BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014N08

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           244   2e-76   Solanum tuberosum [potatoes]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             244   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                244   4e-76   Solanum lycopersicum
ref|XP_002524558.1|  ribosomal protein L5, putative                     243   6e-76   Ricinus communis
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           242   2e-75   Nicotiana tomentosiformis
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   242   2e-75   
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           242   2e-75   Nicotiana sylvestris
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   242   2e-75   
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           241   2e-75   Solanum tuberosum [potatoes]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                241   4e-75   Solanum lycopersicum
ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                240   9e-75   Nicotiana sylvestris
ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           240   1e-74   
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           240   1e-74   Nicotiana tomentosiformis
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                239   2e-74   Populus euphratica
gb|KJB71614.1|  hypothetical protein B456_011G133700                    239   2e-74   Gossypium raimondii
ref|XP_010101365.1|  60S ribosomal protein L5                           239   2e-74   
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                239   3e-74   Prunus mume [ume]
gb|KJB84075.1|  hypothetical protein B456_N001600                       234   4e-74   Gossypium raimondii
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                238   7e-74   Nicotiana tomentosiformis
emb|CDP18434.1|  unnamed protein product                                239   8e-74   Coffea canephora [robusta coffee]
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           238   9e-74   Sesamum indicum [beniseed]
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           237   1e-73   Populus euphratica
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         237   1e-73   Jatropha curcas
ref|NP_001274803.1|  uncharacterized protein LOC102577675               236   4e-73   Solanum tuberosum [potatoes]
gb|KJB84074.1|  hypothetical protein B456_N001600                       234   4e-73   Gossypium raimondii
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           236   5e-73   Nicotiana sylvestris
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                236   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           236   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             235   8e-73   Citrus clementina [clementine]
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                235   8e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK93596.1|  unknown                                                 235   8e-73   Populus trichocarpa [western balsam poplar]
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             235   9e-73   Populus trichocarpa [western balsam poplar]
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     235   1e-72   Eucalyptus grandis [rose gum]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   234   1e-72   Citrus sinensis [apfelsine]
gb|KJB27798.1|  hypothetical protein B456_005G010200                    235   1e-72   Gossypium raimondii
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           234   1e-72   Citrus sinensis [apfelsine]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                235   1e-72   Sesamum indicum [beniseed]
gb|ADR71225.1|  60S ribosomal protein L5A                               234   1e-72   Hevea brasiliensis [jebe]
gb|KJB84072.1|  hypothetical protein B456_N001600                       234   2e-72   Gossypium raimondii
gb|KJB84073.1|  hypothetical protein B456_N001600                       234   2e-72   Gossypium raimondii
emb|CDP17898.1|  unnamed protein product                                236   2e-72   Coffea canephora [robusta coffee]
ref|XP_002524859.1|  ribosomal protein L5, putative                     233   3e-72   Ricinus communis
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           236   4e-72   
gb|ADR71226.1|  60S ribosomal protein L5B                               233   7e-72   Hevea brasiliensis [jebe]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           232   1e-71   Citrus sinensis [apfelsine]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  232   1e-71   Citrus sinensis [apfelsine]
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                232   1e-71   Eucalyptus grandis [rose gum]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                232   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              229   1e-71   
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     232   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     232   2e-71   
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           230   5e-71   Populus euphratica
gb|AES74307.2|  60S ribosomal protein L5-2                              230   5e-71   Medicago truncatula
gb|ACJ85054.1|  unknown                                                 230   6e-71   Medicago truncatula
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     232   7e-71   Eucalyptus grandis [rose gum]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                230   7e-71   Vitis vinifera
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                230   8e-71   Erythranthe guttata [common monkey flower]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         230   8e-71   Jatropha curcas
ref|XP_003604056.1|  60S ribosomal protein L5                           231   9e-71   
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             232   1e-70   
gb|ACG36552.1|  60S ribosomal protein L5-1                              229   1e-70   Zea mays [maize]
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         229   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              229   1e-70   Zea mays [maize]
emb|CBI24704.3|  unnamed protein product                                231   1e-70   Vitis vinifera
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           229   2e-70   
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           229   2e-70   Cicer arietinum [garbanzo]
gb|KJB22669.1|  hypothetical protein B456_004G060400                    229   3e-70   Gossypium raimondii
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           229   3e-70   Tarenaya hassleriana [spider flower]
gb|KJB22668.1|  hypothetical protein B456_004G060400                    229   3e-70   Gossypium raimondii
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             228   3e-70   
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         229   3e-70   Brachypodium distachyon [annual false brome]
gb|ABK95722.1|  unknown                                                 228   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                228   4e-70   Fragaria vesca subsp. vesca
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    226   4e-70   
gb|AFK41086.1|  unknown                                                 228   5e-70   Medicago truncatula
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           228   7e-70   Sesamum indicum [beniseed]
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                227   1e-69   Elaeis guineensis
gb|ABK93902.1|  unknown                                                 227   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             226   2e-69   Phaseolus vulgaris [French bean]
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    226   2e-69   
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    226   2e-69   Elaeis guineensis
gb|ACU23594.1|  unknown                                                 226   3e-69   Glycine max [soybeans]
gb|ACR38045.1|  unknown                                                 226   3e-69   Zea mays [maize]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   226   3e-69   
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           226   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT04099.1|  60S ribosomal protein L5-2                              225   5e-69   
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         225   6e-69   Pyrus x bretschneideri [bai li]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             225   7e-69   Phaseolus vulgaris [French bean]
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   226   1e-68   
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           226   1e-68   Glycine max [soybeans]
dbj|BAB33422.1|  putative senescence-associated protein                 224   1e-68   Pisum sativum [garden pea]
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              224   1e-68   Brachypodium distachyon [annual false brome]
ref|NP_001151284.1|  60S ribosomal protein L5-1                         224   1e-68   Zea mays [maize]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           224   2e-68   Cicer arietinum [garbanzo]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           224   2e-68   Glycine max [soybeans]
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                224   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                224   3e-68   Cucumis melo [Oriental melon]
gb|AFK39593.1|  unknown                                                 223   3e-68   Lotus japonicus
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           223   4e-68   Phoenix dactylifera
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         223   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           223   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           223   6e-68   Phoenix dactylifera
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   223   6e-68   Phaseolus vulgaris [French bean]
gb|KHN36792.1|  60S ribosomal protein L5                                222   9e-68   Glycine soja [wild soybean]
gb|KJB27799.1|  hypothetical protein B456_005G010200                    222   9e-68   Gossypium raimondii
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           220   1e-67   
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         222   1e-67   Malus domestica [apple tree]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         222   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                222   1e-67   
gb|AEV92989.1|  60S ribosomal protein L5                                221   2e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           221   2e-67   Glycine max [soybeans]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    221   2e-67   Phoenix dactylifera
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    221   2e-67   
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    221   2e-67   Glycine max [soybeans]
gb|EMS47485.1|  60S ribosomal protein L5-1                              220   2e-67   Triticum urartu
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           221   3e-67   Cucumis melo [Oriental melon]
ref|NP_001267659.1|  60S ribosomal protein L5                           221   3e-67   Cucumis sativus [cucumbers]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         221   3e-67   Oryza brachyantha
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                221   3e-67   Malus domestica [apple tree]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           221   3e-67   Glycine max [soybeans]
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           220   6e-67   
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           220   7e-67   
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    220   7e-67   
gb|KHN27258.1|  60S ribosomal protein L5                                220   8e-67   Glycine soja [wild soybean]
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           219   9e-67   Cucumis sativus [cucumbers]
dbj|BAJ89012.1|  predicted protein                                      219   9e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           219   1e-66   Fragaria vesca subsp. vesca
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         219   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              219   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         219   2e-66   Setaria italica
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             219   2e-66   Phaseolus vulgaris [French bean]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           218   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        219   3e-66   
gb|AHA84189.1|  60S ribosomal protein L5                                218   3e-66   Phaseolus vulgaris [French bean]
dbj|BAD82173.1|  putative ribosomal protein L5                          218   4e-66   Oryza sativa Japonica Group [Japonica rice]
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        218   5e-66   Oryza sativa Indica Group [Indian rice]
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      218   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045083.1|  Os01g0896800                                       218   5e-66   
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          218   6e-66   Sorghum bicolor [broomcorn]
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    217   7e-66   Oryza brachyantha
gb|AFK46994.1|  unknown                                                 217   7e-66   Lotus japonicus
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    218   7e-66   
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             217   7e-66   Prunus persica
gb|AFK36106.1|  unknown                                                 217   8e-66   Lotus japonicus
gb|KHG04393.1|  60S ribosomal L5                                        216   1e-65   Gossypium arboreum [tree cotton]
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         216   2e-65   Prunus mume [ume]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             216   2e-65   Eutrema salsugineum [saltwater cress]
gb|EMS59984.1|  60S ribosomal protein L5-2                              216   3e-65   Triticum urartu
gb|EMT23062.1|  60S ribosomal protein L5-2                              214   1e-64   
gb|EMT20601.1|  60S ribosomal protein L5-2                              214   1e-64   
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         214   1e-64   Zea mays [maize]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         213   2e-64   
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             213   6e-64   Arabidopsis lyrata subsp. lyrata
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               213   6e-64   Erythranthe guttata [common monkey flower]
gb|KHN15970.1|  60S ribosomal protein L5                                212   9e-64   Glycine soja [wild soybean]
gb|KHG14330.1|  60S ribosomal L5                                        211   9e-64   Gossypium arboreum [tree cotton]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         212   1e-63   Tarenaya hassleriana [spider flower]
ref|NP_001189970.1|  60S ribosomal protein L5-1                         208   1e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10378.1|  60S ribosomal protein L5                                210   1e-63   Gossypium arboreum [tree cotton]
gb|KHG10377.1|  60S ribosomal protein L5                                210   1e-63   Gossypium arboreum [tree cotton]
