRDVSVSLSKIGDVRLRTDDAAGAVKV  1178

Query  297   FQEAIEMLQCLKLNPEEVGLEQRR  226
             F+EA+++ + L    +E   + RR
Sbjct  1179  FEEALDIRRKLAAT-DEANTDWRR  1201


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 70/147 (48%), Gaps = 4/147 (3%)
 Frame = -3

Query  693   REQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDD---LE  523
             RE V    + +E    +   L  +GD    T DAA AVK FEE+++   K+   D    +
Sbjct  1139  RELVGTDSSNTEWRRDVSVSLSKIGDVRLRTDDAAGAVKVFEEALDIRRKLAATDEANTD  1198

Query  522   ITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLAKV  346
                 +SVSLNK+G  +    D   AR  + + +DI R+ A    S      D++VSL   
Sbjct  1199  WRRDVSVSLNKLGGARLRTGDAPGARKAFEEDVDIARKLAAMDDSNTEWLRDLSVSLNTT  1258

Query  345   ADVDRNIGNEKTAVDGFQEAIEMLQCL  265
              DV    G+   A+  ++E + +++ L
Sbjct  1259  GDVRLQTGDAPAALKAYEEGLVIIRKL  1285


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 4/127 (3%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
             L  +GD     GD A A+K ++E ++    L+     + E    +SVSL+KIGD++   +
Sbjct  1111  LNKVGDVQLRAGDTAGALKSYDEGLDIARELVGTDSSNTEWRRDVSVSLSKIGDVRLRTD  1170

Query  462   DLQAARSYYFQALDIRRN-AIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
             D   A   + +ALDIRR  A    +      DV+VSL K+       G+   A   F+E 
Sbjct  1171  DAAGAVKVFEEALDIRRKLAATDEANTDWRRDVSVSLNKLGGARLRTGDAPGARKAFEED  1230

Query  285   IEMLQCL  265
             +++ + L
Sbjct  1231  VDIARKL  1237


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = -3

Query  624  LGDCCRATGDAASAVKYFEESVNFLLKVPKDD---LEITHTLSVSLNKIGDLKYYDEDLQ  454
            +GD   + GDA+ A++  EES+  + ++   D   +E    +SV+LNKIGDL     D  
Sbjct  874  VGDLRLSGGDASGALQAHEESLQIVRQLSAADESNVEWRRDVSVALNKIGDLLAQSGDAA  933

Query  453  AARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             A   Y + LDI R+ A    +      DV+VSL ++ DV    G+   ++  ++EA+++
Sbjct  934  GALKAYEEDLDIARKLAASDEANTVWRRDVSVSLDRIGDVRLRGGDTAGSLKAYEEALDI  993

Query  276  LQCL  265
             + L
Sbjct  994  RRVL  997



>ref|WP_015282261.1| hypothetical protein [Thioflavicoccus mobilis]
 gb|AGA92134.1| hypothetical protein Thimo_3471 [Thioflavicoccus mobilis 8321]
Length=806

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 83/164 (51%), Gaps = 4/164 (2%)
 Frame = -3

Query  744  NNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
              +E+A++  +   E  R  + R+G T E    L   L  +G   RA G+  +A   F E
Sbjct  330  GELEAARAAFAESLEIGRRLLARVGETPEALRDLSISLDNVGKIDRALGELEAARAAFGE  389

Query  564  SVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            S+     LL    +  E    LS+SLN +G +     +L+AAR+ + ++L+IRR  + + 
Sbjct  390  SLEIRRRLLGRVGETPEALRDLSISLNNVGQIDQALGELEAARAAFGESLEIRRRLLGRV  449

Query  393  SQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
             + P    D+++SL  V  +D+ +G  + A   F E++E+ + L
Sbjct  450  GETPEALRDLSISLNNVGQIDQALGELEAARAAFGESLEIRRRL  493


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 80/164 (49%), Gaps = 4/164 (2%)
 Frame = -3

Query  744  NNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
              +E+A++      E  R  + R+G T E    L   L  +G   RA G+  +A   F E
Sbjct  618  GELEAARAAFGESLEIGRRLLGRVGETPEALRDLSVSLNNVGQIDRALGELEAARAAFGE  677

Query  564  SVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            S+     LL    +  E    LS+SLN +G +     +L+AAR+ + ++L+I R  + + 
Sbjct  678  SLEIGRRLLGRVGETPEALRDLSISLNNVGQIDQALGELEAARAAFGESLEIGRRLLGRV  737

Query  393  SQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
             + P    D+++SL  V  +D+ +G  + A   F E +E+ Q L
Sbjct  738  GETPEALRDLSISLNNVGQIDQALGELEAARAAFAEGLEIAQRL  781


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 80/160 (50%), Gaps = 4/160 (3%)
 Frame = -3

Query  744  NNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
              +E+A++      E  R  + R+G T E    L   L  +G   RA G+  +A   F E
Sbjct  474  GELEAARAAFGESLEIRRRLLGRVGETPEALRDLSVSLDNVGQIDRALGELEAARAAFGE  533

Query  564  SVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            S+     LL    +  E    LSVSL+ +G +     +L+AAR+ + ++L+IRR  + + 
Sbjct  534  SLEIGRRLLGRVGETPEALRDLSVSLDNVGQIDRALGELEAARAAFGESLEIRRRLLGRV  593

Query  393  SQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + P    D+++SL  V  +D+ +G  + A   F E++E+
Sbjct  594  GETPEALRDLSISLNNVGQIDQALGELEAARAAFGESLEI  633


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 79/160 (49%), Gaps = 4/160 (3%)
 Frame = -3

Query  744  NNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
              +E+A++      E  R  + R+G T E    L   L  +G   +A G+  +A   F E
Sbjct  570  GELEAARAAFGESLEIRRRLLGRVGETPEALRDLSISLNNVGQIDQALGELEAARAAFGE  629

Query  564  SVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            S+     LL    +  E    LSVSLN +G +     +L+AAR+ + ++L+I R  + + 
Sbjct  630  SLEIGRRLLGRVGETPEALRDLSVSLNNVGQIDRALGELEAARAAFGESLEIGRRLLGRV  689

Query  393  SQ-PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + P    D+++SL  V  +D+ +G  + A   F E++E+
Sbjct  690  GETPEALRDLSISLNNVGQIDQALGELEAARAAFGESLEI  729



>ref|WP_040555497.1| hypothetical protein, partial [Rheinheimera sp. A13L]
Length=634

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 8/156 (5%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L+IC    ++    +G++ ++   L   L  +GD  +  GD  +A   + +S+     L 
Sbjct  475  LAIC----QQLQSSLGDSLQVLRDLSVSLNKVGDIEQQLGDLHAAKSAYAQSLAIRQQLQ  530

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-D  370
                D L++   LSVSLNK+GD++    DLQAA++ Y Q+L IR+          Q + D
Sbjct  531  SSLGDSLQVLRDLSVSLNKVGDIEQQLGDLQAAKAAYTQSLVIRQQLQSSLGDSLQVLRD  590

Query  369  VAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            ++VSL KV D+ + +G+ + A   + +++ + Q L+
Sbjct  591  LSVSLNKVGDIGQQLGDLQAAKAAYAQSLAICQQLQ  626


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 82/150 (55%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++ R+G++ ++   L   L  +GD  +  GD  +A   + +S+    ++     D 
Sbjct  381  IRQQLQSRLGDSPQVLRDLSVSLEKVGDIGQQLGDLQAAKAAYAQSLAICQQLQSSLGDS  440

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVSL K+GD++    DLQAA++ Y Q+L I +          Q + D++VSL 
Sbjct  441  PQVLRDLSVSLEKVGDIEQQLGDLQAAKAAYTQSLAICQQLQSSLGDSLQVLRDLSVSLN  500

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV D+++ +G+   A   + +++ + Q L+
Sbjct  501  KVGDIEQQLGDLHAAKSAYAQSLAIRQQLQ  530


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 80/150 (53%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVER-MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++  +G++ ++   L      +GD  +  GD  +A   + +S+    ++     D 
Sbjct  285  IRQQLQSSLGDSPQVLRDLSVSWNNVGDIEQQLGDLHAAKAVYVQSLTIFQQLQSSLGDS  344

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVS N +GD++    DLQAA++ Y Q L IR+    +     Q + D++VSL 
Sbjct  345  PQVLRDLSVSWNNVGDIEQQLGDLQAAKAAYTQNLIIRQQLQSRLGDSPQVLRDLSVSLE  404

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV D+ + +G+ + A   + +++ + Q L+
Sbjct  405  KVGDIGQQLGDLQAAKAAYAQSLAICQQLQ  434



>gb|EGM76114.1| hypothetical protein Rhein_3833 [Rheinheimera sp. A13L]
Length=756

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 85/157 (54%), Gaps = 10/157 (6%)
 Frame = -3

Query  717  LSICAEDIREQVER-MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---L  550
            L+IC     +Q++  +G++ ++   L   L  +GD  +  GD  +A   + +S+     L
Sbjct  475  LAIC-----QQLQSSLGDSLQVLRDLSVSLNKVGDIEQQLGDLHAAKSAYAQSLAIRQQL  529

Query  549  LKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-  373
                 D L++   LSVSLNK+GD++    DLQAA++ Y Q+L IR+          Q + 
Sbjct  530  QSSLGDSLQVLRDLSVSLNKVGDIEQQLGDLQAAKAAYTQSLVIRQQLQSSLGDSLQVLR  589

Query  372  DVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            D++VSL KV D+ + +G+ + A   + +++ + Q L+
Sbjct  590  DLSVSLNKVGDIGQQLGDLQAAKAAYAQSLAICQQLQ  626


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 82/150 (55%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++ R+G++ ++   L   L  +GD  +  GD  +A   + +S+    ++     D 
Sbjct  381  IRQQLQSRLGDSPQVLRDLSVSLEKVGDIGQQLGDLQAAKAAYAQSLAICQQLQSSLGDS  440

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVSL K+GD++    DLQAA++ Y Q+L I +          Q + D++VSL 
Sbjct  441  PQVLRDLSVSLEKVGDIEQQLGDLQAAKAAYTQSLAICQQLQSSLGDSLQVLRDLSVSLN  500

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV D+++ +G+   A   + +++ + Q L+
Sbjct  501  KVGDIEQQLGDLHAAKSAYAQSLAIRQQLQ  530


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 80/150 (53%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVER-MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++  +G++ ++   L      +GD  +  GD  +A   + +S+    ++     D 
Sbjct  285  IRQQLQSSLGDSPQVLRDLSVSWNNVGDIEQQLGDLHAAKAVYVQSLTIFQQLQSSLGDS  344

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVS N +GD++    DLQAA++ Y Q L IR+    +     Q + D++VSL 
Sbjct  345  PQVLRDLSVSWNNVGDIEQQLGDLQAAKAAYTQNLIIRQQLQSRLGDSPQVLRDLSVSLE  404

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV D+ + +G+ + A   + +++ + Q L+
Sbjct  405  KVGDIGQQLGDLQAAKAAYAQSLAICQQLQ  434



>ref|WP_035536799.1| hypothetical protein [Hyphomonas oceanitis]
Length=787

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 7/162 (4%)
 Frame = -3

Query  642  GAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKY  472
            G  L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++ 
Sbjct  206  GVCLDELGDVEIASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEV  265

Query  471  YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGF  295
               +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F
Sbjct  266  ASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHF  325

Query  294  QEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  326  EEGLEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  364


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  257  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  316

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  317  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  376

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  377  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  412


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  305  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  364

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  365  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  424

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  425  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  460


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  353  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  412

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  413  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  472

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  473  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  508


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 80/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  401  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  460

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  461  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  520

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV  FL+ +LG  E  +G
Sbjct  521  LEVARALSAASPESASAKRDVSV--FLD-KLGNVEVVTG  556



>ref|XP_002602756.1| hypothetical protein BRAFLDRAFT_93702 [Branchiostoma floridae]
 gb|EEN58768.1| hypothetical protein BRAFLDRAFT_93702 [Branchiostoma floridae]
Length=1562

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 68/128 (53%), Gaps = 7/128 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
            +   L  LG+  R  GD   AV Y+E+S+   L +  +D    H  ++ SLN IGD    
Sbjct  775  IAGSLNNLGNAWRNLGDHRKAVSYYEQSLQMKLSIYGED--TAHPDIAGSLNNIGDTWSN  832

Query  468  DEDLQAARSYYFQALDIRRNAIKQ----HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVD  301
              D + A SYY Q+L ++R+  +     + + +   D+A SL  + +  RN+G+ + AV 
Sbjct  833  LGDHRKAISYYEQSLQMKRSIYEMKRSIYGEDTAHPDIAASLNNMGNAWRNLGDHRKAVS  892

Query  300  GFQEAIEM  277
             +++A++M
Sbjct  893  YYEQALQM  900


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 68/132 (52%), Gaps = 7/132 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
            + A L  +G+  R  GD   AV Y+E+++     +  +D    H  ++ SLN +GD    
Sbjct  870  IAASLNNMGNAWRNLGDHRKAVSYYEQALQMKRSIYGED--TAHPDIADSLNNMGDAWSN  927

Query  468  DEDLQAARSYYFQALDIRRNAIKQ----HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVD  301
              D + A SYY QAL++ R+  +     + + +   D+A SL  +     N+G+ + A+ 
Sbjct  928  LGDNRKAISYYEQALEMNRSIYEMRRSIYGEDTAHPDIASSLNNLGGAWTNLGDHRKAIS  987

Query  300  GFQEAIEMLQCL  265
             +++A+EM + +
Sbjct  988  YYEQALEMRRSI  999


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
             + A L  LG+     GD   A+ Y+E+++     +  +D    H  ++ SLN +G     
Sbjct  1009  IAASLNNLGNAWSDLGDNRKAISYYEQALEMRRSIYGED--TAHPDIASSLNNLGGAWTN  1066

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
               D + A SYY QAL++RR+    + + +   D+A SL  +     N+G  + A+  +++
Sbjct  1067  LGDHRKAISYYEQALEMRRSI---YGEDTAHPDIASSLNNLGGAWTNLGGHRKAISYYEQ  1123

Query  288   AIEMLQCL  265
             A+EM + +
Sbjct  1124  ALEMRRSI  1131


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 64/121 (53%), Gaps = 8/121 (7%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDL  457
            L  LG      GD   A+ Y+E+S+  +  V  +D    H  ++ SLN +G       D 
Sbjct  691  LNNLGATWSNLGDNRKAISYYEQSLQMMRSVYGED--TAHPDIADSLNNLGGAWRNLGDH  748

Query  456  QAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIE  280
            + A SYY QAL+++R    + ++ P    D+A SL  + +  RN+G+ + AV  ++++++
Sbjct  749  RKAISYYEQALEMKRGIYGEDNAHP----DIAGSLNNLGNAWRNLGDHRKAVSYYEQSLQ  804