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           211   4e-63   Elaeis guineensis
ref|XP_010648788.1|  PREDICTED: 60S ribosomal protein L5-like           206   5e-63   Vitis vinifera
ref|NP_198790.1|  60S ribosomal protein L5-2                            210   5e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  208   6e-63   Citrus sinensis [apfelsine]
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    209   9e-63   Arabis alpina [alpine rockcress]
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             208   2e-62   Capsella rubella
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         208   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         208   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         208   3e-62   Camelina sativa [gold-of-pleasure]
ref|NP_566767.1|  60S ribosomal protein L5-1                            208   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         208   3e-62   Camelina sativa [gold-of-pleasure]
dbj|BAH20263.1|  AT3G25520                                              205   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    208   4e-62   
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             208   4e-62   
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    207   4e-62   Brassica rapa
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             207   4e-62   Eutrema salsugineum [saltwater cress]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    207   5e-62   Arabis alpina [alpine rockcress]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         207   5e-62   Brassica rapa
emb|CDY27889.1|  BnaA07g04790D                                          207   8e-62   Brassica napus [oilseed rape]
emb|CDY52294.1|  BnaA03g57870D                                          207   9e-62   Brassica napus [oilseed rape]
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    207   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009384264.1|  PREDICTED: 60S ribosomal protein L5-like iso...    202   9e-62   
emb|CDY52293.1|  BnaA03g57860D                                          207   1e-61   Brassica napus [oilseed rape]
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             206   1e-61   
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          206   2e-61   
ref|XP_009384265.1|  PREDICTED: 60S ribosomal protein L5-like iso...    203   2e-61   
emb|CDY50258.1|  BnaC07g47930D                                          206   3e-61   Brassica napus [oilseed rape]
emb|CDX86312.1|  BnaA06g30290D                                          206   3e-61   
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             205   4e-61   Capsella rubella
emb|CDY15089.1|  BnaC03g44500D                                          206   4e-61   Brassica napus [oilseed rape]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              205   5e-61   
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           203   6e-61   
gb|AAM64753.1|  ribosomal protein, putative                             204   7e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34395.1|  unknown                                                 204   1e-60   Lotus japonicus
ref|XP_002876523.1|  predicted protein                                  204   1e-60   Arabidopsis lyrata subsp. lyrata
emb|CDX85331.1|  BnaC07g26420D                                          206   2e-60   
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         202   4e-60   Brassica rapa
gb|EYU36673.1|  hypothetical protein MIMGU_mgv1a0142632mg               196   7e-60   Erythranthe guttata [common monkey flower]
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             201   2e-59   Capsella rubella
gb|KHG15135.1|  60S ribosomal L5                                        199   2e-59   Gossypium arboreum [tree cotton]
gb|ABK21084.1|  unknown                                                 199   1e-58   Picea sitchensis
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   197   1e-58   Citrus sinensis [apfelsine]
gb|KJB71615.1|  hypothetical protein B456_011G133700                    197   2e-58   Gossypium raimondii
gb|KJB10810.1|  hypothetical protein B456_001G226000                    197   4e-58   Gossypium raimondii
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     196   1e-57   Eucalyptus grandis [rose gum]
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            194   2e-57   
gb|KCW63927.1|  hypothetical protein EUGRSUZ_G016041                    191   2e-57   Eucalyptus grandis [rose gum]
ref|XP_001759628.1|  predicted protein                                  192   2e-56   
ref|XP_001783620.1|  predicted protein                                  192   2e-56   
ref|XP_001767871.1|  predicted protein                                  192   3e-56   
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  189   3e-55   Citrus sinensis [apfelsine]
sp|P93779.1|RL5_SOLME  RecName: Full=60S ribosomal protein L5           183   5e-55   Solanum melongena [aubergine]
emb|CDY15088.1|  BnaC03g44490D                                          190   6e-55   Brassica napus [oilseed rape]
ref|XP_001783411.1|  predicted protein                                  188   2e-54   
ref|XP_010451808.1|  PREDICTED: 60S ribosomal protein L5-1-like         182   2e-54   
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   184   6e-53   Phaseolus vulgaris [French bean]
gb|KHF99386.1|  60S ribosomal L5                                        182   9e-53   Gossypium arboreum [tree cotton]
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             179   3e-51   Selaginella moellendorffii
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             177   2e-50   Selaginella moellendorffii
gb|EPS61271.1|  hypothetical protein M569_13526                         173   2e-49   Genlisea aurea
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    172   1e-48   
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         170   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009383145.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    159   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN36791.1|  60S ribosomal protein L5                                157   2e-43   Glycine soja [wild soybean]
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          157   1e-42   
ref|XP_011399144.1|  60S ribosomal protein L5-1                         155   4e-42   Auxenochlorella protothecoides
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              152   6e-41   Chlorella variabilis
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  146   1e-38   Daphnia pulex
gb|KDD76608.1|  ribosomal L18p/L5e                                      145   3e-38   Helicosporidium sp. ATCC 50920
ref|XP_011014769.1|  PREDICTED: 60S ribosomal protein L5-like           138   7e-38   Populus euphratica
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                144   1e-37   Tribolium castaneum [rust-red flour beetle]
emb|CBI38287.3|  unnamed protein product                                137   2e-37   Vitis vinifera
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     142   4e-37   Scedosporium apiospermum
gb|ABK92743.1|  unknown                                                 134   4e-36   Populus trichocarpa [western balsam poplar]
gb|KIK30810.1|  hypothetical protein PISMIDRAFT_86523                   140   5e-36   Pisolithus microcarpus 441
ref|XP_005643753.1|  60S ribosomal protein L5                           139   5e-36   Coccomyxa subellipsoidea C-169
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           139   5e-36   Ceratitis capitata [medfly]
dbj|BAN20290.1|  ribosomal protein L5                                   139   7e-36   Riptortus pedestris
ref|XP_002550737.1|  60S ribosomal protein L5                           139   9e-36   Candida tropicalis MYA-3404
gb|EHJ70750.1|  ribosomal protein L5                                    138   2e-35   
gb|EMF17397.1|  60S ribosomal protein L5                                138   2e-35   Sphaerulina musiva SO2202
ref|NP_001037008.1|  60S ribosomal protein L5                           138   2e-35   Bombyx mori [silk moth]
gb|ADT80695.1|  ribosomal protein L5                                    138   2e-35   Euphydryas aurinia [marsh fritillary]
gb|AAV34814.1|  ribosomal protein L5                                    137   3e-35   Bombyx mori [silk moth]
gb|ABS18358.1|  ribosomal protein L5                                    134   3e-35   Artemia franciscana
gb|ACY95338.1|  ribosomal protein L5                                    137   4e-35   Manduca sexta [Carolina sphinx]
ref|XP_002497480.1|  60S ribosomal protein L5                           137   5e-35   Zygosaccharomyces rouxii
gb|KIO13004.1|  hypothetical protein M404DRAFT_706860                   137   5e-35   Pisolithus tinctorius Marx 270
ref|XP_007880337.1|  hypothetical protein PFL1_04620                    137   6e-35   Anthracocystis flocculosa PF-1
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                136   8e-35   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002617003.1|  hypothetical protein CLUG_02447                    136   8e-35   Clavispora lusitaniae ATCC 42720
ref|XP_007773415.1|  60S ribosomal protein L5                           136   1e-34   Coniophora puteana RWD-64-598 SS2
gb|KDR83692.1|  hypothetical protein GALMADRAFT_236026                  136   1e-34   Galerina marginata CBS 339.88
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     136   1e-34   Eremothecium cymbalariae DBVPG#7215
gb|AGO11355.1|  AaceriACR104Cp                                          135   1e-34   Saccharomycetaceae sp. 'Ashbya aceri'
ref|NP_983506.1|  60S ribosomal protein L5                              135   1e-34   Eremothecium gossypii ATCC 10895
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                135   2e-34   Zeugodacus cucurbitae [melon fruit fly]
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   135   2e-34   Coptotermes formosanus
ref|XP_003349274.1|  60S ribosomal protein L5                           135   2e-34   Sordaria macrospora k-hell
ref|XP_002675028.1|  predicted protein                                  135   2e-34   Naegleria gruberi strain NEG-M
ref|XP_005188116.1|  PREDICTED: 60S ribosomal protein L5                135   2e-34   Musca domestica
emb|CAJ17229.1|  ribosomal protein L5e                                  135   3e-34   Carabus granulatus
ref|XP_001268969.1|  60S ribosomal protein L5                           135   3e-34   Aspergillus clavatus NRRL 1
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                135   3e-34   Nasonia vitripennis
gb|KDR11979.1|  60S ribosomal protein L5                                135   3e-34   Zootermopsis nevadensis
ref|XP_007738723.1|  60S ribosomal protein L5                           134   4e-34   Capronia epimyces CBS 606.96
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           134   5e-34   Lysiphlebus testaceipes
gb|EPS25441.1|  hypothetical protein PDE_00374                          134   5e-34   Penicillium oxalicum 114-2
ref|XP_007392523.1|  hypothetical protein PHACADRAFT_250801             134   5e-34   Phanerochaete carnosa HHB-10118-sp
ref|XP_003856228.1|  60S ribosomal protein L5                           134   5e-34   Zymoseptoria tritici IPO323
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             134   6e-34   Neurospora tetrasperma FGSC 2508
ref|XP_001912102.1|  hypothetical protein                               134   6e-34   Podospora anserina S mat+
gb|KIY49257.1|  hypothetical protein FISHEDRAFT_72600                   134   7e-34   Fistulina hepatica ATCC 64428
ref|XP_960578.1|  60s ribosomal protein l5                              134   8e-34   Neurospora crassa OR74A
ref|XP_001639289.1|  predicted protein                                  134   9e-34   Nematostella vectensis
ref|XP_007861880.1|  60S ribosomal protein L5                           134   9e-34   Gloeophyllum trabeum ATCC 11539
ref|XP_002066772.1|  GK24660                                            134   9e-34   Drosophila willistoni
gb|KIJ20064.1|  hypothetical protein PAXINDRAFT_166226                  134   9e-34   Paxillus involutus ATCC 200175
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               133   1e-33   Metarhizium anisopliae ARSEF 549
emb|CCF48291.1|  probable RPL5-60S large subunit ribosomal protei...    133   1e-33   
ref|XP_002002621.1|  GI17484                                            138   1e-33   
gb|EFZ13276.1|  hypothetical protein SINV_12586                         133   1e-33   
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              133   1e-33   
ref|XP_001973913.1|  GG21448                                            133   1e-33   
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    133   1e-33   
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                133   1e-33   
gb|KIM67945.1|  hypothetical protein SCLCIDRAFT_107388                  133   1e-33   
emb|CCQ18634.1|  60S ribosomal protein L5                               133   1e-33   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 133   1e-33   
gb|KIM46136.1|  hypothetical protein M413DRAFT_441200                   133   1e-33   
dbj|BAA31570.1|  ribosomal protein L5 homolog                           132   1e-33   
ref|XP_004182559.1|  hypothetical protein TBLA_0J00400                  133   1e-33   
ref|XP_002044351.1|  GM26730                                            134   1e-33   
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               133   1e-33   
ref|XP_001264474.1|  60S ribosomal protein L5                           134   1e-33   
ref|XP_003675508.1|  hypothetical protein NCAS_0C01510                  133   2e-33   
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    133   2e-33   
gb|EPY50445.1|  60S ribosomal protein L5                                132   2e-33   
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          133   2e-33   
gb|EPY50651.1|  60S ribosomal protein L5                                132   2e-33   
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               133   2e-33   
ref|XP_002023101.1|  GL21177                                            132   2e-33   
gb|AEL28875.1|  ribosomal protein L5                                    132   2e-33   
ref|XP_453370.1|  60S ribosomal protein L5                              132   2e-33   
ref|XP_007366056.1|  hypothetical protein DICSQDRAFT_86741              132   2e-33   
ref|XP_007381881.1|  60S ribosomal protein L5                           133   2e-33   
ref|XP_008022306.1|  hypothetical protein SETTUDRAFT_167313             130   3e-33   
ref|XP_004200165.1|  Piso0_002740                                       132   3e-33   
emb|CAJ17230.1|  ribosomal protein L5e                                  132   3e-33   
gb|KIK06671.1|  hypothetical protein K443DRAFT_673956                   132   3e-33   
gb|KIK95588.1|  hypothetical protein PAXRUDRAFT_826861                  132   3e-33   
ref|XP_007712612.1|  hypothetical protein COCCADRAFT_5332               132   3e-33   
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             132   3e-33   
ref|XP_001966910.1|  GF22760                                            132   3e-33   
ref|XP_003662289.1|  hypothetical protein MYCTH_78218                   132   3e-33   
ref|XP_009153803.1|  60S ribosomal protein L5                           132   3e-33   
dbj|BAM19090.1|  ribosomal protein L5                                   132   3e-33   
gb|KEQ82579.1|  hypothetical protein M438DRAFT_398586                   132   3e-33   
gb|KDQ29411.1|  hypothetical protein PLEOSDRAFT_1055401                 132   3e-33   
gb|KEQ78036.1|  hypothetical protein M436DRAFT_59974                    132   3e-33   
ref|XP_007813241.1|  60S ribosomal protein L5                           132   4e-33   
gb|ACY66547.1|  ribosomal protein L5                                    129   4e-33   
ref|XP_003649901.1|  60S ribosomal protein L5                           132   4e-33   
gb|KIK68088.1|  hypothetical protein GYMLUDRAFT_92742                   132   4e-33   
gb|KIM25886.1|  hypothetical protein M408DRAFT_330884                   132   4e-33   
ref|XP_007687883.1|  hypothetical protein COCMIDRAFT_36698              132   4e-33   
emb|CCF42723.1|  60S ribosomal protein L5                               128   4e-33   
emb|CCK72232.1|  hypothetical protein KNAG_0J01510                      132   4e-33   
gb|KEQ61687.1|  hypothetical protein M437DRAFT_67147                    132   5e-33   
ref|XP_001877132.1|  60S ribosomal protein L5                           132   5e-33   
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    132   5e-33   
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           132   5e-33   
gb|EPX71630.1|  60S ribosomal protein L5                                131   5e-33   
emb|CDO75577.1|  hypothetical protein BN946_scf184858.g17               131   6e-33   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           131   6e-33   
gb|EPX72323.1|  60S ribosomal protein L5                                131   6e-33   
ref|XP_007705225.1|  hypothetical protein COCSADRAFT_41417              131   6e-33   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     131   6e-33   
gb|KEQ95896.1|  hypothetical protein AUEXF2481DRAFT_39748               131   6e-33   
gb|KHN96356.1|  60S ribosomal protein L5                                131   7e-33   
emb|CEJ93107.1|  Putative 60S ribosomal protein L5 (CPR4)               130   7e-33   
gb|KII95147.1|  hypothetical protein PLICRDRAFT_97457                   131   7e-33   
gb|EKG20809.1|  Ribosomal protein L18/L5                                131   8e-33   
ref|XP_003670285.1|  ribosomal protein L5                               131   8e-33   
gb|KEF55260.1|  60S ribosomal protein L5                                131   8e-33   
ref|NP_596399.1|  60S ribosomal protein L5                              131   8e-33   
ref|XP_006689766.1|  hypothetical protein CANTEDRAFT_116632             131   8e-33   
ref|XP_007725761.1|  60S ribosomal protein L5                           131   8e-33   
dbj|BAM17686.1|  ribosomal protein L5                                   131   8e-33   
gb|ADQ73874.1|  60S ribosomal protein L5                                131   8e-33   
emb|CCE29368.1|  probable 60S ribosomal protein L5                      131   8e-33   
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           132   9e-33   
gb|EMG45911.1|  60S ribosomal protein L5                                131   9e-33   
gb|KJA30227.1|  hypothetical protein HYPSUDRAFT_196476                  131   9e-33   
gb|KIW93473.1|  60S ribosomal protein L5                                131   1e-32   
gb|KFH68392.1|  60S ribosomal protein L5                                131   1e-32   
gb|ACG27083.1|  60S ribosomal protein L5-2                              131   1e-32   
ref|XP_011390982.1|  ribosomal 60S subunit protein L5                   131   1e-32   
gb|KDN36129.1|  putative RPL5-60S large subunit ribosomal protein...    130   1e-32   
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           130   1e-32   
ref|XP_011105789.1|  rpl5p                                              130   1e-32   
ref|XP_002109848.1|  expressed hypothetical protein                     130   1e-32   
ref|XP_003958806.1|  hypothetical protein KAFR_0H02620                  130   1e-32   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       131   1e-32   
ref|XP_003842266.1|  similar to 60S ribosomal protein L5                131   1e-32   
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           130   1e-32   
ref|XP_002478553.1|  60S ribosomal protein L5                           130   1e-32   
ref|XP_007268728.1|  60S ribosomal protein L5                           130   2e-32   
gb|KIJ70516.1|  hypothetical protein HYDPIDRAFT_78845                   130   2e-32   
gb|EFN77280.1|  60S ribosomal protein L5                                131   2e-32   
ref|XP_003173381.1|  60S ribosomal protein L5                           130   2e-32   
ref|XP_001837210.1|  60S ribosomal protein L5                           130   2e-32   
gb|KIX05556.1|  60S ribosomal protein L5                                130   2e-32   
ref|XP_007800448.1|  60S ribosomal protein L5                           130   2e-32   
gb|EFN62403.1|  60S ribosomal protein L5                                131   2e-32   
ref|XP_007315632.1|  hypothetical protein SERLADRAFT_461185             130   2e-32   
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           130   2e-32   
gb|KDQ64549.1|  hypothetical protein JAAARDRAFT_28194                   130   2e-32   
ref|XP_007852257.1|  60s ribosomal protein l5                           130   2e-32   
gb|ELU36170.1|  60S ribosomal protein L5                                131   2e-32   
emb|CDO93596.1|  unnamed protein product                                130   2e-32   
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5                130   2e-32   
ref|XP_004199306.1|  Piso0_002740                                       130   3e-32   
ref|XP_007581033.1|  putative 60s ribosomal protein l5 protein          130   3e-32   
ref|XP_008474018.1|  PREDICTED: 60S ribosomal protein L5                130   3e-32   
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5                129   3e-32   
ref|XP_007746291.1|  60S ribosomal protein L5                           129   3e-32   
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                   129   3e-32   
gb|KIY71482.1|  hypothetical protein CYLTODRAFT_487247                  129   3e-32   
ref|XP_007275120.1|  60s ribosomal protein l5                           129   3e-32   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     129   3e-32   
ref|XP_002130156.1|  PREDICTED: 60S ribosomal protein L5                129   4e-32   
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5-like           129   4e-32   
emb|CDF91015.1|  ZYBA0S09-02894g1_1                                     129   4e-32   
gb|KDB12690.1|  60S ribosomal protein L5                                129   4e-32   
ref|XP_001951987.1|  PREDICTED: 60S ribosomal protein L5                129   4e-32   
gb|EQB57780.1|  hypothetical protein CGLO_02053                         129   4e-32   
gb|EMD40741.1|  hypothetical protein CERSUDRAFT_80390                   129   4e-32   
ref|XP_006696670.1|  60S ribosomal protein l5-like protein              129   5e-32   
ref|NP_594180.1|  60S ribosomal protein L5                              129   5e-32   
gb|AEE61390.1|  unknown                                                 129   5e-32   
emb|CEJ93106.1|  Putative 60S ribosomal protein L5 (CPR4)               129   5e-32   
ref|XP_002490002.1|  60S ribosomal protein L5                           129   6e-32   
ref|XP_007779399.1|  60S ribosomal protein L5                           129   7e-32   
ref|XP_002146254.1|  60S ribosomal protein L5                           129   7e-32   
emb|CEL63831.1|  60S ribosomal protein L5-A OS=Schizosaccharomyce...    130   7e-32   
ref|XP_003036567.1|  60S ribosomal protein L5                           129   7e-32   
ref|XP_009543697.1|  hypothetical protein HETIRDRAFT_408220             129   7e-32   
gb|EJK70557.1|  hypothetical protein THAOC_08069                        129   7e-32   
emb|CDH08743.1|  probable 60S ribosomal protein L5                      129   7e-32   
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    129   7e-32   
gb|EMR84013.1|  putative 60s ribosomal protein l5 protein               128   7e-32   
gb|AAN73355.1|  ribosomal protein L5                                    128   8e-32   
ref|XP_003006324.1|  60S ribosomal protein L5                           128   8e-32   
gb|EPT03783.1|  hypothetical protein FOMPIDRAFT_1022326                 128   8e-32   
gb|EHM99874.1|  Rpl5p                                                   128   8e-32   
ref|XP_002845089.1|  60S ribosomal protein L5                           129   8e-32   
ref|XP_001940200.1|  60S ribosomal protein L5                           128   9e-32   
emb|CDI55135.1|  probable RPL5-60S large subunit ribosomal protei...    128   9e-32   
ref|XP_001224676.1|  60S ribosomal protein L5                           128   9e-32   
gb|KDN68874.1|  putative ribosomal L18p/L5e family protein              128   9e-32   
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5                128   9e-32   
gb|EFQ28351.1|  ribosomal L18p/L5e family protein                       128   9e-32   
ref|XP_001547892.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_002625745.1|  60S ribosomal protein L5                           128   1e-31   
ref|XP_007303062.1|  hypothetical protein STEHIDRAFT_120627             128   1e-31   
ref|XP_011147768.1|  PREDICTED: 60S ribosomal protein L5-like           128   1e-31   
gb|EUC66279.1|  60S ribosomal protein L5                                128   1e-31   
ref|XP_004068201.1|  PREDICTED: 60S ribosomal protein L5                128   1e-31   
gb|EFN62999.1|  60S ribosomal protein L5                                133   1e-31   
ref|XP_002176750.1|  predicted protein                                  128   1e-31   
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575             128   1e-31   
gb|KIV84110.1|  60S ribosomal protein L5                                127   2e-31   
gb|KIP10396.1|  hypothetical protein PHLGIDRAFT_28501                   128   2e-31   
ref|XP_006460296.1|  hypothetical protein AGABI2DRAFT_142569            128   2e-31   
gb|KIW03639.1|  60S ribosomal protein L5                                128   2e-31   
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                   128   2e-31   
ref|XP_008599464.1|  60S ribosomal protein L5 (CPR4)                    127   2e-31   
gb|KGO46596.1|  Ribosomal protein L5 eukaryotic/L18 archaeal, C-t...    127   2e-31   
ref|XP_009648689.1|  60S ribosomal protein L5                           127   2e-31   
ref|XP_001588768.1|  60S ribosomal protein L5                           127   2e-31   
emb|CCU97371.1|  unnamed protein product                                127   2e-31   
gb|KIW09974.1|  60S ribosomal protein L5                                127   2e-31   
ref|XP_003715227.1|  60S ribosomal protein L5                           127   2e-31   
emb|CDM28678.1|  60S ribosomal protein L5                               127   2e-31   
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                       128   2e-31   
ref|XP_003010152.1|  hypothetical protein ARB_03590                     127   2e-31   
gb|EME50014.1|  hypothetical protein DOTSEDRAFT_31141                   127   2e-31   
gb|KIK48932.1|  hypothetical protein CY34DRAFT_797724                   127   2e-31   
dbj|BAD94104.1|  ribosomal protein                                      122   2e-31   
ref|XP_001854652.1|  60S ribosomal protein L5                           127   2e-31   
emb|CEP64074.1|  LALA0S10e01684g1_1                                     127   2e-31   
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           127   2e-31   
ref|XP_001210567.1|  60S ribosomal protein L5                           127   2e-31   
emb|CCF44686.1|  60S ribosomal protein L5                               127   2e-31   
gb|KIW58102.1|  60S ribosomal protein L5                                127   2e-31   
gb|EEH21335.1|  60S ribosomal protein L5                                127   2e-31   
gb|EFN79020.1|  60S ribosomal protein L5                                128   2e-31   
ref|XP_007337949.1|  hypothetical protein AURDEDRAFT_110414             127   3e-31   
ref|XP_001634531.1|  predicted protein                                  127   3e-31   
ref|XP_001645025.1|  hypothetical protein Kpol_1072p37                  127   3e-31   
gb|ACH56834.1|  60S ribosomal protein L5                                126   3e-31   
ref|XP_002798009.1|  60S ribosomal protein L5                           127   3e-31   
gb|KIR56129.1|  50S small subunit ribosomal protein L5e                 127   3e-31   
sp|Q5XUC7.1|RL5_TOXCI  RecName: Full=60S ribosomal protein L5           127   3e-31   
gb|KIM90853.1|  hypothetical protein PILCRDRAFT_811340                  127   3e-31   
gb|KFA64074.1|  hypothetical protein S40285_06737                       127   4e-31   
gb|EPQ65986.1|  Protein component of the large (60S) ribosomal su...    127   4e-31   
ref|XP_003298671.1|  60S ribosomal protein L5                           127   4e-31   
ref|XP_658617.1|  RL5_NEUCR 60S ribosomal protein L5 (CPR4)             127   4e-31   
ref|XP_001242010.1|  60S ribosomal protein L5                           126   4e-31   
gb|ENH79878.1|  60s ribosomal protein l5                                126   4e-31   
emb|CCU76476.1|  60S ribosomal protein L5                               126   5e-31   
gb|KDQ12695.1|  hypothetical protein BOTBODRAFT_34150                   126   5e-31   
ref|XP_003693438.1|  PREDICTED: 60S ribosomal protein L5-like           126   5e-31   
dbj|GAK66444.1|  60S ribosomal protein L5                               126   5e-31   
gb|ADV40159.1|  putative 60S ribosomal protein L5                       126   5e-31   
ref|XP_001536662.1|  60S ribosomal protein L5                           126   5e-31   
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        126   5e-31   
gb|EHK26573.1|  hypothetical protein TRIVIDRAFT_77851                   126   5e-31   
gb|EGE06634.1|  60S ribosomal protein L5                                126   5e-31   
ref|NP_001104213.1|  uncharacterized protein LOC100126642               126   5e-31   
emb|CCG82998.1|  60S ribosomal protein L5-B                             126   5e-31   
ref|XP_003234828.1|  60S ribosomal protein L5                           126   5e-31   
ref|XP_011506330.1|  PREDICTED: 60S ribosomal protein L5                126   5e-31   
gb|EGE00888.1|  60S ribosomal protein L5                                126   5e-31   
gb|KEY69974.1|  hypothetical protein S7711_03992                        126   6e-31   
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      126   6e-31   
gb|KGG50093.1|  60S ribosomal protein L5-2                              127   6e-31   
ref|XP_009223169.1|  60S ribosomal protein L5                           126   6e-31   
ref|XP_002553159.1|  60S ribosomal protein L5                           126   6e-31   
gb|KIW22485.1|  60S ribosomal protein L5                                126   6e-31   
ref|XP_001483338.1|  hypothetical protein PGUG_04067                    126   6e-31   
ref|XP_003019448.1|  hypothetical protein TRV_06528                     126   6e-31   
ref|XP_006968241.1|  ribosomal protein L5                               126   7e-31   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           126   7e-31   
gb|ACZ13335.1|  60S ribosomal protein L5                                126   7e-31   
gb|KIL96266.1|  60s ribosomal protein l5                                126   7e-31   
ref|XP_011273875.1|  60S ribosomal protein L5-B                         126   7e-31   
ref|XP_002544923.1|  60S ribosomal protein L5                           125   8e-31   