Query  279  M  277
            M
Sbjct  805  M  805


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 74/159 (47%), Gaps = 21/159 (13%)
 Frame = -3

Query  735  ESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVN  556
            +S + +LSI  ED                 +   L  +GD     GD   A+ Y+E+S+ 
Sbjct  801  QSLQMKLSIYGEDTAH------------PDIAGSLNNIGDTWSNLGDHRKAISYYEQSLQ  848

Query  555  -----FLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
                 + +K      +  H  ++ SLN +G+      D + A SYY QAL ++R+    +
Sbjct  849  MKRSIYEMKRSIYGEDTAHPDIAASLNNMGNAWRNLGDHRKAVSYYEQALQMKRSI---Y  905

Query  393  SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + +   D+A SL  + D   N+G+ + A+  +++A+EM
Sbjct  906  GEDTAHPDIADSLNNMGDAWSNLGDNRKAISYYEQALEM  944


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + + L  LG      GD   A+ Y+E+++     +  +D    + ++ SLN +G+     
Sbjct  965   IASSLNNLGGAWTNLGDHRKAISYYEQALEMRRSIYGEDTAHPN-IAASLNNLGNAWSDL  1023

Query  465   EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
              D + A SYY QAL++RR+    + + +   D+A SL  +     N+G+ + A+  +++A
Sbjct  1024  GDNRKAISYYEQALEMRRSI---YGEDTAHPDIASSLNNLGGAWTNLGDHRKAISYYEQA  1080

Query  285   IEMLQCL  265
             +EM + +
Sbjct  1081  LEMRRSI  1087



>ref|WP_040055500.1| hypothetical protein, partial [Candidatus Microthrix parvicella]
Length=228

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 10/149 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF------LLK  544
            AED+ E++     T E        L  LGD  RA GD   A   ++ S+N        L 
Sbjct  2    AEDLAERLAEQLGTPEALRDHSISLSNLGDVYRAQGDWTQAEAAYQSSLNIGERLAEQLG  61

Query  543  VPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVA  364
             P    E     SVSLNKIGD+     D   A + Y  +L+IR+   +Q   P    D +
Sbjct  62   TP----EALRDHSVSLNKIGDVYRAQGDWTQAEASYQSSLNIRQRLAEQLGTPEALRDHS  117

Query  363  VSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
            +SL+ + DV R  G+   A   +Q ++ +
Sbjct  118  ISLSNLGDVYRAQGDWTQAEAAYQSSLNI  146



>gb|KDA03220.1| SEFIR domain-containing protein [Hyphomonas oceanitis SCH89]
Length=791

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 7/162 (4%)
 Frame = -3

Query  642  GAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKY  472
            G  L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++ 
Sbjct  210  GVCLDELGDVEIASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEV  269

Query  471  YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGF  295
               +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F
Sbjct  270  ASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHF  329

Query  294  QEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  330  EEGLEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  368


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  261  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  320

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  321  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  380

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  381  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  416


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  309  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  368

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  369  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  428

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  429  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  464


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  357  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  416

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  417  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  476

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV   LN +LG  E  SG
Sbjct  477  LEVARALSAASPESAQAKRDVSV--SLN-KLGDVEVASG  512


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 80/159 (50%), Gaps = 7/159 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
            L  LGD   A+G+   A  +FEE +     L     +  +    +SVSLNK+GD++    
Sbjct  405  LNKLGDVEVASGNLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASG  464

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
            +L  AR ++ + L++ R       + +Q   DV+VSL K+ DV+   GN   A   F+E 
Sbjct  465  NLVVARGHFEEGLEVARALSAASPESAQAKRDVSVSLNKLGDVEVASGNLVVARGHFEEG  524

Query  285  IEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGKKETNSG  169
            +E+ + L     E    +R +SV  FL+ +LG  E  +G
Sbjct  525  LEVARALSAASPESASAKRDVSV--FLD-KLGNVEVVTG  560



>gb|KFE68107.1| TPR repeat protein [Hyalangium minutum]
Length=1104

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = -3

Query  693  REQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLE  523
            R+    +G++      L   L  +GD     GD  +A   +EES+     L     D   
Sbjct  332  RQLRSSLGDSPTALRDLSVSLERMGDVRLDLGDLNAAAAAYEESLALRRQLRSSLGDSPT  391

Query  522  ITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKV  346
                LSVSLNK+GD++    DL A+ + Y ++L +RR         P+   D++VSL K+
Sbjct  392  ALRDLSVSLNKVGDVRRDLSDLNASAAAYEESLALRRQLRSSLGDSPTALRDLSVSLTKM  451

Query  345  ADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
             DV R++G+   A   ++E++ + + L+
Sbjct  452  GDVRRDLGDLNAAAAAYEESLALCRQLR  479


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = -3

Query  693   REQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLE  523
             R+    +G++  +   L   L  +GD  R  GD   A   +EES+     L     D L 
Sbjct  908   RQLRSSLGDSLAVLRDLSVSLTKMGDARRDLGDLNVAAAAYEESLALSRHLRSSLSDSLT  967

Query  522   ITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKV  346
                 LS+S N++GD++    DL AA + Y ++L + R       + P+   D++VSL KV
Sbjct  968   ALRDLSISFNRVGDVRRDLSDLNAAAAAYEESLALCRQLRSSCGNSPTALRDLSVSLNKV  1027

Query  345   ADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
              DV  ++G+   A   F+E++ + + L+
Sbjct  1028  GDVRLDLGDLSAATAAFEESLALCRQLR  1055


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 68/137 (50%), Gaps = 8/137 (6%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L++C    R+    +G++      L   L  +GD  R  GD  +A   +EES+     L 
Sbjct  760  LALC----RQLRSSLGDSPTALRNLSVSLTKMGDVRRDLGDLNAAAAAYEESLALCRQLR  815

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTID  370
                D       LSVSLNK+GD++    DL AA + + ++L +RR         P+   D
Sbjct  816  SSLGDSPTALRDLSVSLNKVGDVRRDLSDLNAAAAAHEESLALRRQLRSSLGDSPTALRD  875

Query  369  VAVSLAKVADVDRNIGN  319
            ++VSL K+ DV R++G+
Sbjct  876  LSVSLTKMGDVRRDLGD  892


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 8/156 (5%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L++C    R+    +G++      L   L  +GD  R  GD   A   +EES+     L 
Sbjct  472  LALC----RQLRSSLGDSPAALRDLSVSLTKMGDARRDLGDLNVAAAAYEESLALSRHLR  527

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDI-RRNAIKQHSQPSQTID  370
                D       LS+SLN +GD++    DL AA + Y ++L + R+        P+   D
Sbjct  528  SSLSDSPTALRDLSISLNGVGDVRRDLGDLNAAAAAYEESLALCRQLRSSLGDSPTALRD  587

Query  369  VAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            ++VSL +V DV R++G+   A   ++E + + + L+
Sbjct  588  LSVSLTRVGDVRRDLGDLNAATAAYEEFLALCRQLR  623


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 8/156 (5%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L++C    R+    +G++      L   L  +GD  R  GD  +A   +EE +     L 
Sbjct  568  LALC----RQLRSSLGDSPTALRDLSVSLTRVGDVRRDLGDLNAATAAYEEFLALCRQLR  623

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTID  370
                D       LSVSL K+GD +    DL AA + Y ++L +RR         P+   D
Sbjct  624  SSLGDSPAALRDLSVSLEKVGDARLDLGDLNAAAAAYEESLALRRQLRSSLGDSPTALRD  683

Query  369  VAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            ++VSL KV DV R++ +   +   ++E++ + + L+
Sbjct  684  LSVSLNKVGDVRRDLSDLNASAAAYEESLALCRQLR  719


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 5/165 (3%)
 Frame = -3

Query  696  IREQV-ERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDD  529
            +R Q+   +G++      L   L  +GD  R   D  ++   +EES+     L     D 
Sbjct  666  LRRQLRSSLGDSPTALRDLSVSLNKVGDVRRDLSDLNASAAAYEESLALCRQLRSSLGDS  725

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLA  352
                  LSVSL K+GD++    DL AA + Y ++L + R+        P+   +++VSL 
Sbjct  726  PAALRDLSVSLTKMGDVRRDLGDLNAAAAAYEESLALCRQLRSSLGDSPTALRNLSVSLT  785

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSV  217
            K+ DV R++G+   A   ++E++ + + L+ +  +     R LSV
Sbjct  786  KMGDVRRDLGDLNAAAAAYEESLALCRQLRSSLGDSPTALRDLSV  830



>ref|WP_035304088.1| hypothetical protein, partial [Brevundimonas aveniformis]
Length=330

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 73/145 (50%), Gaps = 6/145 (4%)
 Frame = -3

Query  684  VERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESV----NFLLKVPKDDLEIT  517
            V+R    +E    L      LGD   A GD  +A   ++ S+    + + + PK+  E  
Sbjct  91   VDRDPKNTEWLRDLSVSHNKLGDIATAEGDLPAAKNAYQASLEIAQDLVDRDPKN-TEWL  149

Query  516  HTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVAD  340
              LSVS NK+GD+   + DL AAR  Y   LDI ++   +  + ++ + D++VS  ++ D
Sbjct  150  RDLSVSHNKLGDIATAEGDLPAARHAYQAGLDIAQDLANRDPKKTEWLRDLSVSHDRLGD  209

Query  339  VDRNIGNEKTAVDGFQEAIEMLQCL  265
            + R  G+   A D +Q ++ + Q L
Sbjct  210  IARAEGDLPAAKDAYQHSLYIRQDL  234


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (51%), Gaps = 6/136 (4%)
 Frame = -3

Query  678  RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESV----NFLLKVPKDDLEITHT  511
            R    +E    L      LGD  RA GD  +A   ++ S+    +   + PK+  E    
Sbjct  189  RDPKKTEWLRDLSVSHDRLGDIARAEGDLPAAKDAYQHSLYIRQDLANRDPKN-TEWLRD  247

Query  510  LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVD  334
            +SVS NK+GD+   + DL AA++ Y  +LDIR+    +  + +Q + D+A+S AK+A + 
Sbjct  248  VSVSHNKLGDIATAEGDLPAAKNAYQASLDIRQELANRDPKNTQWLRDLAISAAKLAQLA  307

Query  333  RNIGNEKTAVDGFQEA  286
               G+   A  GF EA
Sbjct  308  EAEGDRAAARAGFLEA  323


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 68/130 (52%), Gaps = 4/130 (3%)
 Frame = -3

Query  642  GAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDD---LEITHTLSVSLNKIGDLKY  472
             A L  LGD  RA GD  +A   ++ S+     + K D    E    LSVS +K+GD+  
Sbjct  9    AAALDDLGDIARAEGDLNAARHAYQASLEIAQDLAKRDPKNTEWLRDLSVSHDKLGDIAT  68

Query  471  YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVDGF  295
             + DL AAR  Y   L+I ++ + +  + ++ + D++VS  K+ D+    G+   A + +
Sbjct  69   AEGDLPAARHAYQDGLEIAQDLVDRDPKNTEWLRDLSVSHNKLGDIATAEGDLPAAKNAY  128

Query  294  QEAIEMLQCL  265
            Q ++E+ Q L
Sbjct  129  QASLEIAQDL  138



>ref|WP_018302711.1| hypothetical protein [Wenxinia marina]
 gb|KIQ70549.1| TIR domain protein/Tetratricopeptide repeat protein [Wenxinia 
marina DSM 24838]
Length=1016

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 76/159 (48%), Gaps = 11/159 (7%)
 Frame = -3

Query  672  GNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLE---ITHTLSV  502
            GNT      L   L  LGD     GDA +A++ +E S+  + ++   D         +S+
Sbjct  552  GNTM-WQRDLAITLNNLGDVSLLAGDAGAAMEAYERSLGIVRRLSASDPGNAVWRRDVSI  610

Query  501  SLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQT---IDVAVSLAKVADVDR  331
             LN +GDL+    DL AA   Y ++LDI R+     S P  T    DV V L +V D+  
Sbjct  611  GLNNVGDLRRRAGDLSAALDAYIESLDIVRDLAA--SDPGNTEWQRDVTVGLERVGDLGL  668

Query  330  NIGNEKTAVDGFQEAIEMLQCL-KLNPEEVGLEQRRLSV  217
             +G+   A   +++ +++ + L  L+P      QR LSV
Sbjct  669  QMGDRAAAEGAYRDGLDIRRRLAALDPGNTQW-QRDLSV  706



>ref|WP_034990952.1| hypothetical protein [Beijerinckia mobilis]
Length=474

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 4/121 (3%)
 Frame = -3

Query  627  MLGDCCRATGDAASAVKYFEESVNFLLKVPKDD---LEITHTLSVSLNKIGDLKYYDEDL  457
            M+GD  RA GD   A++ +E S+    K+   D    E    ++V+L K G++K    D 
Sbjct  136  MIGDMKRAAGDLRGALEAYESSLGAERKLAVADPGNAEWQRDVAVNLIKSGEIKQSIGDH  195

Query  456  QAARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIE  280
            + AR  Y + L I RR      +      DVAV L  V DV R+IG++KTA++ +  +++
Sbjct  196  KGAREAYKEGLTIARRLLANDEANQEWQHDVAVGLFMVGDVSRDIGDQKTAIESYLASLD  255

Query  279  M  277
            M
Sbjct  256  M  256



>gb|ETK07947.1| hypothetical protein T231_14820 [Tannerella sp. oral taxon BU063 
isolate Cell 6/7/9]
Length=444

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 90/179 (50%), Gaps = 8/179 (4%)
 Frame = -3

Query  771  HHAMRAF---RANNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRAT  601
            HH   A+     N+ E A +   +  +++RE  ++  N       +   L  LG   R  
Sbjct  236  HHFKYAYLLQSLNDFEKAINLYEMVLKELRELAKQ--NPEAYNPDMALTLNTLGCLLRVA  293

Query  600  GDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQAL  424
             D   A  +FEE++    K+ K + E  +  +++SLN +G L     D + A++++ +AL
Sbjct  294  NDFKQAQSHFEEALEIYRKLTKLNPEAYNPYVAMSLNNLGCLLRVTNDFKQAQAHFEEAL  353

Query  423  DIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL-KLNPE  250
            +IRR   KQ+ +  +   +A +L  + ++ R+  + K A   F+EA+E+ + L K NPE
Sbjct  354  EIRRELAKQNPEAYKP-HMATTLNNLGNLLRDTNDLKQAQAYFEEALEIYRELAKQNPE  411



>ref|WP_034935348.1| hypothetical protein, partial [Candidatus Accumulibacter sp. 
SK-12]
Length=211