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKYQ+ FS YIKKG++AD LE++YKKVHAAIRADP  KKSEKQPPK+HK
Sbjct  205  TYMKTLIEDEPEKYQTHFSEYIKKGLEADGLEEMYKKVHAAIRADPCPKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFAKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+GIDAD +E LYKKVHAAIRADP+AKKSEKQPPKEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+AA
Sbjct  265  RYNLKKLTYEERKAKLVERLNALNSAA  291



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDA+VHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKYQ+ FS YIKKG +AD LE++YKKVHAAIRADPS KKSEKQPPK+HK
Sbjct  205  TYMQTLIEDEPEKYQTHFSQYIKKGFEADGLEEMYKKVHAAIRADPSPKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+K+SKQLD+EVHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKESKQLDSEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIKKG+D DN+E++YKKVHAAIRADPSAKK+EKQPPKEHK
Sbjct  205  AYMRMLLEDEPEKYQSHFSEYIKKGVDPDNMEEMYKKVHAAIRADPSAKKTEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI RL ALN+AA
Sbjct  265  RYNLKKLTYEERKAKLIERLTALNSAA  291



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAGFSKDSKQLDA+VHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEKYQS FS YIK+G++AD+LE++YKKVHAAIRADPS KKSEKQPPK+HK
Sbjct  205  TYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKY+YGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYLYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+AD+LE LYKKVHAAIRADP+AKKSEK+PPKEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKSEKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RL+ LN+AAG
Sbjct  265  RFNLKKLTYEERKAKLIERLHTLNSAAG  292



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDA+VHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEKYQS FS YIK+G++AD+LE++YKKVHAAIRADPS KKSEKQPPK+HK
Sbjct  205  TYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKY+YGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYLYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+AD+LE LYKKVHAAIRADP+AKKSEK+PPKEHK
Sbjct  206  AYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKSEKEPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RL+ LN+AAG
Sbjct  266  RFNLKKLTYEERKAKLIERLHTLNSAAG  293