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 81/169 (48%), Gaps = 8/169 (5%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDL  478
             L   L  +GD     GD A+A   + ES+     L     D  +    LS+SLNK+G +
Sbjct  11   HLAIALANVGDAGEQLGDLAAARAAYGESLELCRQLRASLGDTPQALRDLSISLNKVGGV  70

Query  477  KYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVD  301
                 DL+AA + Y ++LD+RR          Q + D+++SL KV  VD  +G+   A  
Sbjct  71   DAQLGDLEAAHAAYGESLDLRRQLRASLGDTPQALRDLSISLDKVGGVDEQLGDLAAARG  130

Query  300  GFQEAIEMLQCLKLNPEEVGLEQRRLSV----LEFLNSQLGKKETNSGS  166
             + E++++ + L+ +  +     R LS+    +  ++ +LG  E   G+
Sbjct  131  AYGESLDLRRQLRASLGDTPQVLRDLSISLNKVAGVDERLGDLEAARGA  179



>ref|XP_002588168.1| hypothetical protein BRAFLDRAFT_68806 [Branchiostoma floridae]
 gb|EEN44179.1| hypothetical protein BRAFLDRAFT_68806 [Branchiostoma floridae]
Length=1589

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 87/164 (53%), Gaps = 12/164 (7%)
 Frame = -3

Query  744   NNVESAKSRLSICAEDIR--EQVERM-----GNTSELCSQLGAVLGMLGDCCRATGDAAS  586
             NN+ S  SRL   ++ ++  E   +M     G+T+     + A L  +G C    GD + 
Sbjct  1070  NNIGSCWSRLGDQSKALKYYELSLKMRKAIYGDTTPH-PDIAASLNNIGKCWSDLGDQSK  1128

Query  585   AVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNA  406
             +++Y+E+S+N ++K    +      ++ SL+ IG       D + A +YY QAL +R+N 
Sbjct  1129  SIRYYEQSLN-MIKTIYGETAKHPDIASSLHNIGTCWSDLGDHKTAITYYKQALKMRKNI  1187

Query  405   IKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEML  274
                +S+ ++  D+A SL  +      +G+++ A+  ++++++ML
Sbjct  1188  ---YSETTEHPDIASSLMNIGACFMKLGDQRKAISSYEQSLKML  1228


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 4/123 (3%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + + L  +G C    GD   A+  +E+S+  LL +   + E    +++ LN IG+     
Sbjct  1197  IASSLMNIGACFMKLGDQRKAISSYEQSLKMLLAI-YSETEQHPDIAICLNNIGNCLNLL  1255

Query  465   EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
              D   A +YY QAL +R+ AI   + P    D++ SL+ +      +GN+  A+  F+++
Sbjct  1256  GDQTKAITYYEQALKMRK-AIYGETTPHP--DISSSLSNIGSCWGAVGNQGKAMSYFEQS  1312

Query  285   IEM  277
             +EM
Sbjct  1313  LEM  1315



>ref|XP_002602188.1| hypothetical protein BRAFLDRAFT_216744 [Branchiostoma floridae]
 gb|EEN58200.1| hypothetical protein BRAFLDRAFT_216744, partial [Branchiostoma 
floridae]
Length=204

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 81/161 (50%), Gaps = 24/161 (15%)
 Frame = -3

Query  735  ESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVN  556
            +S + R SI  ED         N ++  + LG   G LGD  +A       + Y+++S+ 
Sbjct  64   QSLQMRRSIYGEDTAHP-----NIADSLNNLGNAWGNLGDYIKA-------ISYYKQSLQ  111

Query  555  FLLKVPKDDL---EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS-Q  388
               ++  ++    +I  +LS   N  G+L     D + A SYY Q+L +RR+   +++  
Sbjct  112  IKRRIYGEETAHPDIAGSLSNMGNAWGNLG----DYRKAVSYYEQSLQLRRSIYGEYTAH  167

Query  387  PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            P    D+A SL  + +  RN+G+ + A+   ++A++M++ +
Sbjct  168  P----DIADSLTNLGNAWRNLGDHEKAISYHEQALDMIRSI  204



>ref|XP_002602191.1| hypothetical protein BRAFLDRAFT_76878 [Branchiostoma floridae]
 gb|EEN58203.1| hypothetical protein BRAFLDRAFT_76878 [Branchiostoma floridae]
Length=685

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYY  469
            ++ A L  +G     +GD   A+ Y+E+S+   L + ++D      ++ SLN +G+    
Sbjct  145  EIAASLNNMGTPGETSGDHRKAISYYEQSLQMKLSIYRED-NAHPDIAASLNNMGNAWRD  203

Query  468  DEDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
              D + A SYY Q+L +RR+   K  + P    ++A SL  +    RN+G+ + A+  ++
Sbjct  204  LGDHRKAISYYAQSLQMRRSIYGKNTAHP----EIAASLNNMGTAWRNLGDHRKAISYYE  259

Query  291  EAIEMLQCL  265
            +A++M + +
Sbjct  260  QALQMRRSI  268


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 67/124 (54%), Gaps = 6/124 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
            + A L  LG  C   GD   A+ Y+E+S+  +  +  +D      ++ SLN +G+     
Sbjct  366  IAASLNNLGATCSNLGDHRKAISYYEQSLQMMRSIYGED-NAHPDIAGSLNNMGNAWSNL  424

Query  465  EDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
             D + A SYY QAL ++R+  ++ ++ P    D+A SL  + +   N+G+ + AV  +++
Sbjct  425  GDHRKAVSYYEQALQMKRSICREDNAHP----DIADSLNNLGNACSNLGDNRKAVSYYEQ  480

Query  288  AIEM  277
            A+EM
Sbjct  481  ALEM  484


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYY  469
            ++ A L  +G   R  GD   A+ Y+E+++     + ++D      ++ SLN +G     
Sbjct  233  EIAASLNNMGTAWRNLGDHRKAISYYEQALQMRRSICRED-NAHPNIAASLNNLGATWRN  291

Query  468  DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY Q+L +RR+    + + +   D+A SL  +    RN+G+ + A+  +++
Sbjct  292  LGDHRKAISYYEQSLQMRRSI---YGEDTAHPDIAASLNNMGTAWRNLGDHRKAISYYEQ  348

Query  288  AIEMLQCL  265
            A++M + +
Sbjct  349  ALQMKRSI  356


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 74/154 (48%), Gaps = 20/154 (13%)
 Frame = -3

Query  720  RLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKV  541
            R SIC ED                 + A L  LG   R  GD   A+ Y+E+S+     +
Sbjct  265  RRSICRED------------NAHPNIAASLNNLGATWRNLGDHRKAISYYEQSLQMRRSI  312

Query  540  PKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDV  367
              +D    H  ++ SLN +G       D + A SYY QAL ++R+  ++ ++ P    ++
Sbjct  313  YGED--TAHPDIAASLNNMGTAWRNLGDHRKAISYYEQALQMKRSICREDNAHP----NI  366

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            A SL  +     N+G+ + A+  ++++++M++ +
Sbjct  367  AASLNNLGATCSNLGDHRKAISYYEQSLQMMRSI  400


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
            +   L  +G+     GD   AV Y+E+++     + ++D      ++ SLN +G+     
Sbjct  410  IAGSLNNMGNAWSNLGDHRKAVSYYEQALQMKRSICRED-NAHPDIADSLNNLGNACSNL  468

Query  465  EDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
             D + A SYY QAL++RR+   K+ + P    ++A SL  +     N+G+ + A+  F +
Sbjct  469  GDNRKAVSYYEQALEMRRSTYGKRTAHP----NIASSLNNLGGAWTNLGDHRKAISYFDQ  524

Query  288  AIEMLQCL  265
            A+EM + +
Sbjct  525  ALEMRRSI  532



>ref|XP_002946777.1| hypothetical protein VOLCADRAFT_87094 [Volvox carteri f. nagariensis]
 gb|EFJ52003.1| hypothetical protein VOLCADRAFT_87094 [Volvox carteri f. nagariensis]
Length=520

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 60/139 (43%), Gaps = 29/139 (21%)
 Frame = -3

Query  666  TSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKI  487
            +SE   +LG +LG   DC R  GD A+A++Y+  S+  L        E    +SV+ NK 
Sbjct  239  SSETAIRLGTILGCKADCYRRLGDPAAALRYYAASLICLAHWRGRSREADSAISVTHNKQ  298

Query  486  GDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI----------------------  373
            GDL +    L  A+  Y  AL+IRR  +       +T+                      
Sbjct  299  GDLLFMSGRLAEAKEQYEAALEIRREVVSAGPPVRETVAKGANGEAALATGAGAEGCAQV  358

Query  372  -------DVAVSLAKVADV  337
                   D+AVSL KVADV
Sbjct  359  AVVQDLCDLAVSLCKVADV  377



>ref|WP_044189888.1| hypothetical protein, partial [Hyalangium minutum]
Length=377

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 68/137 (50%), Gaps = 8/137 (6%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L++C    R+    +G++      L   L  +GD  R  GD  +A   +EES+     L 
Sbjct  220  LALC----RQLRSSLGDSPTALRNLSVSLTKMGDVRRDLGDLNAAAAAYEESLALCRQLR  275

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTID  370
                D       LSVSLNK+GD++    DL AA + + ++L +RR         P+   D
Sbjct  276  SSLGDSPTALRDLSVSLNKVGDVRRDLSDLNAAAAAHEESLALRRQLRSSLGDSPTALRD  335

Query  369  VAVSLAKVADVDRNIGN  319
            ++VSL K+ DV R++G+
Sbjct  336  LSVSLTKMGDVRRDLGD  352


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 8/156 (5%)
 Frame = -3

Query  717  LSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LL  547
            L++C    R+    +G++      L   L  +GD  R  GD  +A   +EE +     L 
Sbjct  28   LALC----RQLRSSLGDSPTALRDLSVSLTRVGDVRRDLGDLNAATAAYEEFLALCRQLR  83

Query  546  KVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQ-HSQPSQTID  370
                D       LSVSL K+GD +    DL AA + Y ++L +RR         P+   D
Sbjct  84   SSLGDSPAALRDLSVSLEKVGDARLDLGDLNAAAAAYEESLALRRQLRSSLGDSPTALRD  143

Query  369  VAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            ++VSL KV DV R++ +   +   ++E++ + + L+
Sbjct  144  LSVSLNKVGDVRRDLSDLNASAAAYEESLALCRQLR  179


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 5/165 (3%)
 Frame = -3

Query  696  IREQV-ERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDD  529
            +R Q+   +G++      L   L  +GD  R   D  ++   +EES+     L     D 
Sbjct  126  LRRQLRSSLGDSPTALRDLSVSLNKVGDVRRDLSDLNASAAAYEESLALCRQLRSSLGDS  185

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLA  352
                  LSVSL K+GD++    DL AA + Y ++L + R+        P+   +++VSL 
Sbjct  186  PAALRDLSVSLTKMGDVRRDLGDLNAAAAAYEESLALCRQLRSSLGDSPTALRNLSVSLT  245

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSV  217
            K+ DV R++G+   A   ++E++ + + L+ +  +     R LSV
Sbjct  246  KMGDVRRDLGDLNAAAAAYEESLALCRQLRSSLGDSPTALRDLSV  290



>gb|EIC20019.1| hypothetical protein Thi970DRAFT_03631 [Thiorhodovibrio sp. 970]
Length=1411

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (53%), Gaps = 8/125 (6%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDE  463
             L  +GD     G + +A+  F E +     L     D+L     L++SLN+IGDL+    
Sbjct  1068  LTKVGDLHLTVGKSRAALAAFSEGLELSRELAVRDPDNLVWLRDLTISLNRIGDLRLRSG  1127

Query  462   DLQAARSYYFQALDIRRNAIKQHSQPSQTI---DVAVSLAKVADVDRNIGNEKTAVDGFQ  292
             ++  A  YY +ALDI R+   +   P+  +   D+A+SL KV D+    G+   A+D ++
Sbjct  1128  EVNQALDYYQEALDIARDLTAE--DPNNRVWGRDLAISLNKVGDILVQQGDPPAALDLYR  1185

Query  291   EAIEM  277
             E++E+
Sbjct  1186  ESLEI  1190


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 69/139 (50%), Gaps = 4/139 (3%)
 Frame = -3

Query  669   NTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDL---EITHTLSVS  499
             + +E    L   L  +GD  + +G A +A+  +EE++     +   D         +S++
Sbjct  864   DNAEAQRDLSVTLDRIGDIEKESGQAEAALTAYEETLAISRALAAGDATNARWQRDVSIA  923

Query  498   LNKIGDLKYYDEDLQAARSYYFQALDIRRN-AIKQHSQPSQTIDVAVSLAKVADVDRNIG  322
               K+GD+     D   A + Y + L  RR+ A ++ + P+   D+AVSL K  DV    G
Sbjct  924   WEKVGDISLQQGDAAGALAAYEEVLATRRSLAKREPNSPTARRDLAVSLNKTGDVRVLRG  983

Query  321   NEKTAVDGFQEAIEMLQCL  265
             + + A+  +QEA+ ++Q L
Sbjct  984   DTQGALAAYQEAMTLVQVL  1002


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 64/143 (45%), Gaps = 4/143 (3%)
 Frame = -3

Query  693   REQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES---VNFLLKVPKDDLE  523
             R   +R  N+      L   L   GD     GD   A+  ++E+   V  L+    D+ +
Sbjct  952   RSLAKREPNSPTARRDLAVSLNKTGDVRVLRGDTQGALAAYQEAMTLVQVLVASDPDNTK  1011

Query  522   ITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKV  346
               H LSV+  +IG+++       AA + Y   L IRR   +   + S  I D  V+L KV
Sbjct  1012  WQHDLSVTQERIGNIQLQLGQTDAALTSYENVLGIRRALSESDPENSDWIRDTLVALTKV  1071

Query  345   ADVDRNIGNEKTAVDGFQEAIEM  277
              D+   +G  + A+  F E +E+
Sbjct  1072  GDLHLTVGKSRAALAAFSEGLEL  1094



>ref|XP_002602757.1| hypothetical protein BRAFLDRAFT_93703 [Branchiostoma floridae]
 gb|EEN58769.1| hypothetical protein BRAFLDRAFT_93703 [Branchiostoma floridae]
Length=2103

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 6/124 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
             +   L  LG+     GD   A+ Y+E+++   L +  +D    H  ++ SLN +GD    
Sbjct  1014  IAGSLNNLGNAWSNLGDHRKAISYYEQALEMKLSIYGED--TAHPDIAASLNNMGDTWSN  1071

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
               D + A SYY QAL+++   +  + + +   D+A SL  + +  RN+G+ + A+  +++
Sbjct  1072  LGDNRKAISYYEQALEMK---LSIYGEDTAHPDIAASLNNMGNAWRNLGDNRKAISYYEQ  1128