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGFSKDSKQLDA+VHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDADVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKYQS FS YIK+G++ADNLE++YKKVHAAIRA+PS KKSEKQPPK+HK
Sbjct  205  TYMKTLIEDEPEKYQSHFSEYIKRGLEADNLEEMYKKVHAAIRAEPSPKKSEKQPPKKHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKY S FS YIK+G++ADNLE++YKKVHAAIRA+PS KKSEKQPPK+HK
Sbjct  205  TYMKTLIEDEPEKYLSHFSGYIKRGLEADNLEEMYKKVHAAIRAEPSPKKSEKQPPKKHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   240 bits (613),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAGFSKDSKQLDA+VHR YIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVHRNYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKYQS FS YIKKG++AD LE++YKKVHAAIRADP+ KKS+KQPPK+HK
Sbjct  205  TYMKTLIEDEPEKYQSHFSEYIKKGLEADGLEEMYKKVHAAIRADPTFKKSDKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGG+DIPHSEKRFAG+SKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQ+ FS YIK G++ADNLE++YKKVHAAIRADPS KKS KQPPK HK
Sbjct  205  AYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPSPKKSGKQPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNAA G
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNAAGG  292



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAGF KDSKQLDA+VHRKYIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L+EDEPEKYQS FS YIK G++AD+LE++YKKVHAAIRADPS+KKS+KQPPK+HK
Sbjct  205  AYMKTLMEDEPEKYQSHFSEYIKTGLEADDLEEMYKKVHAAIRADPSSKKSDKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTY+ERKA LI RLNALNAAAG
Sbjct  265  RYNLKKLTYDERKARLIERLNALNAAAG  292



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAG++KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+GIDAD +E LYKKVHAAIRADP+AKKSEKQP KEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSEKQPSKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+AA
Sbjct  265  RYNLKKLTYEERKAKLVERLNALNSAA  291



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALD GLDIPHS+KRFAGFSKD+KQLDAEVH KYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHSKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADP+AKK+EK+PPK+HK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKTEKEPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RL+ LNAAAG
Sbjct  265  RFNLKKLTYEERKAKLIERLHTLNAAAG  292



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  150  LDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  209

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEK+ + FS Y+K+GIDADNLE+LYKKVHAAIRADP+ +KSEKQPPKEHK
Sbjct  210  AYMRTLAEDEPEKFLAHFSEYLKRGIDADNLEELYKKVHAAIRADPTGRKSEKQPPKEHK  269

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI RLNA N+AA
Sbjct  270  RYNLKKLTYEERKAKLIERLNAFNSAA  296



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS YIKKGI+ADN+E +YKKVHAAIRADP+AKK EKQPPKEHK
Sbjct  205  AYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVHAAIRADPTAKKIEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERK  LI RLNA N+AA
Sbjct  265  RYNLKKLTYEERKNKLIERLNAFNSAA  291



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF+KD+KQLD EVHRKYIYGGHVA
Sbjct  31   LDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVHRKYIYGGHVA  90

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQS FS YIK+GI+ADNLE +YKKVHAAIRA+P AKKSEK PPKEHK
Sbjct  91   SYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHK  150

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  151  RYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDA+VHR YIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVHRNYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEPEKYQS FS YIKKG++AD+LE++YKKVHAAIRADP+ KKS+K PPK+HK
Sbjct  205  TYMKTLIEDEPEKYQSHFSEYIKKGLEADHLEEMYKKVHAAIRADPTFKKSDKHPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNSAAG  292



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   239 bits (609),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF K+SKQLD EVHRKYIYGGHVA
Sbjct  175  LDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFDKESKQLDPEVHRKYIYGGHVA  234

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR LIEDEPE+YQS FS YIK+G++ADN+E+LYKKVHAAIRAD SAKKSEK+PPKEHK
Sbjct  235  AYMRTLIEDEPERYQSHFSEYIKRGLEADNIEELYKKVHAAIRADSSAKKSEKEPPKEHK  294

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEER+A LI RLNALN+AAG
Sbjct  295  RYNLKKLTYEERRAKLIERLNALNSAAG  322



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   238 bits (606),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD+KQLDAEVHRKYIYGGHV+
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDNKQLDAEVHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS FS YIKK I+ DN+E +YKKVHAAIRADP+ KKSEKQPPKEHK
Sbjct  205  AYMNTLMEDEPEKYQSHFSEYIKKSIEPDNIEAMYKKVHAAIRADPTEKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNAAAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNAAAG  292



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+GIDAD +E LYKKVHAAIRADP+ KKSEKQPPKEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYLKRGIDADCMEALYKKVHAAIRADPTTKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  265  RYNLKKLTYEERKEKLVERLNTFNSAA  291



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAE+HRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAELHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+GIDADN+E+LYKKVH+AIRADP  KK+EKQPPKEHK
Sbjct  205  AYMRILMEDEPEKYQSHFSEYVKRGIDADNMEELYKKVHSAIRADPITKKTEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERK  LI RL ALN+AA
Sbjct  265  RYNLKKLTYEERKNKLIERLKALNSAA  291



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGG+DIPHSEKRFAG+SKDSKQLDAEVHRK+IYGGHV 
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVHRKFIYGGHVT  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQ+ FS YIK G++ADNLE++YKKVHAAIRADP  KKS KQPPK HK
Sbjct  205  AYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPCPKKSGKQPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNAA G
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNAAGG  292



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF+KD+KQLD EVHRKYIYGGHVA
Sbjct  97   LDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVHRKYIYGGHVA  156

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQS FS YIK+GI+ADNLE +YKKVHAAIRA+P AKKSEK PPKEHK
Sbjct  157  SYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHK  216

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  217  RYNLKKLSYEERKAKLIDRLKALNSAAG  244



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGG+DIPHSEKRFAGF KDSKQLDA+VHRKYIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L+EDEPEKYQS F+ YIK G++AD+LE++YKKVHAAIRADPS+KK +KQPPK+HK
Sbjct  205  AYMKTLMEDEPEKYQSHFNEYIKTGLEADDLEEMYKKVHAAIRADPSSKKFDKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTY+ERKA LI RLNALNAAAG
Sbjct  265  RYNLKKLTYDERKARLIERLNALNAAAG  292



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQS FS YIK+GI+ADN+E+LYKKVHAAIRADP+ KKSEK+PPKEHK
Sbjct  205  SYMRALMEDEPEKYQSHFSEYIKRGIEADNIEELYKKVHAAIRADPTIKKSEKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK+ LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEEKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L EDEPEKYQS FS YI KGIDADN+E+LY+KVHAAIRADP+ KKSEKQPPKEHK
Sbjct  205  SYMRALNEDEPEKYQSHFSEYINKGIDADNIEELYRKVHAAIRADPTTKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEER++ LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIY GHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS F  YIK+GI+ADNLE+LYKKVHAAIRADP+ KKSEK+PP EHK
Sbjct  205  AYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKSEKKPPAEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYNLKKLTYEERKA L+ RL ALNAA
Sbjct  265  RYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAE HRKYIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEAHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQ+ FS Y+K+GIDAD LE LYKKVHAAIRADP+AK+SEK+ PK HK
Sbjct  205  GYMKTLMEDEPEKYQTHFSEYVKRGIDADGLEALYKKVHAAIRADPTAKQSEKEAPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTY+ERKASLI RLNALNAAAG
Sbjct  265  RYNLKKLTYDERKASLIERLNALNAAAG  292



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL+EDEPEKYQS FS YIK+GI+ DN+E+LYKKVHAAIRADP+AKKSEKQ PKEHK
Sbjct  205  AYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKKSEKQLPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA L+ RL ALN+
Sbjct  265  RYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL+EDEPEKYQS FS YIK+GI+ DN+E+LYKKVHAAIRADP+AKKSEKQ PKEHK
Sbjct  205  AYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKKSEKQLPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA L+ RL ALN+
Sbjct  265  RYNLKKLTYEERKAKLVERLKALNS  289



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLD +VHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIK+G++AD+LE LYKKVHAAIRADP  KKSEK+PPKEHK
Sbjct  205  AYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKKSEKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NL+KLTYEERKA L+ RLNALN+A G
Sbjct  265  RFNLRKLTYEERKAKLVERLNALNSAGG  292



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIY GHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS F  YIK+GI+ADNLE+LYKKVHAAIRADP+ KKSEK+PP EHK
Sbjct  205  AYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKSEKKPPAEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYNLKKLTYEERKA L+ RL ALNAA
Sbjct  265  RYNLKKLTYEERKARLVERLKALNAA  290



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGN VFGALKGALD GLDIPHS+KRFAGFSKD KQLDAEVHR YIYGGHVA
Sbjct  145  LDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHRNYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADPSAKKSEK PPK+H 
Sbjct  205  AYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKSEKAPPKQHM  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RL+ LNAAAG
Sbjct  265  RFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIY GHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS F  YIK+GI+ADNLE+LYKKVHAAIRADP+ KKSEK+PP EHK
Sbjct  205  AYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKSEKKPPAEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYNLKKLTYEERKA L+ RL ALNAA
Sbjct  265  RYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  162  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVA  221

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM NL+EDEPEKYQS FS Y+KKG++ADNLE+LYKKVHAAIRADP+AKKSEKQPPKEHK
Sbjct  222  SYMTNLMEDEPEKYQSHFSKYVKKGLEADNLEELYKKVHAAIRADPTAKKSEKQPPKEHK  281

Query  328  RYNLKKLTYEERKASLISR  272
            RYNLKKLTYEERKA LI R
Sbjct  282  RYNLKKLTYEERKAKLIER  300



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ  FS YIK+GI+ D++E+LYKKVHAAIRADP+AKKSEKQPPKEHK
Sbjct  205  AYMRMLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNL+K+TYEERKA LI RL ALN+
Sbjct  265  RYNLRKMTYEERKAKLIERLQALNS  289