Query  288   AIEM  277
             A+EM
Sbjct  1129  ALEM  1132


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + A L  +G+  R  GD   A+ Y+E+++     +  +D      ++ SLN +G+     
Sbjct  1203  IAASLNNMGNAWRNLGDHRKAISYYEQALEMRRSICGED-NAHPNIAASLNNLGNAWGNL  1261

Query  465   EDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QAL++RR+   K+ + P    D+A SL  +     N+G  + A+  +++
Sbjct  1262  GDHRKAISYYEQALEMRRSTYGKRTAHP----DIASSLNNLGGAWTNLGGHRKAISYYEQ  1317

Query  288   AIEMLQCL  265
             A+EM + +
Sbjct  1318  ALEMRRSI  1325


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + A L  LG+     GD   A+ Y+E+++     +  +D      ++ SLN +GD     
Sbjct  1379  IAASLNNLGNAWGDLGDHRKAISYYEQALEMRRSIYGED-NAHPNIAASLNNLGDAWGNL  1437

Query  465   EDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
                + A SYY QAL++RR+   K+ + P    D+A SL  +     N+G  + A+  +++
Sbjct  1438  GGHRKAISYYEQALEMRRSTYGKRTAHP----DIASSLNNLGGAWSNLGGHRKAISYYEQ  1493

Query  288   AIEMLQCL  265
             A+EM + +
Sbjct  1494  ALEMRRSI  1501


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDL  457
             L  LG+     GD + A+ Y+E+S+     +  +D    H  ++ SLN +G+      D 
Sbjct  974   LNNLGNARGDLGDNSKAISYYEQSLQMRRSIYGED--TAHPDIAGSLNNLGNAWSNLGDH  1031

Query  456   QAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + A SYY QAL+++   +  + + +   D+A SL  + D   N+G+ + A+  +++A+EM
Sbjct  1032  RKAISYYEQALEMK---LSIYGEDTAHPDIAASLNNMGDTWSNLGDNRKAISYYEQALEM  1088


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 61/118 (52%), Gaps = 6/118 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
             + A L  +GD     GD   A+ Y+E+++   L +  +D    H  ++ SLN +G+    
Sbjct  1058  IAASLNNMGDTWSNLGDNRKAISYYEQALEMKLSIYGED--TAHPDIAASLNNMGNAWRN  1115

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGF  295
               D + A SYY QAL++ R+    + + +   D+A SL  + +  RN+G+ + AV  +
Sbjct  1116  LGDNRKAISYYEQALEMNRSI---YGEDTAHPDIAASLNNMGNAWRNLGDHRKAVTTW  1170



>gb|ETK04187.1| hypothetical protein T229_10280 [Tannerella sp. oral taxon BU063 
isolate Cell 5]
Length=927

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 85/167 (51%), Gaps = 5/167 (3%)
 Frame = -3

Query  744  NNVESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
            N+ + A++      E  RE  ++  N+      +   L  LG   R   D   A  +FEE
Sbjct  613  NDFKQAQAYFEEALETCRELAKQ--NSEAYKPHMALTLNNLGSLLRVANDFKQAQSHFEE  670

Query  564  SVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQ  388
            ++    K+ K + E  +  +++SLN +G L     D + A++++ +AL+IRR   KQ+ +
Sbjct  671  ALEIYRKLTKLNPEAYNPYVAMSLNNLGCLLRVTNDFKQAQAHFEEALEIRRELAKQNPE  730

Query  387  PSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL-KLNPE  250
              +   +A +L  + ++ R+  + K A   F+EA+E+ + L K NPE
Sbjct  731  AYKP-HMATTLNNLGNLLRDTNDLKQAQAYFEEALEIYRELAKQNPE  776



>gb|EXI68493.1| putative ATPase [Candidatus Accumulibacter sp. SK-12]
Length=464

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 4/133 (3%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDL  478
             L   L  +GD     GD A+A   + ES+     L     D  +    LS+SLNK+G +
Sbjct  247  HLAIALANVGDAGEQLGDLAAARAAYGESLELCRQLRASLGDTPQALRDLSISLNKVGGV  306

Query  477  KYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAKVADVDRNIGNEKTAVD  301
                 DL+AA + Y ++LD+RR          Q + D+++SL KV  VD  +G+   A  
Sbjct  307  DAQLGDLEAAHAAYGESLDLRRQLRASLGDTPQALRDLSISLDKVGGVDEQLGDLAAARG  366

Query  300  GFQEAIEMLQCLK  262
             + E++++ + L+
Sbjct  367  AYGESLDLRRQLR  379



>ref|XP_002602181.1| hypothetical protein BRAFLDRAFT_76869 [Branchiostoma floridae]
 gb|EEN58193.1| hypothetical protein BRAFLDRAFT_76869 [Branchiostoma floridae]
Length=930

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 67/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
            + A L  LG+  R  G+   A+ Y+E+S+     +  +D    H  ++ SLN +G     
Sbjct  273  IAASLNNLGNAWRNLGNHRKAISYYEQSIQMKRSIYGED--TAHLDIAASLNNLGATWRN  330

Query  468  DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QA+ ++R+    + + +   D+A SL  +    RN+G+ + A+  +++
Sbjct  331  LGDYRKAISYYEQAIQMKRSI---YGEDTAHPDIAASLNNLGATWRNLGDHRKAISYYEQ  387

Query  288  AIEMLQCL  265
            A+EM + +
Sbjct  388  ALEMTRSI  395



>ref|XP_002602180.1| hypothetical protein BRAFLDRAFT_76868 [Branchiostoma floridae]
 gb|EEN58192.1| hypothetical protein BRAFLDRAFT_76868 [Branchiostoma floridae]
Length=1714

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 69/128 (54%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             +   L  +G+     GD   AV YF++++  +  +  +D      ++ SLN +G++    
Sbjct  1242  IAGSLHNMGNAWGNLGDHRKAVSYFDQALQMMRSIYGED-NAHPDIADSLNNMGNVWRNL  1300

Query  465   EDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QAL++ R    + ++ P    D+A SL  +A+V  N+G+ + AV  F++
Sbjct  1301  GDQRKAISYYEQALEMMRGIYGEGNAHP----DIAASLNNLANVWGNLGDHRKAVSYFEQ  1356

Query  288   AIEMLQCL  265
             A+EM + +
Sbjct  1357  ALEMTRSI  1364


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 69/128 (54%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
             +   L  +G+     GD   A+ Y+E+S+  +  +   D    H  ++ SLN +G++   
Sbjct  1042  IAGSLHNMGNAWGNLGDHRKAISYYEQSLQMMRSIYGKD--TAHPDIAESLNNMGNVWGN  1099

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
               D + A SYY QAL++RR+    + + +   ++A SL  + +  RN+G  + A+  +++
Sbjct  1100  LGDHRKAISYYEQALEMRRSI---YGEDTAHPEIAASLNNLGEAWRNLGYHRKAISYYEQ  1156

Query  288   AIEMLQCL  265
             +++M++ +
Sbjct  1157  SLQMMRSV  1164


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 68/129 (53%), Gaps = 4/129 (3%)
 Frame = -3

Query  651   SQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKY  472
             S + A L  LG      GD   A+ Y E++++ +  +  +D      +  SLN +G+   
Sbjct  1416  SDIAASLNNLGITWSNLGDHRKAISYHEQALDMMRDIYGED-NAHPDIVKSLNNLGNAWC  1474

Query  471   YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
               ED + A SYY QAL+I R+    +S+ +    +A SL  + +  RN+G+ + A+   +
Sbjct  1475  DLEDHRKAISYYEQALEIMRSI---YSEDTAHPYIAASLHNLGNAWRNLGDHRKAISYHE  1531

Query  291   EAIEMLQCL  265
             +A+EM++ +
Sbjct  1532  QALEMMRGI  1540


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 68/128 (53%), Gaps = 12/128 (9%)
 Frame = -3

Query  636   VLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDL---EITHTLSVSLNKIGDLKYYD  466
             +L  +G+ CR  GD   A+ Y+E+S+     +  +D    +I  +L    N   +L Y+ 
Sbjct  887   LLTNMGNACRNLGDYGKAISYYEQSLQMRRSIYGEDTAHPDIADSLHNMGNAWRNLGYHG  946

Query  465   EDLQAARSYYFQALDIRRNAIKQHS-QPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
             +    A SYY Q+L + R+   +++  P    D++ SL  + +V  N+G+ + A+  +++
Sbjct  947   K----AISYYEQSLQMMRSIYGENTAHP----DISGSLNNMGNVWGNLGDHRKAISYYEQ  998

Query  288   AIEMLQCL  265
             A+EM + +
Sbjct  999   ALEMTRSI  1006


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (48%), Gaps = 22/149 (15%)
 Frame = -3

Query  648   QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYY  469
             ++ A L  LG+  R  G    A+ Y+E+S+  +  V  +D      ++ SLN +G+    
Sbjct  1129  EIAASLNNLGEAWRNLGYHRKAISYYEQSLQMMRSVYGED-NAHPDIAGSLNNMGNAWGN  1187

Query  468   DEDLQAARSYYFQALDIR----------RNAIKQHSQPSQTI-----------DVAVSLA  352
               D + A SY+ QAL+++          R AI  + Q  Q +           D+A SL 
Sbjct  1188  LGDHRKAVSYFEQALEMKLSIYENLGDHRKAISYYEQSLQMMRSIYGEDNAHPDIAGSLH  1247

Query  351   KVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
              + +   N+G+ + AV  F +A++M++ +
Sbjct  1248  NMGNAWGNLGDHRKAVSYFDQALQMMRSI  1276



>ref|XP_002602179.1| hypothetical protein BRAFLDRAFT_76867 [Branchiostoma floridae]
 gb|EEN58191.1| hypothetical protein BRAFLDRAFT_76867 [Branchiostoma floridae]
Length=1211

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 67/124 (54%), Gaps = 12/124 (10%)
 Frame = -3

Query  624  LGDCCRATGDAASAVKYFEESVNFLLKVPKDDL---EITHTLSVSLNKIGDLKYYDEDLQ  454
            +G+  R  GD   AV Y+E+S+  + ++  +D     I  +L+   N  GDL     D +
Sbjct  842  MGNAWRKLGDYRKAVNYYEQSLQMIRRIYGEDTAHPNIAASLTSLGNAWGDLG----DHR  897

Query  453  AARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             A SYY QAL+++R+   K  + P    ++A SL  +  +  N+G  + A+  +++A++M
Sbjct  898  KAISYYEQALEMKRSTYGKGTTHP----EIARSLNNLGTIWNNLGYHRKAISYYEQALQM  953

Query  276  LQCL  265
            ++ +
Sbjct  954  MRSI  957



>ref|WP_034393722.1| hypothetical protein, partial [Candidatus Microthrix parvicella]
Length=432

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 64/139 (46%), Gaps = 4/139 (3%)
 Frame = -3

Query  714  SICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK  535
            S  AED+ E++     T E        L  +GD  RA GD   A   ++ S+N   ++  
Sbjct  293  STEAEDLAERLAEQLGTPEALRDHSISLDRIGDVYRAQGDWTQAEASYQSSLNIRERL-A  351

Query  534  DDLEITHTL---SVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVA  364
            + L     L   S+SL+KIGD+     D   A + Y  +L+IR    +Q   P    D +
Sbjct  352  EQLGTPEALRDHSISLDKIGDVYRAQGDWTQAEASYQSSLNIRERLAEQLGTPEALRDHS  411

Query  363  VSLAKVADVDRNIGNEKTA  307
            VSL K+ DV R  G+   A
Sbjct  412  VSLDKIGDVYRAQGDWTQA  430



>ref|WP_007820238.1| hypothetical protein, partial [Rhizobium sp. CF142]
 gb|EJJ27887.1| hypothetical protein PMI11_03915, partial [Rhizobium sp. CF142]
Length=198

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 76/159 (48%), Gaps = 16/159 (10%)
 Frame = -3

Query  699  DIREQV-ERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKY----FEESVNFLLKVPK  535
            DIR+ + ER     E    L      +GD  +A GD A A++     F+ +     + P+
Sbjct  26   DIRKTLAERDPYNVEWQRDLSVSYEKIGDMHQAGGDTAGALEAHKAGFDIAQTLTTRDPR  85

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRN-AIKQHSQPSQTIDVAVS  358
            + +E    LSVS NKIGD++  + D+  A   Y   LDIR+  A +  S      D+ VS
Sbjct  86   N-VEWQRDLSVSHNKIGDIRKAERDMAGALEAYLLGLDIRKTLAARDPSSVQLQRDLIVS  144

Query  357  LAKVADVDRNIGNEKTAVDGFQEAIEMLQCL----KLNP  253
              K+A++     N   A   FQ A+E+ + L    +L+P
Sbjct  145  HIKIAEI-----NPPQATKHFQTALEIARRLYETSRLSP  178



>ref|XP_010456431.1| PREDICTED: gibberellin 20 oxidase 3 [Camelina sativa]
Length=397

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -3

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAA  448
            +DLEITHTLS  LNKIGDLKYYD+DLQAA
Sbjct  2    NDLEITHTLSDLLNKIGDLKYYDQDLQAA  30



>ref|XP_002608109.1| hypothetical protein BRAFLDRAFT_91413 [Branchiostoma floridae]
 gb|EEN64119.1| hypothetical protein BRAFLDRAFT_91413 [Branchiostoma floridae]
Length=1373

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 70/135 (52%), Gaps = 6/135 (4%)
 Frame = -3

Query  669   NTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNK  490
             NTS     + A L  LG   R  G+   A++Y+E+++  +  +  +   +   ++  LN 
Sbjct  873   NTSH--PDIAASLNNLGVAWRRLGNHKKAIRYYEQTLEIMRNMYGEG-TVHPDIANLLNN  929

Query  489   IGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKT  310
             +G+   Y  D +    YY QAL +RR+    + + +   D+A SL  +     NIG+++ 
Sbjct  930   LGEAWIYLGDQRKTVKYYEQALQMRRSI---YGENTAHPDIAASLHNLGGTWSNIGDDRK  986

Query  309   AVDGFQEAIEMLQCL  265
             AV  +++++EML+ +
Sbjct  987   AVTYYEQSLEMLRSV  1001



>ref|WP_000555981.1| hypothetical protein [Vibrio cholerae]
 gb|EKG84715.1| leucine Rich Repeat family protein [Vibrio cholerae HE-16]
Length=586

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 76/152 (50%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPKDD  529
            IR+Q+   +G++  +   L      LGD  +  GD  +A   + +S+     L     D 
Sbjct  429  IRQQLHTSLGDSPPVLRDLSVSFSNLGDIEQQLGDLHAAKAAYTQSLAIDQQLHTSLGDS  488

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  489  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  545

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  546  SLRDVANIERLLGRD-TAATQTETELSLIQCL  576



>ref|WP_044283032.1| hypothetical protein, partial [Candidatus Amoebophilus asiaticus]
Length=439

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -3

Query  675  MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSL  496
            MGN   +   L  +    G+   A G    A+KY ++++     +   +   T   S+SL
Sbjct  235  MGNHPSMAISLNNI----GNIYTALGQYQEALKYLKQALEMRQALFTGNHPQT---SISL  287

Query  495  NKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNE  316
            N +GD      + Q A  YY QAL +R+ ++   + P    D+A+SL  +  V + +G  
Sbjct  288  NDLGDFYQASGEYQEALKYYQQALTMRQ-SLYTGNHP----DIAISLNSIGYVYQTLGQH  342

Query  315  KTAVDGFQEAIEMLQCL  265
            + A+  +Q+A+ M +C+
Sbjct  343  QEALKYYQQALNMWKCV  359



>ref|XP_002602186.1| hypothetical protein BRAFLDRAFT_121480 [Branchiostoma floridae]
 gb|EEN58198.1| hypothetical protein BRAFLDRAFT_121480 [Branchiostoma floridae]
Length=1668

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 68/127 (54%), Gaps = 4/127 (3%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
            + A L  +G+     GD   AV YF++++     +  +D      ++  LN +G      
Sbjct  807  IAASLNNMGNAWGNLGDHRKAVSYFDQALEMRRSICGED-NAHPDIATLLNNLGKAWGNL  865

Query  465  EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
             D + A SYY QAL++RR+    + + +   D+A SL  + +  RN+G+++ A+  +++A
Sbjct  866  GDHRKAFSYYDQALEMRRSI---YGEDTAHPDIAASLNNLGEAWRNLGDQRIAISYYEQA  922

Query  285  IEMLQCL  265
            +EM++ +
Sbjct  923  LEMMRGI  929


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 68/128 (53%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             +   L  LG+     GD   A+ Y+E+S+  +  V  +D      ++ SLN +G+     
Sbjct  983   IAGSLNNLGNAWGDLGDNRKAISYYEQSLQMMRSVYGED-NAHPDIAGSLNNMGNAWGNL  1041

Query  465   EDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QAL++RR+   + ++ P    D+A  L  + +   N+G+ + A+  +++
Sbjct  1042  GDHRKAVSYYDQALEMRRSIFGEDNAHP----DIADLLYNMGNAWGNLGDHRKAISYYEQ  1097

Query  288   AIEMLQCL  265
             A++M++ +
Sbjct  1098  ALQMMRSI  1105



>ref|XP_002591853.1| hypothetical protein BRAFLDRAFT_125514 [Branchiostoma floridae]
 gb|EEN47864.1| hypothetical protein BRAFLDRAFT_125514 [Branchiostoma floridae]
Length=1421

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 84/179 (47%), Gaps = 15/179 (8%)
 Frame = -3

Query  768   HAMRAFRANNVESAKSRLSI---CAEDIREQVERM------GNTSELCSQLGAVLGMLGD  616
             H   A   NN+ SA  +L +    A    EQ   M       NT+     + A+L  LG 
Sbjct  1241  HPDTAASLNNLGSAWHKLGVQNKKAISYYEQALTMMKIVYGDNTAHPDIDIAALLQNLGC  1300

Query  615   CCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSY  439
             C    GD   A+ Y+E+S+  +  +  D+    H  ++ SLN +G       DL+ ARSY
Sbjct  1301  CWSKLGDHKKAISYYEQSITTMKTIHGDN--TAHPDIAASLNNLGTSWVKCGDLKKARSY  1358

Query  438   YFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
             + Q+L +R+ AI  + + +    +A +L  +  +   +G+EK A+D  Q+   M   LK
Sbjct  1359  FEQSLTMRK-AI--YGETTAHPSIAGTLNNLRLLWTEMGDEKRAMDYMQQLQSMQMVLK  1414



>ref|XP_002589468.1| hypothetical protein BRAFLDRAFT_80108 [Branchiostoma floridae]
 gb|EEN45479.1| hypothetical protein BRAFLDRAFT_80108 [Branchiostoma floridae]
Length=1754

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/159 (25%), Positives = 74/159 (47%), Gaps = 24/159 (15%)
 Frame = -3

Query  723  SRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLK  544
            +++  CAE+  +  +       +  ++G +L  LG  C   GD  +AV Y E+S+     
Sbjct  807  TKMKTCAENALQHAQHKYGKDAVHPEIGRLLQNLGVTCVYLGDHGAAVTYLEQSLEMKQS  866

Query  543  VPKDDL---EI---THTLSVSLNKIGD----LKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            V  ++    EI    H L  +  K+GD    +KY+++ LQ  RS               H
Sbjct  867  VYGENTAHPEICASLHNLGAAWVKLGDPGKAMKYFEQTLQMQRSI--------------H  912

Query  393  SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + ++  D+AVSL  +    + +G+ + A+   ++A++M
Sbjct  913  GEDTKHPDIAVSLGSLGGAFKELGDYRKAIIFHEQALQM  951



>ref|XP_002588777.1| hypothetical protein BRAFLDRAFT_89794 [Branchiostoma floridae]
 gb|EEN44788.1| hypothetical protein BRAFLDRAFT_89794 [Branchiostoma floridae]
Length=1491

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 4/155 (3%)
 Frame = -3

Query  651   SQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKY  472
             S +   L  LG  C A GD   AV Y EES+     V  ++      L  +LN +     
Sbjct  1258  SDIAKPLHNLGRSCIALGDYKKAVGYLEESLKICQSVFGEN-TTNCILGNALNDLAVSWG  1316

Query  471   YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
               E+   A SY+ QAL +R+ A   H + S   D+A SL  +     N+G  + A++ ++
Sbjct  1317  RLEEHSKAFSYHTQALRMRKAA---HGEHSPHPDIADSLMNIGISCSNLGEHRKAMNYYE  1373

Query  291   EAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
             EA++M++C+  N        R L  L   +S LG+
Sbjct  1374  EALKMMKCVYGNNTAHTDIARLLCNLALSSSNLGE  1408



>ref|WP_037485882.1| hypothetical protein, partial [Sphaerotilus natans]
Length=506

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 74/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  702  EDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFE---ESVNFLLKVPKD  532
            E +R  VER    ++  ++L      +GD  RA GD A A+K ++   E    L +    
Sbjct  96   EIMRRLVERDPGNTKWQNELSFNHISVGDMHRAQGDLAGALKSYQTLLEITRLLAERDPG  155

Query  531  DLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLA  352
            ++     LSVS NKIGD+     DL  A   Y   L++RR   +    P+    +A    
Sbjct  156  EILWQKNLSVSHNKIGDVHKAQGDLAGALKSYQAGLEVRRGLPE--LDPNTKSMIASQHD  213

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCL-KLNPEEVGL  238
            ++ DV +  G+   A+  +Q  +E+++ L +  P E G 
Sbjct  214  RIGDVQKAQGDLAGALQSYQAGLEIVRALAEREPGETGW  252



>ref|WP_020179495.1| hypothetical protein [Methylopila sp. M107]
Length=505

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = -3

Query  600  GDAASAVKYFEESVNFLLKV----PKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYF  433
            GD A A+K FEES+    K+    P +D+     +S+SLNKIG++K    D   A   + 
Sbjct  320  GDTAGALKAFEESLEIARKLASTDPSNDV-WQRDISISLNKIGEVKSQARDGAGALRAFE  378

Query  432  QALDIRRN-AIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            + L+I R  + K  +      DV V+L+K+ ++    G++  A + +QE++++ + L
Sbjct  379  EDLEISRKLSTKDSTNTEWQRDVLVTLSKIGELRLGAGDKSGAFEAYQESLDISRKL  435



>ref|XP_002602184.1| hypothetical protein BRAFLDRAFT_76872 [Branchiostoma floridae]
 gb|EEN58196.1| hypothetical protein BRAFLDRAFT_76872 [Branchiostoma floridae]
Length=1901

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + A L  LG      GD   A+ Y+E+S+     +  +D    + ++ SLN +G      
Sbjct  882   IAASLNNLGGAWTNLGDHRKAISYYEQSLQMKRSIYGEDTAHPN-IADSLNNLGGAWTNL  940

Query  465   EDLQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QAL++RR+   + ++ P    ++A SL  + D   N+G+ + A+  +++
Sbjct  941   GDHRKAISYYEQALEMRRDIYGEDNAHP----NIAGSLNNLGDAWANLGDHRKAISYYEQ  996

Query  288   AIEMLQCL  265
             A+EM+  +
Sbjct  997   ALEMMWSI  1004


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 68/126 (54%), Gaps = 12/126 (10%)
 Frame = -3

Query  636   VLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITH-TLSVSLNKIGDLKYYDED  460
             +L  LG+  R  GD   A+ Y+++++   ++      +  H  ++ SLN +G++     D
Sbjct  1186  ILTNLGNTWRNLGDHRKALSYYKQALEIYVE------DNAHPNIAGSLNNLGNVWRNLGD  1239

Query  459   LQAARSYYFQALDIRRNAIKQ-HSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAI  283
              + A SYY Q+L IRR+   + ++ P    D+A SL  +     NIG+ + AV  + +A+
Sbjct  1240  NRKALSYYEQSLKIRRSIYGEDNAHP----DIAASLNNLGGAWGNIGDHRKAVSYYDQAL  1295

Query  282   EMLQCL  265
             EM++ +
Sbjct  1296  EMMRGI  1301



>gb|KDB50423.1| hypothetical protein X805_39860 [Sphaerotilus natans subsp. natans 
DSM 6575]
Length=856

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 74/159 (47%), Gaps = 6/159 (4%)
 Frame = -3

Query  702  EDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFE---ESVNFLLKVPKD  532
            E +R  VER    ++  ++L      +GD  RA GD A A+K ++   E    L +    
Sbjct  396  EIMRRLVERDPGNTKWQNELSFNHISVGDMHRAQGDLAGALKSYQTLLEITRLLAERDPG  455

Query  531  DLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLA  352
            ++     LSVS NKIGD+     DL  A   Y   L++RR   +    P+    +A    
Sbjct  456  EILWQKNLSVSHNKIGDVHKAQGDLAGALKSYQAGLEVRRGLPE--LDPNTKSMIASQHD  513

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCL-KLNPEEVGL  238
            ++ DV +  G+   A+  +Q  +E+++ L +  P E G 
Sbjct  514  RIGDVQKAQGDLAGALQSYQAGLEIVRALAEREPGETGW  552



>ref|WP_032479617.1| hypothetical protein, partial [Vibrio cholerae]
Length=167

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  10   IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  69

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  70   PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  126

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  127  SLRDVANIERLLGRD-TAATQTETELSLIQCL  157



>ref|XP_002611483.1| hypothetical protein BRAFLDRAFT_63882 [Branchiostoma floridae]
 gb|EEN67493.1| hypothetical protein BRAFLDRAFT_63882 [Branchiostoma floridae]
Length=1622

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = -3

Query  624   LGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSL-NKIGDLKYYDEDLQAA  448
             LG+ C   GD   AV Y E+S+     +   D    H + ++L +K+G       D + A
Sbjct  1325  LGEACSNLGDHRKAVSYHEQSLQMWQHIYGQD--TAHVVIIALLDKLGAAWSILGDHRKA  1382

Query  447   RSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQ  271
              SYY Q+L + R+   K  + P    D+A SL  +A   RN+G+++ AV  +++ ++M +
Sbjct  1383  VSYYEQSLRMTRSIYGKDTAHP----DIADSLNNLAGAWRNLGDQRKAVSYYEQLLQMAR  1438

Query  270   CL  265
             C+
Sbjct  1439  CI  1440



>ref|XP_002610632.1| hypothetical protein BRAFLDRAFT_65821 [Branchiostoma floridae]
 gb|EEN66642.1| hypothetical protein BRAFLDRAFT_65821 [Branchiostoma floridae]
Length=1466

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 78/143 (55%), Gaps = 7/143 (5%)
 Frame = -3

Query  702  EDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLE  523
            E +++++ + G+ + + S +   L  LG  C   GD   A+ YFE+S+  L  +  ++  
Sbjct  830  EALQKELVKYGSRA-IHSDIAHSLFKLGYACENLGDYQEAMSYFEQSLQMLQSIHGEN--  886

Query  522  ITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKV  346
              H  ++ ++N +G + YY  D + A SY+ QAL + ++    + + +   ++A SL  +
Sbjct  887  TAHPDIAAAINSLGAVWYYFRDHRKAASYHKQALQMYQDI---YGESTAHPNIAGSLNNL  943

Query  345  ADVDRNIGNEKTAVDGFQEAIEM  277
              +  ++G+ + A+  F+++++M
Sbjct  944  GGISDDLGDHRKALSYFEQSLQM  966



>ref|WP_018283462.1| hypothetical protein [zeta proteobacterium SCGC AB-137-C09]
Length=565

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 71/148 (48%), Gaps = 6/148 (4%)
 Frame = -3

Query  693  REQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESV----NFLLKVPKDDL  526
            R  V R+G T E    L   L   GD   A G    A +  EES+    N ++++  +  
Sbjct  333  RNLVARIGETPESLRDLFVSLDKTGDTLLAQGKLEQAAQACEESLKIARNLVIRI-DETP  391

Query  525  EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLAK  349
            E  H LSVSLNK+G+       L+ A   Y + L I RN + +  +  +++ D+ VSL K
Sbjct  392  ESLHDLSVSLNKVGNTLLAQGKLEQAAQAYEEGLQIARNLVTRIGETPESLRDLFVSLDK  451

Query  348  VADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            + +     G  + A   ++E +++ + L
Sbjct  452  IGNTLLAQGKLEQAAQAYEEGLQIARNL  479



>ref|WP_002029069.1| TPR repeat family protein, partial [Vibrio cholerae]
 gb|EMP83182.1| TPR repeat family protein, partial [Vibrio cholerae O1 str. 116063]
Length=191

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  34   IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  93

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  94   PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  150

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  151  SLRDVANIERLLGRD-TAATQTETELSLIQCL  181



>gb|EKM02271.1| tetratricopeptide repeat family protein, partial [Vibrio cholerae 
HC-44C1]
Length=359

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  188  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  246

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  247  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  303

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  304  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  337



>ref|XP_002611185.1| hypothetical protein BRAFLDRAFT_88416 [Branchiostoma floridae]
 gb|EEN67195.1| hypothetical protein BRAFLDRAFT_88416 [Branchiostoma floridae]
Length=1943

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
            +   L  LG+     GD   AV Y+E+S+     +  +D    H  ++ SLN +G+    
Sbjct  700  IATSLNKLGNAWNDLGDHRKAVSYYEQSLQMNWSIHGED--TAHPDIATSLNNLGNAWND  757