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF+KD+KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQS FS YIK+GI+ADNLE +YKKVHAAIRA+P AKKSEK PPKEHK
Sbjct  205  SYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  265  RYNLKKLSYEERKAKLIDRLKALNSAAG  292



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHSEKRFAGF+KD+KQLD EVHRKYIYGGHVA
Sbjct  142  LDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVHRKYIYGGHVA  201

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQS FS YIK+GI+ADNLE +YKKVHAAIRA+P AKKSEK PPKEHK
Sbjct  202  SYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHK  261

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  262  RYNLKKLSYEERKAKLIDRLKALNSAAG  289



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K++KQLD EVHRKYI+GGHVA
Sbjct  199  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKETKQLDPEVHRKYIFGGHVA  258

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPE+YQS FS Y K+G++ADNLE+LYKKVHAAIRADP+ KKSEK PPKEHK
Sbjct  259  AYMRTLAEDEPERYQSHFSEYHKRGLEADNLEELYKKVHAAIRADPTPKKSEKAPPKEHK  318

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKASLI RLNALN+AAG
Sbjct  319  RYNLKKLTYEERKASLIERLNALNSAAG  346



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKD KQLD+EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDSEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS FS YIK G++AD++E LYKKVHAAIRADPS KKSEKQPPKEHK
Sbjct  205  AYMNTLMEDEPEKYQSHFSKYIKSGVEADDIEALYKKVHAAIRADPSPKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA LI RL ALN+
Sbjct  265  RYNLKKLTYEERKAKLIERLQALNS  289



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLD +VHRKYIYGGHVA
Sbjct  226  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVA  285

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIK+G++AD+LE LYKKVHAAIRADP  KKSEK+PPKEHK
Sbjct  286  AYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKKSEKEPPKEHK  345

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NL+KLTYEERKA L+ RLNALN+A G
Sbjct  346  RFNLRKLTYEERKAKLVERLNALNSAGG  373



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGN VFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ  FS YIK+GI+ D++E+LYKKVHAAIRADP+AKKSEKQPPKEHK
Sbjct  205  AYMRTLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNL+K+TYEERKA LI RL ALN+
Sbjct  265  RYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS F+ YIKKGIDAD LE LYKKVHAAIRADP+ KKSEK  PKEHK
Sbjct  205  AYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKKSEKPAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  265  RYNLKKLTYEERKAKLVERLNALNSAV  291



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS F+ YIKKGIDAD LE LYKKVHAAIRADP+ KKSEK  PKEHK
Sbjct  205  AYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKKSEKPAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  265  RYNLKKLTYEERKAKLVERLNALNSAV  291



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV+
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM +L+EDEPEKYQS FS YIKKGI+ D+ E LYKKVHAAIRADP+ KKS+K  PKEHK
Sbjct  205  AYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKKSDKPVPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERK  LI RLNALN+AAG
Sbjct  265  RFNLKKLTYEERKQKLIERLNALNSAAG  292



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAEVHRKYI+GGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ L+EDEPEKYQ+ FS YIKKGID D++E++YKKVHAAIRADP A KS K PPKEHK
Sbjct  205  SYMKTLMEDEPEKYQAHFSEYIKKGIDPDDMEEMYKKVHAAIRADPIAVKSTKPPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNA+AG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNASAG  292



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA++HRKYIYGGHVA
Sbjct  73   LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKYIYGGHVA  132

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMRNL E+EPEKYQS FS YIKKGI+AD++E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  133  DYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTKQPPKEHK  192

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  193  RYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAE HRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L+EDEPEKYQ+ FS Y+K+GI+AD LE LYKKVHAAIRADPS KKSEK  P++HK
Sbjct  205  GYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKKSEKPQPQKHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTY+ERKASLI RLNALNAAAG
Sbjct  265  RYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAE HRKYIYGGHVA
Sbjct  147  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETHRKYIYGGHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L+EDEPEKYQ+ FS Y+K+GI+AD LE LYKKVHAAIRADPS KKSEK  P++HK
Sbjct  207  GYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKKSEKPQPQKHK  266

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTY+ERKASLI RLNALNAAAG
Sbjct  267  RYNAKKLTYDERKASLIERLNALNAAAG  294



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL+EDEPEKYQS FS YIK+GI+ DN+E+LYKKVHAAIR DP+AKKS KQ PKEHK
Sbjct  205  AYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIREDPTAKKSGKQLPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA L+ RL ALN+
Sbjct  265  RYNLKKLTYEERKAKLVERLKALNS  289



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L+EDEPEKYQ+ FS YIK+GI+AD +E+LYKKVHAAIRADPS KK EKQPPKEHK
Sbjct  205  AYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKKPEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  L+SRL ALN+AAG
Sbjct  265  RYNLKKLTYEERKTKLVSRLQALNSAAG  292



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV+
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQ+ FS YIKKGI+AD LE+LYKKVHAAIRADP+ KKSEKQPPK+HK
Sbjct  205  AYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+SRL ALNAA 
Sbjct  265  RYNLKKLTYEERKAKLVSRLAALNAAV  291



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV+
Sbjct  209  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVS  268

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM +L+EDEPEKYQS FS YIKKGI+ D+ E LYKKVHAAIRADP+ KKS+K  PKEHK
Sbjct  269  AYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKKSDKPVPKEHK  328

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERK  LI RLNALN+AAG
Sbjct  329  RFNLKKLTYEERKQKLIERLNALNSAAG  356



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHV+
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  LIEDEPEKYQS FS YIKKG++ D++E++YKKVHAAIRA+P  KK EKQPPKEHK
Sbjct  205  AYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKVEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA LI RLNALN+
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNS  289



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAG++KD+KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM  L+EDEP+KYQS FS Y+KKG++ADN+E++YKKVHAAIRADP+ KKS+KQ PK+HK
Sbjct  205  SYMNTLMEDEPDKYQSHFSKYVKKGVEADNIEEMYKKVHAAIRADPTPKKSDKQQPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNAAAG
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNAAAG  292



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFTKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L+EDEPEKYQ+ FS Y+K+GI+ DNLE LYKKVHAAIRADP+ KK EKQPPKEHK
Sbjct  205  AYMKTLMEDEPEKYQTHFSEYVKRGIEPDNLEALYKKVHAAIRADPTLKKIEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNL+KLTYEERKA LI RL ALN+
Sbjct  265  RYNLRKLTYEERKAKLIERLQALNS  289



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHVA
Sbjct  176  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVA  235

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L+EDEPEKYQ+ FS YIK+GI+AD +E+LYKKVHAAIRADPS KK EKQPPKEHK
Sbjct  236  AYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKKPEKQPPKEHK  295

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  L+SRL ALN+AAG
Sbjct  296  RYNLKKLTYEERKTKLVSRLQALNSAAG  323



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAEVHRKYIYGGHVA
Sbjct  232  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVA  291

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS F+ YIKKGIDAD LE LYKKVHAAIRADP+ KKSEK  PKEHK
Sbjct  292  AYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTTKKSEKPAPKEHK  351

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  352  RYNLKKLTYEERKAKLVERLNALNSAV  378



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMRNL E+EPEKYQS FS YIKKGI+AD++E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  206  DYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTKQPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  266  RYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+SKQLD EVHRKYIYGGH+A
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDPEVHRKYIYGGHIA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADPS KKSEKQPPKEHK
Sbjct  205  DYMRLLNEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPSVKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+N KKLTYEERKA LI RL ALN+A G
Sbjct  265  RFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMRNL E+EPEKYQS FS YIKKGI+AD++E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  206  DYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKSTKQPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  266  RYNPKKLTYEQRKASLIERLNQLNSSGG  293



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHV+
Sbjct  177  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVS  236

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  LIEDEPEKYQS FS YIKKG++ D++E++YKKVHAAIRA+P  KK EKQPPKEHK
Sbjct  237  AYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKVEKQPPKEHK  296

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERKA LI RLNALN+
Sbjct  297  RYNLKKLTYEERKAKLIERLNALNS  321



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEKYQ+ FS YIKKGI+ADN+E+LYKKVHAAIRADP+AKK+EKQPPKEHK
Sbjct  205  AYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTAKKTEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNAL  260
            RYNLKKLT++ERK  L+ RL A 
Sbjct  265  RYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV 
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVT  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQ+ FS YIK+G++AD +E+LYKKVHAAIRADP+ KKS KQPPKEHK
Sbjct  205  AYMKTLIEDEPEKYQTHFSEYIKRGVEADGIEELYKKVHAAIRADPTIKKSGKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI+RL ALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIARLQALNSAAG  292



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFAGF+KD KQLD EVHRKYIYGGHVA
Sbjct  142  LDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVHRKYIYGGHVA  201

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL+EDEPEKYQS FS YIK+ I+ D +E +YKKVHAAIRA P AKKSEK PPKEHK
Sbjct  202  AYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKKSEKAPPKEHK  261

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  262  RYNLKKLSYEERKAKLIDRLKALNSAAG  289



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+SKQLDAEVHRKYIYG HVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEVHRKYIYGVHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR ++EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADP+ KKSEKQPPKEHK
Sbjct  205  DYMRVMMEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPTIKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+N KKLTYEERKA LI RL ALN+A G
Sbjct  265  RFNAKKLTYEERKARLIERLKALNSAGG  292



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGG+DIPHS+KRFAGF+KD KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL+EDEPEKYQS FS YIK+ I+ D +E +YKKVHAAIRA P AKKSEK PPKEHK
Sbjct  205  AYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKKSEKAPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  265  RYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+KQLDAEVHRKYIYGGHVA
Sbjct  140  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRKYIYGGHVA  199

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+ IDAD +E LYKKVHAAIRADP+ KKSEK+P KEHK
Sbjct  200  AYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHK  259

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  260  RYNLKKLTYEERKEKLVERLNTFNSAA  286