Query  468  DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY Q+L + R+    H + +   D+A SL K+ +   ++G+ + AV  +++
Sbjct  758  LGDHRKAVSYYEQSLQMNRSI---HGEDTAHPDIATSLNKLGNAWNDLGDHRKAVSYYEQ  814

Query  288  AIEM  277
            +++M
Sbjct  815  SLQM  818


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 6/128 (5%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
            +   L  LG+     GD   AV Y+E+S+     +  +D    H  ++ SLN +G+    
Sbjct  788  IATSLNKLGNAWNDLGDHRKAVSYYEQSLQMNWSIHGED--TAHPDIATSLNNLGNAWND  845

Query  468  DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              D + A SYY QAL + R+    H + +   D+A SL  + +   ++G+ + AV  +++
Sbjct  846  LGDHRKAVSYYEQALQMNRSI---HGEDTAHPDIATSLNNLGNAWNDLGDHRKAVSYYEQ  902

Query  288  AIEMLQCL  265
            A +M + +
Sbjct  903  ARQMKRSI  910



>ref|WP_033929925.1| hypothetical protein, partial [Vibrio cholerae]
Length=565

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+     HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQQL---HSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG+
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGE  364

Query  186  KETNSG  169
             E   G
Sbjct  365  IEQQLG  370



>gb|KFE15678.1| tetratricopeptide repeat family protein [Vibrio cholerae]
Length=586

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  188  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  246

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  247  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  303

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG+
Sbjct  304  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGE  360

Query  186  KETNSG  169
             E   G
Sbjct  361  IEQQLG  366


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  429  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  488

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  489  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  545

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  546  SLRDVANIERLLGRD-TAATQTETELSLIQCL  576



>ref|WP_034995879.1| hypothetical protein [Beijerinckia mobilis]
Length=441

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 4/107 (4%)
 Frame = -3

Query  633  LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDD---LEITHTLSVSLNKIGDLKYYDE  463
            L M+GD  RA  D   A+  +  S+    K+   D   L     + +S N+IGD+K    
Sbjct  294  LAMIGDVKRAAADTQGALNAYNASLEMTRKLVNLDSRSLPWKRDMVLSANRIGDVKMETG  353

Query  462  DLQAARSYYFQALDIRRNAIKQHSQPSQT-IDVAVSLAKVADVDRNI  325
            D Q AR  Y QAL+I R  I + S   +T  D+  SL KV  ++ +I
Sbjct  354  DRQGAREAYEQALEINRKRISEVSNELETQSDLVTSLLKVGGINGDI  400


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = -3

Query  627  MLGDCCRATGDAASAVKYFEESVNFLLKVP---KDDLEITHTLSVSLNKIGDLKYYDEDL  457
            ++G   +  G+  +A++ ++ S+    ++     D++++ H + ++L KIG LK    D+
Sbjct  200  IMGMIEQTKGNREAALEAYQSSLTITRRLSTENPDNVDLHHDIQLTLKKIGSLKKEHGDV  259

Query  456  QAARSYYFQALDIRRNAIK-QHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIE  280
            Q A   Y +  DI R  ++     P++  DV++SLA + DV R   + + A++ +  ++E
Sbjct  260  QGALDAYQEHHDICRRIVELDPDSPARRRDVSLSLAMIGDVKRAAADTQGALNAYNASLE  319

Query  279  MLQCLKLNPEEVGLEQRRLSVL  214
            M + L +N +   L  +R  VL
Sbjct  320  MTRKL-VNLDSRSLPWKRDMVL  340



>gb|EMP83509.1| tetratricopeptide repeat family protein, partial [Vibrio cholerae 
O1 str. 116063]
Length=354

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  188  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  246

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  247  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  303

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  304  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  337



>gb|EKL01521.1| tetratricopeptide repeat family protein, partial [Vibrio cholerae 
HC-41B1]
Length=355

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  188  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  246

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  247  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  303

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  304  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  337



>ref|WP_032483209.1| hypothetical protein, partial [Vibrio cholerae]
Length=363

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  341



>ref|WP_032483688.1| hypothetical protein, partial [Vibrio cholerae]
Length=359

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  341



>ref|WP_032482135.1| hypothetical protein [Vibrio cholerae]
Length=590

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG+
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGE  364

Query  186  KETNSG  169
             E   G
Sbjct  365  IEQQLG  370


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  433  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  492

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  493  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  549

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  550  SLRDVANIERLLGRD-TAATQTETELSLIQCL  580



>ref|WP_032482486.1| hypothetical protein, partial [Vibrio cholerae]
Length=358

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 76/154 (49%), Gaps = 11/154 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            +VS  K+ ++++ +G+   A   + +++ + Q L
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQL  341



>ref|WP_001908540.1| hypothetical protein [Vibrio cholerae]
 gb|EEO06386.1| TPR repeat-containing protein [Vibrio cholerae TM 11079-80]
Length=542

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG+
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGE  364

Query  186  KETNSG  169
             E   G
Sbjct  365  IEQQLG  370


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  385  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  444

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  445  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  501

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  502  SLRDVANIERLLGRD-TAATQTETELSLIQCL  532



>ref|XP_002585539.1| hypothetical protein BRAFLDRAFT_111892 [Branchiostoma floridae]
 gb|EEN41550.1| hypothetical protein BRAFLDRAFT_111892 [Branchiostoma floridae]
Length=1973

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 77/163 (47%), Gaps = 24/163 (15%)
 Frame = -3

Query  723  SRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLK  544
            +++  CAE+  ++ ++         ++G +L  LG  C   GD  +AV Y E+S+     
Sbjct  807  TKMKTCAENAVQEAQQRYGKDVAHPEIGRLLQNLGVTCVYLGDHKAAVTYLEQSLEMKQS  866

Query  543  VPKDDL---EI---THTLSVSLNKIGD----LKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            V  ++    EI    H L  +  K+GD    +KY+++ LQ  RS               H
Sbjct  867  VYGENTAHPEICASLHNLGAAWVKLGDPGKAIKYFEQTLQMQRSI--------------H  912

Query  393  SQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
             + ++  D+AVSL  +    + +G+ + A+   ++A++M + +
Sbjct  913  GEDTKHPDIAVSLGSLGGAFKELGDHRKAIIFHEQALQMRRSI  955



>ref|XP_002599233.1| hypothetical protein BRAFLDRAFT_64417 [Branchiostoma floridae]
 gb|EEN55245.1| hypothetical protein BRAFLDRAFT_64417 [Branchiostoma floridae]
Length=3135

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 81/174 (47%), Gaps = 9/174 (5%)
 Frame = -3

Query  702   EDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLE  523
             E +R +    G+ SE   ++ A L  LG  C   GD+  A++YFEES+  L K    D E
Sbjct  2778  ESLRMERTLYGD-SEAHPEIIASLTKLGTTCLGVGDSKKAIRYFEESLR-LNKTLHGDSE  2835

Query  522   ITHTLSVSLNKIGDLKYYD-EDLQAARSYYFQALDIRRNAIK-QHSQPSQTIDVAVSLAK  349
             I   +   LN +G L + +  D Q A SY  Q+L +R+   +   S P    D+A SL+ 
Sbjct  2836  IHPDIDELLNNLG-LSWSELGDQQKAISYLKQSLTMRKTIYRDSESHP----DIAESLSN  2890

Query  348   VADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
             +    R +G  K A +  + ++ M   +  N     L  + L  +  L  Q G+
Sbjct  2891  LGSSWRRLGKTKKATECLEASLTMAMDIYGNDTPHSLIAKILHNMGLLWRQCGE  2944



>gb|KFE11407.1| tetratricopeptide repeat family protein [Vibrio cholerae]
Length=240

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 11/144 (8%)
 Frame = -3

Query  675  MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DDLEITHTLS  505
            +G++  +   L      LGD  +  GD  +A   + +S+    ++     D   +   LS
Sbjct  91   LGDSPPVLRDLSVSFIKLGDIEQQLGDLHAAKAAYAQSLAIFQQLHSSLGDSPHVLRDLS  150

Query  504  VSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAVSLAKVADV  337
            VS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +SL  VA++
Sbjct  151  VSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLIISLRDVANI  207

Query  336  DRNIGNEKTAVDGFQEAIEMLQCL  265
            +R +G + TA    +  + ++QCL
Sbjct  208  ERLLGRD-TAATQTETELSLIQCL  230



>ref|WP_001973313.1| tetratricopeptide repeat family protein, partial [Vibrio cholerae]
 gb|EKL01392.1| tetratricopeptide repeat family protein, partial [Vibrio cholerae 
HC-41B1]
Length=206

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  49   IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  108

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  109  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  165

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  166  SLRDVANIERLLGRD-TAATQTETELSLIQCL  196



>ref|WP_002006903.1| hypothetical protein [Vibrio cholerae]
 gb|EJH49721.1| leucine Rich Repeat family protein [Vibrio cholerae HC-43B1]
Length=638

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG 
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGD  364

Query  186  KETNSG  169
             E   G
Sbjct  365  IEQQLG  370


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  481  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  540

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  541  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  597

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  598  SLRDVANIERLLGRD-TAATQTETELSLIQCL  628



>gb|EKL95138.1| tetratricopeptide repeat family protein [Vibrio cholerae HC-46B1]
Length=634

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (48%), Gaps = 14/186 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  188  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIGQQLHTSLG  246

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  247  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  303

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCLKLNPEEVGLEQRRLSVLEFLNSQLGK  187
            +VS  K+ ++++ +G+   A   + +++ + Q L  +  +     R LSV  F  S+LG 
Sbjct  304  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQQLHTSLGDSPQVLRDLSV-SF--SKLGD  360

Query  186  KETNSG  169
             E   G
Sbjct  361  IEQQLG  366


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  477  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  536

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  537  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  593

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  594  SLRDVANIERLLGRD-TAATQTETELSLIQCL  624



>ref|XP_002602196.1| hypothetical protein BRAFLDRAFT_76883 [Branchiostoma floridae]
 gb|EEN58208.1| hypothetical protein BRAFLDRAFT_76883 [Branchiostoma floridae]
Length=1765

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 70/149 (47%), Gaps = 18/149 (12%)
 Frame = -3

Query  720   RLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKV  541
             R SI  ED         N ++  + LGA    LGD  +A       + Y+E+S+   L +
Sbjct  1001  RRSIYGEDTAHP-----NIADSLNNLGATWSNLGDNRKA-------ISYYEQSLQMKLSI  1048

Query  540   PKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVA  364
               +D    H   + SLN +G       D + A SYY QAL++ R     + + +   ++A
Sbjct  1049  YGED--TAHPDFASSLNNLGGAWTNLGDHRKAISYYEQALEMMRGI---YGEDTVHPNIA  1103

Query  363   VSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
              SL  +    RN+G+ + AV  F +A+EM
Sbjct  1104  ASLNNLGSAWRNLGDHRKAVSYFDQALEM  1132


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 73/154 (47%), Gaps = 18/154 (12%)
 Frame = -3

Query  735   ESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVN  556
             +S + +LSI  ED                   + L  LG      GD   A+ Y+E+++ 
Sbjct  1040  QSLQMKLSIYGEDTAH------------PDFASSLNNLGGAWTNLGDHRKAISYYEQALE  1087

Query  555   FLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAI-KQHSQPSQ  379
              +  +  +D  +   ++ SLN +G       D + A SY+ QAL++RR+   K  + P  
Sbjct  1088  MMRGIYGED-TVHPNIAASLNNLGSAWRNLGDHRKAVSYFDQALEMRRSIYGKNTAHP--  1144

Query  378   TIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
               D+A SL  + +   N+G+ + A+  ++++++M
Sbjct  1145  --DIAQSLNNMGNAWGNLGDHRKAISYYEQSLQM  1176


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 6/109 (6%)
 Frame = -3

Query  600  GDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQAL  424
            GD   A+ YFE+S+     +  +D   TH  ++ SLN +G+      D + A SYY QAL
Sbjct  897  GDHGKALYYFEQSLQMRRSIYGED--NTHPDIAASLNNLGEAWRNLGDYRKAVSYYEQAL  954

Query  423  DIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
            ++RR+    + + +   ++A SL  +     N+G+ + A+  +++A+EM
Sbjct  955  EMRRSI---YGEDTAHPNIAASLNNLGATWSNLGDNRKAISYYEQALEM  1000



>gb|KDC50150.1| hypothetical protein DC53_13475 [Pseudoalteromonas citrea]
Length=578

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 78/150 (52%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++  +G++ ++   L      +G+  +  GD  +A   + +S+    ++     D 
Sbjct  283  IRQQLQTSLGDSPQVLRDLSVSFDKVGNIEQQLGDLPAAKAAYAQSLAICQQLQTSLGDS  342

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVS NK+G+++    DL AA++ Y Q+L IR+          Q + D++VS  
Sbjct  343  PQVLRDLSVSFNKVGNIELQLGDLPAAKAAYAQSLAIRQQLQTSLGDSPQVLRDLSVSFD  402

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV +++  +G+   A   + +++ + Q L+
Sbjct  403  KVGNIELQLGDVPAAKAAYMQSLAIRQQLQ  432



>ref|WP_032471735.1| hypothetical protein, partial [Vibrio cholerae]
Length=259

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 11/144 (8%)
 Frame = -3

Query  675  MGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DDLEITHTLS  505
            +G++  +   L      LGD  +  GD  +A   + +S+    ++     D   +   LS
Sbjct  110  LGDSPPVLRDLSVSFIKLGDIEQQLGDLHAAKAAYAQSLAIFQQLHSSLGDSPHVLRDLS  169

Query  504  VSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAVSLAKVADV  337
            VS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +SL  VA++
Sbjct  170  VSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLIISLRDVANI  226

Query  336  DRNIGNEKTAVDGFQEAIEMLQCL  265
            +R +G + TA    +  + ++QCL
Sbjct  227  ERLLGRD-TAATQTETELSLIQCL  249



>ref|WP_032481142.1| hypothetical protein, partial [Vibrio cholerae]
Length=339

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 11/152 (7%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQ  271
            +VS  K+ ++++ +G+   A   + +++ + Q
Sbjct  308  SVSFNKLGEIEQQLGDLHAAKAAYAQSLAICQ  339



>ref|WP_033030573.1| hypothetical protein, partial [Pseudoalteromonas citrea]
Length=575

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 78/150 (52%), Gaps = 5/150 (3%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK---DD  529
            IR+Q++  +G++ ++   L      +G+  +  GD  +A   + +S+    ++     D 
Sbjct  283  IRQQLQTSLGDSPQVLRDLSVSFDKVGNIEQQLGDLPAAKAAYAQSLAICQQLQTSLGDS  342

Query  528  LEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTI-DVAVSLA  352
             ++   LSVS NK+G+++    DL AA++ Y Q+L IR+          Q + D++VS  
Sbjct  343  PQVLRDLSVSFNKVGNIELQLGDLPAAKAAYAQSLAIRQQLQTSLGDSPQVLRDLSVSFD  402

Query  351  KVADVDRNIGNEKTAVDGFQEAIEMLQCLK  262
            KV +++  +G+   A   + +++ + Q L+
Sbjct  403  KVGNIELQLGDVPAAKAAYMQSLAIRQQLQ  432



>ref|XP_002611217.1| hypothetical protein BRAFLDRAFT_71177 [Branchiostoma floridae]
 gb|EEN67227.1| hypothetical protein BRAFLDRAFT_71177 [Branchiostoma floridae]
Length=1510

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (49%), Gaps = 16/158 (10%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + + L  +G+CC   GD   A+ Y E+S+  + +V   +L     ++ SLN IG      
Sbjct  1232  IASSLNNIGNCCNDLGDGWKALSYHEQSLK-MSEVIYGELTPHTEIAASLNNIGTCWSKL  1290

Query  465   EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
              D + A  +Y Q+L +R+ AI  H + +   D+A SL  + +   ++G+++ AV G+ E 
Sbjct  1291  GDQRKAVKHYEQSLRMRK-AI--HGETTPHPDIASSLNNIGNCWSDLGDQRKAV-GYHE-  1345

Query  285   IEMLQCLKLNPEEVGLEQRRLSVLEFLN------SQLG  190
                 Q LK+     G  +    + E LN      SQLG
Sbjct  1346  ----QSLKMRKTIYGETKGHPDIAESLNNIGHCWSQLG  1379


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQ  454
             L  +G C    GD   AV+Y E+S+  + KV   +      ++ S+N IG   Y+  D +
Sbjct  1368  LNNIGHCWSQLGDQRKAVRYHEQSLK-MDKVIYGETTPHPHIAGSVNNIGTCWYFLGDHR  1426

Query  453   AARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEML  274
              A  YY Q+L +R+ AI  + + +   D+A SL  +      +GN+  A+   ++++EM+
Sbjct  1427  KAIRYYEQSLKMRQ-AI--YGESTVHPDIASSLYNIGACWNELGNQSKALSYLEQSVEMM  1483

Query  273   QCL  265
             + +
Sbjct  1484  KVI  1486



>ref|XP_002609227.1| hypothetical protein BRAFLDRAFT_90681 [Branchiostoma floridae]
 gb|EEN65237.1| hypothetical protein BRAFLDRAFT_90681 [Branchiostoma floridae]
Length=1469

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/146 (25%), Positives = 72/146 (49%), Gaps = 20/146 (14%)
 Frame = -3

Query  651   SQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITH--------TLSVSL  496
             S + + L  LG+     GD   A+KY+E+S+     + +   +  H         L+V+ 
Sbjct  1329  SSIASSLNNLGNAWSDLGDHRKAIKYYEQSLQMRRSIYRHGEDTAHPHIADSLNNLAVAW  1388

Query  495   NKIGDLKYYDEDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGN  319
             + +GD K        A +YY Q+L I+R+   K  + P    D+A +L  +A   R++G+
Sbjct  1389  SDLGDHK-------MAINYYEQSLQIKRHIYGKNTAHP----DIAATLNNMAVAYRDLGD  1437

Query  318   EKTAVDGFQEAIEMLQCLKLNPEEVG  241
              + A+  ++++++M++ +    E  G
Sbjct  1438  HRRAISYYEQSLQMMRSIHAYGEATG  1463



>ref|WP_001937111.1| hypothetical protein [Vibrio cholerae]
Length=495

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 84/167 (50%), Gaps = 12/167 (7%)
 Frame = -3

Query  741  NVESAKSRLSICAEDIREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEE  565
            ++ +AK+     +  IR+Q+   +G++  +   L      LG+     GD  +A   + +
Sbjct  323  DLHAAKAAYYTQSLAIRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQ  382

Query  564  S--VNFLLKVPKDDL-EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQH  394
            S  ++  L     DL  +   LSVS NK+GD++    DL AA++ Y Q+L I +   + H
Sbjct  383  SLAIDQQLHTSLGDLPHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLH  439

Query  393  S----QPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            S     P    D+ +SL  VA+++R +G + TA    +  + ++QCL
Sbjct  440  STLGDSPPVLRDLIISLRDVANIERLLGRD-TAATQTETELSLIQCL  485



>ref|WP_041702693.1| hypothetical protein, partial [Prosthecochloris aestuarii]
Length=339

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 80/145 (55%), Gaps = 5/145 (3%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDL  526
            A +IR ++ R  N +     +   L  L +  R   D  SA+K ++E++    ++ + + 
Sbjct  94   ALEIRRELART-NRATYLPDVATTLNNLANLQRGINDYESALKGYQEALEIYRELARTN-  151

Query  525  EITHT--LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLA  352
              T+   ++++LN +  L+    D ++A   Y +AL+IRR  + + ++ +   DVA +L 
Sbjct  152  RATYLPDVAMTLNNMAVLQSDRNDYESALKGYQEALEIRRE-LARTNRATYLPDVATTLN  210

Query  351  KVADVDRNIGNEKTAVDGFQEAIEM  277
             +A++ R I + ++A+ G+QEA+E+
Sbjct  211  NLANLQRGINDYESALKGYQEALEI  235



>ref|XP_002591631.1| hypothetical protein BRAFLDRAFT_80730 [Branchiostoma floridae]
 gb|EEN47642.1| hypothetical protein BRAFLDRAFT_80730 [Branchiostoma floridae]
Length=1417

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (47%), Gaps = 5/126 (4%)
 Frame = -3

Query  654   CSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLK  475
             C  +   L  LG  C    D   A+ Y E+S+     +  +  E     S +L+ +G   
Sbjct  1137  CPDIATSLHNLGFTCLYLSDYKKAISYLEQSLKMDRSIYGEGTEHPDIAS-ALSNLGTAW  1195

Query  474   YYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGF  295
                 D + A SYY QAL ++RN  +  +     +D+A SL  V  +  N+ + + A+  F
Sbjct  1196  SGLGDHRKALSYYEQALTMQRNIYQTEAH----LDIATSLNNVGAIWTNLADYRKAISYF  1251

Query  294   QEAIEM  277
             QEA+EM
Sbjct  1252  QEALEM  1257



>ref|XP_002608129.1| hypothetical protein BRAFLDRAFT_91392 [Branchiostoma floridae]
 gb|EEN64139.1| hypothetical protein BRAFLDRAFT_91392 [Branchiostoma floridae]
Length=1623

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 65/123 (53%), Gaps = 4/123 (3%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + A L  LG+  R  GD   A+ Y+E+S+     +  +D  +   ++ SLN +G +    
Sbjct  1233  IAAFLNNLGNAVRDLGDNRKAISYYEQSLQMKRSIYGED-NVHPDIADSLNNLGTVWGDL  1291

Query  465   EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
              D + A SYY Q+L ++R     + + +   D+  SL  + ++ R++G+ + AV  +++A
Sbjct  1292  GDQRRAISYYEQSLQMKRII---YGEGTVHPDIVTSLNNLGNIWRDLGDHRKAVSYYEQA  1348

Query  285   IEM  277
             + M
Sbjct  1349  LHM  1351



>gb|EKM02159.1| tetratricopeptide repeat family protein [Vibrio cholerae HC-44C1]
Length=288

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  131  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  190

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  191  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  247

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  248  SLRDVANIERLLGRD-TAATQTETELSLIQCL  278



>ref|XP_002603377.1| hypothetical protein BRAFLDRAFT_80370 [Branchiostoma floridae]
 gb|EEN59388.1| hypothetical protein BRAFLDRAFT_80370 [Branchiostoma floridae]
Length=922

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/145 (25%), Positives = 73/145 (50%), Gaps = 6/145 (4%)
 Frame = -3

Query  708  CAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDD  529
            C E++ +  +     + + S +   L  LG+ C+  GD  +AV Y E S+  +  +  D+
Sbjct  546  CLEELLQNYQTRFGEASMHSDIVQTLHKLGEACKNIGDNKNAVSYHERSLQMMRTIYGDN  605

Query  528  LEITH-TLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLA  352
                H  +++SLN +G       D + A SY+ ++L +RR     +   +   ++A+SL 
Sbjct  606  --TAHPNIAMSLNNLGLALMNIGDNKNAVSYHERSLHMRRTI---YGDNTAHPNIAMSLN  660

Query  351  KVADVDRNIGNEKTAVDGFQEAIEM  277
             + +   N+G+ K AV   +++++M
Sbjct  661  NLGNAWMNLGDHKKAVSYHEQSLQM  685



>ref|WP_000322839.1| hypothetical protein, partial [Vibrio cholerae]
Length=288

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 77/152 (51%), Gaps = 12/152 (8%)
 Frame = -3

Query  696  IREQVE-RMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEES--VNFLLKVPKDDL  526
            IR+Q+   +G++  +   L      LG+     GD  +A   + +S  ++  L     DL
Sbjct  131  IRQQLHTSLGDSPPVLRDLSVSFSNLGEIEEQLGDLHAAKAAYTQSLAIDQQLHTSLGDL  190

Query  525  -EITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDVAV  361
              +   LSVS NK+GD++    DL AA++ Y Q+L I +   + HS     P    D+ +
Sbjct  191  PHVLRDLSVSFNKLGDIEQQLGDLHAAKAAYAQSLAIFQ---QLHSTLGDSPPVLRDLII  247

Query  360  SLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
            SL  VA+++R +G + TA    +  + ++QCL
Sbjct  248  SLRDVANIERLLGRD-TAATQTETELSLIQCL  278



>ref|XP_002591376.1| hypothetical protein BRAFLDRAFT_93999 [Branchiostoma floridae]
 gb|EEN47387.1| hypothetical protein BRAFLDRAFT_93999, partial [Branchiostoma 
floridae]
Length=1226

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (44%), Gaps = 12/171 (7%)
 Frame = -3

Query  768  HAMRAFRANNVESAKSRLSICAEDIREQVERMGNTSELCSQ------LGAVLGMLGDCCR  607
            HA + +  N +  A  R+    + I    +    +  +  Q      +   L  LG  C 
Sbjct  807  HAEKMYLFNRLGEAWHRMGDWHKAIDYYEQSFQKSRSIFGQDTAHPDIAIALNNLGTACD  866

Query  606  ATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQ  430
              GD   A+ YFE+++  L  +       +H  ++ SLN +G   Y+  D + A SYY Q
Sbjct  867  NLGDYRKAINYFEQALQMLRSIYGQ--HKSHPDIANSLNNLGSAWYFLGDHRKAISYYKQ  924

Query  429  ALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             L +RRN     +  S   D+A SL  +       G+ + A++  ++A++M
Sbjct  925  VLQMRRNIYGFDTAHS---DIATSLNNLGGAYEKQGDYRKAINYHEQALKM  972



>ref|XP_002589433.1| hypothetical protein BRAFLDRAFT_80170 [Branchiostoma floridae]
 gb|EEN45444.1| hypothetical protein BRAFLDRAFT_80170 [Branchiostoma floridae]
Length=1439

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 66/129 (51%), Gaps = 6/129 (5%)
 Frame = -3

Query  648   QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKY  472
              +   L  LG   R +GD   A+ YFE+++     V  +D    H  ++ SL  +G+  +
Sbjct  1091  HIALTLNNLGAAWRNSGDPRKAISYFEQAIQMRRSVYGED--TAHPDIADSLLSLGEAWH  1148

Query  471   YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
               +D + A SYY QAL ++R     H + +   D+   +  +    R++G+ + A+  F+
Sbjct  1149  DLDDYRKALSYYEQALQMKRFV---HGEETAHTDIDKLMRNMCVAWRHLGDHRKAISCFE  1205

Query  291   EAIEMLQCL  265
             +A++M++ +
Sbjct  1206  QALQMMRSI  1214



>gb|ACE06324.1| hypothetical protein Aasi_0966 [Candidatus Amoebophilus asiaticus 
5a2]
Length=2145

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 67/120 (56%), Gaps = 8/120 (7%)
 Frame = -3

Query  624   LGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQAAR  445
             LG   +A G    A+KY++E++     + K       +++ SLN +GD+       Q A 
Sbjct  1948  LGKVYQALGQHQEALKYYQEALEKRRTLYKG---YHRSIATSLNNLGDVYQALGQHQEAL  2004

Query  444   SYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEMLQCL  265
             +YY QALD+R+ A+ + + P+    +AVSL  + +V + +G  + A+  +Q+A++M + L
Sbjct  2005  TYYQQALDMRK-ALYKGNHPA----IAVSLNNLGNVYQTLGQHQEALTYYQQALDMRKGL  2059



>gb|EAR87128.2| tetratricopeptide repeat protein [Tetrahymena thermophila SB210]
Length=965

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK-DDLEITHTLSVSLNKIGDLKY  472
            +L  +L  LG+C         A++YFE+S+    ++ K D ++  +TL     KI   ++
Sbjct  558  ELATLLYNLGNCYFKQRKRKEALQYFEQSLEIRERLFKYDHIDTANTLF----KISYCQF  613

Query  471  YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
             + +++ A  + ++AL +R    K  + P    D+A SL  +    +N+G+ K A+D  Q
Sbjct  614  VNNEIKLAYDFSYRALIMRLKLFKNSNHP----DIADSLNDLGLRCQNLGDNKKAMDLIQ  669

Query  291  EAIEMLQCL-KLNPEEVGLEQRRLSVLEFLNSQLGKKETN  175
            +AI+ML+ + + N E++ +    L+V++  N +  K + N
Sbjct  670  KAIDMLEAINQNNNEKLAIYYNSLAVIQQNNGEYLKAKIN  709



>ref|XP_002602759.1| hypothetical protein BRAFLDRAFT_93705 [Branchiostoma floridae]
 gb|EEN58771.1| hypothetical protein BRAFLDRAFT_93705 [Branchiostoma floridae]
Length=1309

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 67/123 (54%), Gaps = 4/123 (3%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
            + A L  LG+  R  GD   AV Y+E+S+   L +  +D    + ++ SLN +G+     
Sbjct  615  IAASLNNLGEGWRYLGDYRKAVSYYEQSLLMKLSIYGEDTAHPN-IADSLNNLGNAWTNL  673

Query  465  EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
             D + A SY+ Q+L ++R+    + + +   D+A SL  +  V RN+G+ + A+   +++
Sbjct  674  GDHRKAISYHEQSLQMKRSI---YGEDTAHPDIADSLNNLGGVWRNLGDHRKAISYHEQS  730