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L ++EPEK+QS FS YIKKGI AD++E LYKKVHAAIRADPS  KS K+PPK HK
Sbjct  205  DYMRSLADEEPEKFQSHFSEYIKKGISADDMEALYKKVHAAIRADPSMAKSTKEPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTY+ERKASL+ RLNALNA+AG
Sbjct  265  RYNLKKLTYDERKASLVQRLNALNASAG  292



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+ IDAD +E LYKKVHAAIRADP+ KKSEK+P KEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERK  L+ RLN  N+AA
Sbjct  265  RYNLKKLTYEERKEKLVERLNTFNSAA  291



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH KYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHHKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS Y+KKGI+ADN+E++YKKVHAAIRADP+ KKS K  P EHK
Sbjct  205  AYMRTLMEDEPEKYQTHFSEYLKKGIEADNIEEVYKKVHAAIRADPTMKKSSKPQPSEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERK  LI RLNA N+AA
Sbjct  265  RWNLKKLTYEERKNKLIERLNAFNSAA  291



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA+ HR+YIYGGHVA
Sbjct  73   LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRYIYGGHVA  132

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+NL E+EPEKYQS FSAYIKKG++AD +E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  133  DYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTKQPPKEHK  192

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  193  RYNPKKLTYEQRKASLIERLNQLNSSGG  220



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TT GNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV+
Sbjct  145  LDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQ+ FS YIKKGI+AD LE+LYKKVHAAIRADP+ KKSEKQPPK+HK
Sbjct  205  AYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKKSEKQPPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+SRL ALNAA 
Sbjct  265  RYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   228 bits (580),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM  L+EDEPEKYQS F  Y+KKG++ DNLE+LYKKVHAAIRADP+AKKSEKQPPKEHK
Sbjct  205  SYMTTLMEDEPEKYQSHFGLYVKKGLEPDNLEELYKKVHAAIRADPTAKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISR  272
            RYNLKKLTYEERKA LI R
Sbjct  265  RYNLKKLTYEERKAKLIER  283



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGFSKD KQLDAEVHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFSKDDKQLDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQ+ FS YIK+GI+ D++E LYKKVHAAIRADP+  KS K+PPKEHK
Sbjct  205  SYMRMLMEDEPEKYQTHFSEYIKRGIEPDDMEGLYKKVHAAIRADPTMVKSAKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNL+KLTYEERKA LI RLNALNA A
Sbjct  265  RYNLRKLTYEERKAKLIDRLNALNARA  291



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD+KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS Y+K+ IDAD +E LYKKVHAAIRADP+ KKSEK+P KEHK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            +YNLKKLTYEERK  L+ RLN  N+AA
Sbjct  265  KYNLKKLTYEERKEKLVERLNTFNSAA  291



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LDA++HRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDADIHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ LIEDEPEKYQ+ FS YIK+GI+ DNLE++YKKVHAAIRADP+ KKSEK+PPKEHK
Sbjct  205  SYMKTLIEDEPEKYQTHFSDYIKRGIEPDNLEEVYKKVHAAIRADPTFKKSEKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L++RL ALN+AA
Sbjct  265  RYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF KD KQLDAEVHR YI GGHVA
Sbjct  147  LDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVHRNYILGGHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR ++EDEPEKYQ+ FS YIK+GI+ D++E++YKKVHAAIRADP A KS K+PPKEHK
Sbjct  207  SYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIKSTKEPPKEHK  266

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RLNALNA+AG
Sbjct  267  RFNLKKLTYEERKARLIERLNALNASAG  294



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVF ALKGA DGGLDIPHS+KRFAGF KD KQLDAEVHR YI GGHVA
Sbjct  145  LDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVHRNYILGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR ++EDEPEKYQ+ FS YIK+GI+ D++E++YKKVHAAIRADP A KS K+PPKEHK
Sbjct  205  SYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIKSTKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RLNALNA+AG
Sbjct  265  RFNLKKLTYEERKARLIERLNALNASAG  292



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADPS KKSEKQPPKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKKSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  265  RYNLKKLTYEERKAKLIARVAAINSAA  291



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA+ HR+YIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+NL E+EPEKYQS FSAYIKKG++AD +E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  206  DYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTKQPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  266  RYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF+KDSKQLD EVHRKYIYGGHVA
Sbjct  147  LDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVHRKYIYGGHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+ I+ DN+E LYKKVHAAIRAD  AKKSE++PP EHK
Sbjct  207  AYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKKSEREPPMEHK  266

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+Y+ERKA LI RL  LN+AAG
Sbjct  267  RYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF  D KQLDAEVHR YI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKNDEKQLDAEVHRNYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEP+KYQ+ FS YIKKGI+ D++E++YKKVHAAIRADPSA KS K+PP EHK
Sbjct  205  SYMRALMEDEPDKYQTHFSEYIKKGIEPDDIEEMYKKVHAAIRADPSAIKSTKEPPTEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALNA+ G
Sbjct  265  RYNLKKLTYEERKAKLIERLNALNASGG  292



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAE+HRKYIYGGHVA
Sbjct  142  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKYIYGGHVA  201

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM++L ++EPEKYQS FS YIKKGI+ADN+E LYKKVHAAIRADP+  KS K+PPK HK
Sbjct  202  DYMKSLADEEPEKYQSHFSEYIKKGIEADNMEALYKKVHAAIRADPTMAKSTKEPPKTHK  261

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN++AG
Sbjct  262  RYNPKKLTYEQRKASLVERLNALNSSAG  289



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEKYQ+ FS YIKKGI+ADN+E+LYKKVHAAIRADP+ KK+EKQPP EHK
Sbjct  205  AYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTPKKTEKQPPTEHK  264

Query  328  RYNLKKLTYEERKASLISRLNAL  260
            RYNLKKLT++ERK  L+ RL A 
Sbjct  265  RYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LD ++HRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ LIEDEPEKYQ+ FS YIK+GI+AD LE LYKKVHAAIRADP+ KKSEK+ PKEHK
Sbjct  205  SYMKTLIEDEPEKYQTHFSEYIKRGIEADCLEDLYKKVHAAIRADPTFKKSEKETPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA L++RL ALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF+KDSKQLD EVHRKYIYGGHVA
Sbjct  201  LDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVHRKYIYGGHVA  260

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+ I+ DN+E LYKKVHAAIRAD  AKKSE++PP EHK
Sbjct  261  AYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKKSEREPPMEHK  320

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+Y+ERKA LI RL  LN+AAG
Sbjct  321  RYNLKKLSYDERKARLIDRLKVLNSAAG  348



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  186  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  245

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADPS KKSEKQPPKEHK
Sbjct  246  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKKSEKQPPKEHK  305

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  306  RYNLKKLTYEERKAKLIARVAAINSAA  332



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV 
Sbjct  125  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVT  184

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQ+ FS YIKKGI+AD +E+LYKKVHAAIRADP+ KK+EKQPPKEHK
Sbjct  185  AYMKTLIEDEPEKYQTHFSQYIKKGIEADGIEELYKKVHAAIRADPANKKAEKQPPKEHK  244

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTY+ER+  LI+RL ALN+A 
Sbjct  245  RYNLKKLTYDERRTKLIARLEALNSAV  271



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L E+EPEKYQS FS YIKKGI+A  +E LYKKVHAAIRADP+  KS K+PPK HK
Sbjct  205  DYMKTLAEEEPEKYQSHFSEYIKKGIEAGGMEALYKKVHAAIRADPTLAKSTKEPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  265  RYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA+ HR+YIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHRRYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+NL E+EPEKYQS FSAYIKKG++A+ +E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  206  DYMKNLAEEEPEKYQSHFSAYIKKGVEAEEIEALYKKVHAAIRADPSVVKSTKQPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  266  RYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV+
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQ+ FS YIKKGI+AD LE+LYKKVHAAIRADPS KKSEK P KEHK
Sbjct  205  AYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPSIKKSEKPPRKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERKA LI+RL ALNAA 
Sbjct  265  RFNLKKLTYEERKAKLIARLQALNAAV  291



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADP+ KKS+KQPPKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKKSDKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI+R+ +LN+AA
Sbjct  265  RYNLKKLTYEERKAKLIARVASLNSAA  291



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMRNL EDEPEKYQS FS YIKKGI+ADN+E+LYKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMRNLAEDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNAL  260
            RYNLKKLT++ERK  L+ RL A 
Sbjct  265  RYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG++K+S+QLD EVHRKYI+GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYTKNSQQLDVEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIKKGI+AD+LE LYKKVHAAIRA+P+ KKS+K  PK HK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYIKKGIEADDLEGLYKKVHAAIRANPTVKKSDKPQPKAHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTY+ERKA L+ RLNALN+AA
Sbjct  265  RYNLKKLTYDERKARLVERLNALNSAA  291



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQS FS YIK+GI+AD LE+LYKKVHAAIRADP++KKSEK  PKEHK
Sbjct  205  AYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPTSKKSEKPQPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTY+ERK  LI+RL ALN+AA
Sbjct  265  RYNLKKLTYDERKNKLIARLQALNSAA  291



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF+KD KQLDAEVHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQ+ FS YI++GI+ D+LE+LYKKVHAAIRAD +  KS ++PPKEHK
Sbjct  205  SYMRILMEDEPEKYQTHFSEYIQRGIEPDDLEELYKKVHAAIRADATMAKSTREPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI RLNALNA+ 
Sbjct  265  RYNLKKLTYEERKARLIERLNALNAST  291



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   223 bits (568),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L +DEPEKYQS FS YIKKGI+ADN+E+LYKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMTTLADDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLT++ERK  L+ RL A N A 
Sbjct  265  RYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ KQLD EVH KYIYGGHVA
Sbjct  146  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHHKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM  L+EDEPEKYQS F  YIKKGI+ DN+E LY+KVHAAIRADP+  KSEKQPPKEHK
Sbjct  206  SYMMTLMEDEPEKYQSHFGEYIKKGIEPDNIEALYRKVHAAIRADPTM-KSEKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK+ LI RLNALN+AAG
Sbjct  265  RYNLKKLTYEERKSKLIERLNALNSAAG  292