Query  285  IEM  277
            ++M
Sbjct  731  LQM  733



>ref|XP_002602194.1| hypothetical protein BRAFLDRAFT_76881 [Branchiostoma floridae]
 gb|EEN58206.1| hypothetical protein BRAFLDRAFT_76881 [Branchiostoma floridae]
Length=1768

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 74/154 (48%), Gaps = 18/154 (12%)
 Frame = -3

Query  735   ESAKSRLSICAEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVN  556
             +S + +LSI  ED               S + A L  LG      GD   +V YF++++ 
Sbjct  1064  QSLQMKLSIYGEDTAH------------SDIAASLTNLGAAWNNLGDHRKSVSYFDQALQ  1111

Query  555   FLLKVPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQ  379
                 +  +D  I H  ++ SLN +G+      D + A SYY QAL +RR+    + + + 
Sbjct  1112  MRRSIYGED--IAHPGIADSLNNMGNAWGNLGDYRKAISYYEQALQMRRSI---YGEDTA  1166

Query  378   TIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
               ++A SL  +     N+G+ + AV  ++++++M
Sbjct  1167  HPNIAASLNNLGSTWSNLGDNRKAVSFYEQSLQM  1200



>ref|XP_002604150.1| hypothetical protein BRAFLDRAFT_71558 [Branchiostoma floridae]
 gb|EEN60161.1| hypothetical protein BRAFLDRAFT_71558 [Branchiostoma floridae]
Length=550

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/127 (24%), Positives = 69/127 (54%), Gaps = 4/127 (3%)
 Frame = -3

Query  645  LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
            +  +L  LG+  R  GD   A+ Y+E+S+  + ++   D      ++ SLN +G    + 
Sbjct  131  IATLLNNLGNAWRDLGDYRKAINYYEQSLQ-MKRIIYGDNTAHPNIADSLNNLGTAWSHL  189

Query  465  EDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEA  286
             D + A+SYY Q+L + +     + + ++  D+A  L  + +  R++G+ + A++ ++++
Sbjct  190  GDHRKAKSYYEQSLQMTQII---YGEDTEHPDIATLLNNLGNAWRDLGDYRKAINYYEQS  246

Query  285  IEMLQCL  265
            ++M Q +
Sbjct  247  LQMRQSI  253



>ref|XP_002602178.1| hypothetical protein BRAFLDRAFT_76866 [Branchiostoma floridae]
 gb|EEN58190.1| hypothetical protein BRAFLDRAFT_76866 [Branchiostoma floridae]
Length=1648

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLKYY  469
             + A L  LG+     GD   A+ Y+E+++     +  +D    H+ ++ SLN +G+    
Sbjct  1125  IAASLNNLGNAWSNLGDHRKAISYYEQALQMNRSIYGED--TAHSDIAASLNNLGNAWSN  1182

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
               D + A SYY QAL + R+    + + +   D+A SL  + +   N+G+ + A+  +++
Sbjct  1183  LGDHRKAISYYEQALQMNRSI---YGEDTAHPDIATSLNNMGNAWSNLGDHRKAISYYEQ  1239

Query  288   AIEM  277
             A++M
Sbjct  1240  ALQM  1243


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 68/130 (52%), Gaps = 6/130 (5%)
 Frame = -3

Query  651   SQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHT-LSVSLNKIGDLK  475
             S + A L  LG+     GD   A+ Y+E+++     +  +D    H  ++ SLN +G+  
Sbjct  1167  SDIAASLNNLGNAWSNLGDHRKAISYYEQALQMNRSIYGED--TAHPDIATSLNNMGNAW  1224

Query  474   YYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGF  295
                 D + A SYY QAL + R+    + + +   D+A SL  + +   ++G+ + A+  +
Sbjct  1225  SNLGDHRKAISYYEQALQMNRSI---YGEDTAHPDIATSLNNMGNTWGDLGDHRKAISYY  1281

Query  294   QEAIEMLQCL  265
             +++++M++ +
Sbjct  1282  EQSLQMMRTI  1291



>ref|XP_001007373.1| TPR Domain containing protein [Tetrahymena thermophila]
Length=747

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -3

Query  648  QLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPK-DDLEITHTLSVSLNKIGDLKY  472
            +L  +L  LG+C         A++YFE+S+    ++ K D ++  +TL     KI   ++
Sbjct  340  ELATLLYNLGNCYFKQRKRKEALQYFEQSLEIRERLFKYDHIDTANTLF----KISYCQF  395

Query  471  YDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQ  292
             + +++ A  + ++AL +R    K  + P    D+A SL  +    +N+G+ K A+D  Q
Sbjct  396  VNNEIKLAYDFSYRALIMRLKLFKNSNHP----DIADSLNDLGLRCQNLGDNKKAMDLIQ  451

Query  291  EAIEMLQCL-KLNPEEVGLEQRRLSVLEFLNSQLGKKETN  175
            +AI+ML+ + + N E++ +    L+V++  N +  K + N
Sbjct  452  KAIDMLEAINQNNNEKLAIYYNSLAVIQQNNGEYLKAKIN  491



>ref|XP_002608130.1| hypothetical protein BRAFLDRAFT_91391 [Branchiostoma floridae]
 gb|EEN64140.1| hypothetical protein BRAFLDRAFT_91391 [Branchiostoma floridae]
Length=1429

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 78/150 (52%), Gaps = 10/150 (7%)
 Frame = -3

Query  717   LSICAED-IREQVERMG-NTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLK  544
             L  C+E  +   + + G NT+   S + A L  L     A GD  ++V+Y+E+S+     
Sbjct  993   LKTCSEQTLHYYLSKYGENTAH--SDVAASLDNLAFALGALGDHKNSVRYYEQSLQMRQS  1050

Query  543   VPKDDLEITHT-LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDV  367
             +  +D    H  ++ SLN +G +     D +   SYY Q+L + R+    + + +  +++
Sbjct  1051  IYSED--TAHPDIASSLNNLGRVWTDQGDYRKTVSYYEQSLQMMRSI---YGEDTAHLNI  1105

Query  366   AVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             A+SL  +  V R +G+ + AV  F+++++M
Sbjct  1106  AISLNNLGGVWRQLGDNRKAVKYFEQSLQM  1135



>ref|WP_032916713.1| hypothetical protein, partial [Mesorhizobium loti]
Length=743

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 60/124 (48%), Gaps = 4/124 (3%)
 Frame = -3

Query  624  LGDCCRATGDAASAVKYFEESVN---FLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQ  454
            +GD  R +GD   A+  +  ++    FL +   DD      LSVS +K+G       DLQ
Sbjct  548  IGDAMRISGDGPGALANYRSALKVAEFLAEKAPDDDGFRRDLSVSHSKVGLALRLTNDLQ  607

Query  453  AARSYYFQALDIRRNAIKQHSQPSQ-TIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
             + + Y  AL I     K+    S+   D++VSL  + DV R  G+   A D +Q ++E+
Sbjct  608  GSIAEYEVALRITEALAKKKPDDSELQRDISVSLNAIGDVQRLSGHNDRAFDPYQRSVEI  667

Query  276  LQCL  265
             + L
Sbjct  668  AKTL  671



>ref|XP_002611437.1| hypothetical protein BRAFLDRAFT_63931 [Branchiostoma floridae]
 gb|EEN67447.1| hypothetical protein BRAFLDRAFT_63931 [Branchiostoma floridae]
Length=1400

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITH-TLSVSLNKIGDLKYY  469
             + + L  LG   R  GD   AV+Y E+S+     +  +D    H  ++ SLN +G   Y 
Sbjct  1011  IASSLNSLGAAWRIIGDHRKAVRYHEQSLKMRRIIYGED--TAHPNIANSLNNVGKAWYG  1068

Query  468   DEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
               D + A  ++ QAL + R+   + +  S  +D   SL  + +  RN+G+ + AV+ +++
Sbjct  1069  LGDYRKAIEHHEQALQMSRSMYGEDAAHSDIVD---SLNSLGNAQRNLGDHRKAVNYYEQ  1125

Query  288   AIEMLQCL  265
             A++M + +
Sbjct  1126  ALKMTRSI  1133


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 63/123 (51%), Gaps = 4/123 (3%)
 Frame = -3

Query  633   LGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQ  454
             L  LG+  R  GD   AV Y+E+++     +        H ++ SLN +G+      D  
Sbjct  1103  LNSLGNAQRNLGDHRKAVNYYEQALKMTRSIYGKS-TAHHDIAHSLNNLGNAWKGLGDHV  1161

Query  453   AARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEML  274
              A SYY Q+L +RR   + + + +   D+A SL  +     ++GN + A+  ++++++M+
Sbjct  1162  KAASYYEQSLQMRR---RIYGEGTVHPDIAASLNNLGSAWSDLGNHRKAIGYYEQSLKMM  1218

Query  273   QCL  265
             + +
Sbjct  1219  RSI  1221



>gb|ACF45059.1| SEFIR domain protein [Pelodictyon phaeoclathratiforme BU-1]
Length=1611

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 8/156 (5%)
 Frame = -3

Query  624   LGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQ  454
             +GD  RA G    A   F ++++    L +   D  +    LSVS NK+GDL       +
Sbjct  1373  MGDLYRALGQGEQARDAFLKALDIRQRLAQSEPDRADYQRDLSVSYNKMGDLYSALGQGE  1432

Query  453   AARSYYFQALDI-RRNAIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
              AR  + +AL+I +R A  +  +     D++VS  ++ D+ R +G  + A D F +A+E+
Sbjct  1433  QARDAFLKALEIAKRLAQSEPDRADYQRDLSVSYERMGDLYRALGQGEQARDAFLKALEI  1492

Query  276   LQCLKLNPEEVGLEQRRLSV----LEFLNSQLGKKE  181
              + L  +  +    QR LSV    +  L S LG+ E
Sbjct  1493  AKRLAQSEPDRADYQRDLSVSYNKMGDLYSALGQGE  1528



>gb|ACF47388.1| TPR repeat-containing protein [Prosthecochloris aestuarii DSM 
271]
Length=649

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 80/145 (55%), Gaps = 5/145 (3%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDL  526
            A +IR ++ R  N +     +   L  L +  R   D  SA+K ++E++    ++ + + 
Sbjct  287  ALEIRRELART-NRATYLPDVATTLNNLANLQRGINDYESALKGYQEALEIYRELARTN-  344

Query  525  EITHT--LSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHSQPSQTIDVAVSLA  352
              T+   ++++LN +  L+    D ++A   Y +AL+IRR  + + ++ +   DVA +L 
Sbjct  345  RATYLPDVAMTLNNMAVLQSDRNDYESALKGYQEALEIRRE-LARTNRATYLPDVATTLN  403

Query  351  KVADVDRNIGNEKTAVDGFQEAIEM  277
             +A++ R I + ++A+ G+QEA+E+
Sbjct  404  NLANLQRGINDYESALKGYQEALEI  428



>ref|XP_002611187.1| hypothetical protein BRAFLDRAFT_88414 [Branchiostoma floridae]
 gb|EEN67197.1| hypothetical protein BRAFLDRAFT_88414 [Branchiostoma floridae]
Length=1957

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  645   LGAVLGMLGDCCRATGDAASAVKYFEESVNFLLKVPKDDLEITHTLSVSLNKIGDLKYYD  466
             + + L  LG+     GD   AV Y+E+++     +  ++ E T  ++ SLN +G      
Sbjct  955   IASSLHNLGNTWGDLGDLKKAVSYYEQALQMKRSIYGENTEHT-DIARSLNSLGATWGDL  1013

Query  465   EDLQAARSYYFQALDIRRNAI-KQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQE  289
              DL+ A SYY QAL ++R+   K  + P    D+A SL  +     N+G+ K AV  +++
Sbjct  1014  GDLKKAVSYYEQALQMKRSIYGKDTAHP----DIASSLNNLGAAWTNLGDLKKAVSYYEQ  1069

Query  288   AIEM  277
             A++M
Sbjct  1070  ALQM  1073



>ref|WP_032471704.1| hypothetical protein, partial [Vibrio cholerae]
Length=331

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGN  319
            +VS  K+ ++++ +G+
Sbjct  308  SVSFNKLGEIEQQLGD  323



>ref|WP_032479475.1| hypothetical protein, partial [Vibrio cholerae]
Length=327

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGN  319
            +VS  K+ ++++ +G+
Sbjct  308  SVSFNKLGEIEQQLGD  323



>ref|WP_032470287.1| hypothetical protein, partial [Vibrio cholerae]
Length=326

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = -3

Query  705  AEDIREQVERMGNTSELCSQLGAVLGMLGDCCRATGDAASAVKYFEESVNF---LLKVPK  535
            A D+ EQ  + G +++   Q    LG LGD        A A   + +S+     L     
Sbjct  192  ARDLVEQ-RKQGRSAKEKRQYSIALGRLGDLLCEVNQYAEAKTAYAQSLAIDQQLHTSLG  250

Query  534  DDLEITHTLSVSLNKIGDLKYYDEDLQAARSYYFQALDIRRNAIKQHS----QPSQTIDV  367
            D  ++   LSVS NK+GD++    DL AA++ Y Q+L IR+   + HS     P    D+
Sbjct  251  DSPQVLRDLSVSFNKLGDIEQQLGDLHAAKAAYTQSLAIRQ---QLHSSLGDSPPVLRDL  307

Query  366  AVSLAKVADVDRNIGN  319
            +VS  K+ ++++ +G+
Sbjct  308  SVSFNKLGEIEQQLGD  323



>ref|WP_023767457.1| peptidase C14 [Mesorhizobium sp. LNHC232B00]
 gb|ESY64992.1| peptidase C14 [Mesorhizobium sp. LNHC232B00]
Length=876

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 76/154 (49%), Gaps = 9/154 (6%)
 Frame = -3

Query  624  LGDCCRATGDAASAVKYFEESVNF---LLKVPKDDLEITHTLSVSLNKIGDLKYYDEDLQ  454
            +GD  R  GDAA A+  +  S      L++   +D ++   LS+S  KIG+     E+  
Sbjct  634  IGDVLRQRGDAAGALVAYSRSQAIAEDLVRRDPNDTDLKRDLSISYAKIGNALNDQENWP  693

Query  453  AARSYYFQALDIRRN-AIKQHSQPSQTIDVAVSLAKVADVDRNIGNEKTAVDGFQEAIEM  277
            AA + Y QAL + R+ A    +      D++V L KVA V    GN   A+  +Q+++ +
Sbjct  694  AALASYRQALAVARDLAADDPANTEWQRDLSVCLEKVAGVLDAQGNTSGALQNYQDSLAI  753

Query  276  LQCL-KLNPEEVGLEQRRLSVLEFLNSQLGKKET  178
               L KL+P      QR LS+     S++G  ET
Sbjct  754  ANRLAKLDPGNSDW-QRDLSITL---SEIGMLET  783



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520