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAEVHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQ+ F  YIK+GI+ D++E+LYKKVHAAIRADP+  KS K+PPKEHK
Sbjct  205  SYMRMLMEDEPEKYQTHFIEYIKRGIEPDDMEELYKKVHAAIRADPTLVKSSKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTY+ERKA LI RLNALN++A
Sbjct  265  RFNLKKLTYDERKARLIERLNALNSSA  291



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LD ++HRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ LIEDEPEKYQ+ FS YIK+GI+AD LE LYKKVHAAIRADP+ KK EK+ PKEHK
Sbjct  205  SYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEDLYKKVHAAIRADPTFKKFEKETPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA L++RL ALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLVARLQALNSAAG  292



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADP+ +KS+KQPPKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRKSDKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYN+KKLTYEERKA LI+R+ A+N+AA
Sbjct  265  RYNMKKLTYEERKAKLIARVAAINSAA  291



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 131/148 (89%), Gaps = 3/148 (2%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGN VFGALKGALD GLDIPHS+KRFAGFSKD KQLDAEVHR YIYGGHVA
Sbjct  145  LDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHRNYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADPSAKKSEK PPK+H 
Sbjct  205  AYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKSEKAPPKQHM  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R    KLTYEERKA LI RL+ LNAAAG
Sbjct  265  RL---KLTYEERKAKLIDRLHTLNAAAG  289



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGFSK + +L+A+VHRKYI+GGHVA
Sbjct  90   LDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRKYIFGGHVA  149

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E+L KKVH+AIRA+P  K +EKQPPK HK
Sbjct  150  AYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTTEKQPPKTHK  209

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  210  RYNLKKLTYEQRKAKLVERLNALNSAAG  237



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L +DEPEK+QS FS YIKKGI+ADN+E+LYKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMTTLADDEPEKFQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLT++ERK  L+ RL A N A 
Sbjct  265  RYNLKKLTFDERKKKLVERLKAFNEAG  291



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L ++EPEKYQS FS YIKKGI AD++E +YKKVHAAIRADP+  KS K+ PK HK
Sbjct  205  DYMRSLADEEPEKYQSHFSEYIKKGISADDIESVYKKVHAAIRADPTLVKSTKEAPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  265  RYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKD KQLDAE+HRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIKKGI+AD++E++YKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLT++ERK  L+ RL A N A 
Sbjct  265  RYNLKKLTFDERKKKLVERLKAFNDAG  291



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAE+HRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM++L ++EPEKYQS FS YIKKGI+ D++E LYKKVHAAIRADP+  KS K+PPK HK
Sbjct  205  DYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAKSTKEPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN++AG
Sbjct  265  RYNPKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADP+ +KS+KQPPKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRKSDKQPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYN+KKLTYEERKA L++R+ A+N+AA
Sbjct  265  RYNMKKLTYEERKAKLVARVAAINSAA  291



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KD KQLD EVHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR ++EDEPEKYQ+ FS YIKKGI+ DN+E++YKK HAAIRADP+  KS K+ PKEH+
Sbjct  205  SYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIKSTKETPKEHQ  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RLNALN +AG
Sbjct  265  RFNLKKLTYEERKARLIERLNALNESAG  292



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLDIPHS+KRFAGF KD KQLD EVHRKYI+GGHVA
Sbjct  147  LDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVHRKYIFGGHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR ++EDEPEKYQ+ FS YIKKGI+ DN+E++YKK HAAIRADP+  KS K+ PKEH+
Sbjct  207  SYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIKSTKETPKEHQ  266

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTYEERKA LI RLNALN +AG
Sbjct  267  RFNLKKLTYEERKARLIERLNALNESAG  294



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYK VHAAIRADP+ KKS+KQ PKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKKSDKQTPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LISR+ ALN+AA
Sbjct  265  RYNLKKLTYEERKAKLISRVAALNSAA  291



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAE+HRKYIYGGHVA
Sbjct  113  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKYIYGGHVA  172

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM++L ++EPEKYQS FS YIKKGI+ D++E LYKKVHAAIRADP+  KS K+PPK HK
Sbjct  173  DYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAKSTKEPPKTHK  232

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKA+L+ RLNALN++AG
Sbjct  233  RYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGFSK + +L+A+VHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E+L KKVH+AIRA+P AK +EKQPPK HK
Sbjct  205  AYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLAKTTEKQPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  265  RYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG++K+ +QLD EVHRKYI+GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKNGQQLDVEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIKKGI+AD LE LYKKVHAAIRA+P AKKS+K  PK HK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYIKKGIEADELEGLYKKVHAAIRANPIAKKSDKPQPKAHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTY+ERKA L+ RLNALN+AA
Sbjct  265  RYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPH EKRFAGF KD KQLDAE+HRKYIYGGHVA
Sbjct  146  LDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFKKDEKQLDAEIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L E+EPEK+Q+ FS YIK+GI+AD++E LYKKVHAAIRA+P+  KS K+PPK HK
Sbjct  206  DYMRSLAEEEPEKFQAHFSDYIKRGIEADDMEALYKKVHAAIRANPTMVKSTKEPPKTHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE RKASL+ RLNALN++AG
Sbjct  266  RYNLKKLTYEGRKASLVQRLNALNSSAG  293



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKD KQLDAE+HRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIKKGI+AD++E++YKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLT++ERK  L+ RL A N
Sbjct  265  RYNLKKLTFDERKKKLVDRLKAFN  288



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADP+ +KS+K+PPKEHK
Sbjct  205  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRKSDKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYN+KKLTYEERKA LI+R+ A+N+AA
Sbjct  265  RYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEKYQS FS YIKK I+ADN+E+LYKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMXTLAEDEPEKYQSHFSEYIKKCIEADNIEELYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLT++ERK  L+ RL A N A 
Sbjct  265  RYNLKKLTFDERKMKLVERLKAFNDAG  291



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEKYQS FS YIKK I+ADN+E+LYKKVHAAIRADP+ KK+EK  P+EHK
Sbjct  205  AYMXTLAEDEPEKYQSHFSEYIKKXIEADNIEELYKKVHAAIRADPTIKKTEKPAPQEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLT++ERK  L+ RL A N A 
Sbjct  265  RYNLKKLTFDERKMKLVERLKAFNDAG  291



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  163  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  222

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYK VHAAIRADP+ KKS+KQ PKEHK
Sbjct  223  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKKSDKQTPKEHK  282

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LISR+ ALN+AA
Sbjct  283  RYNLKKLTYEERKAKLISRVAALNSAA  309



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGHVA
Sbjct  148  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHVA  207

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADP+ KKS+KQ PKEHK
Sbjct  208  AYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKKSDKQLPKEHK  267

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI+R+ +LN+AA
Sbjct  268  RYNLKKLTYEERKAKLIARVASLNSAA  294



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHS KRFAGFSK + +L+A+VHRKYI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS YIKKGI+ DN+E+L KKVH+AIRA+P  K +EKQPPK HK
Sbjct  205  AYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTTEKQPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKA L+ RLNALN+AAG
Sbjct  265  RYNLKKLTYEQRKAKLVERLNALNSAAG  292



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDAE+HRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM++L ++EPEKYQS FS YIKKGI+AD +E LYKKVHAAIRADP+  KS K+PPK HK
Sbjct  205  DYMKSLADEEPEKYQSHFSEYIKKGIEADGMEALYKKVHAAIRADPTIAKSTKEPPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            +YN KKLTYE+RKASL+ RLNALN++ G
Sbjct  265  KYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGG+D+PHSEKRFAGFSKDSK LDAE HRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFAGFSKDSKSLDAETHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  LIEDEPEKYQ+ FS YIKKGI+A+ +E+LYKKVHAAIRADP  KK+ K  PK+HK
Sbjct  205  AYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYKKVHAAIRADPLEKKTAKPEPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERK  LI RLNA N+AA
Sbjct  265  RFNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNR+FGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE HR YI+GGHV 
Sbjct  145  LDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFAGFNKETKQLDAETHRNYIFGGHVG  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ ++EDEPEKYQS FS Y KKGI+ADNLE LYKKVHAAIRADP+ KKS+K  P EHK
Sbjct  205  SYMKLMMEDEPEKYQSHFSEYAKKGIEADNLEALYKKVHAAIRADPTLKKSDKPAPTEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RL ALN+ AG
Sbjct  265  RYNLKKLTYEERKARLIERLKALNSGAG  292



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF+K++KQLD E HR YI+GGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKENKQLDPETHRNYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEKYQ+ FS Y+KKGI+ADNLE +YKKVHAAIRADP+ KKSEK  P EHK
Sbjct  205  NYMKVLTEDEPEKYQTHFSGYVKKGIEADNLEAMYKKVHAAIRADPTLKKSEKSAPTEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI RL ALN+ AG
Sbjct  265  RYNLKKLTYEERKERLIERLKALNSGAG  292



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKYIYGGHVA
Sbjct  146  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDAEIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L E+EPEKYQ+ FS YIKKGI+AD++E LYKKVHAAIR +P+  K  KQPPKEHK
Sbjct  206  DYMRTLAEEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRGEPTMAKITKQPPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN++ G
Sbjct  266  RYNPKKLTYEQRKASLVERLNALNSSGG  293



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LD ++HRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ L+EDEPEKYQ+ FS YIK+G++AD LE LYKKVHAAIRADP+ KKS K+ PKEHK
Sbjct  205  SYMKTLMEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKKSSKEAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L++RL ALN+AA
Sbjct  265  RYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFG LKGALDGGLD+PHS+KRFAGF KD KQLDA+ HR YI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFAGFKKDEKQLDADFHRNYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQ+ FS YIK+ +  D++E LYKKVHAAIRADPS  KS K+PPKEHK
Sbjct  205  SYMRTLMEDEPEKYQTHFSDYIKRNVGPDDMEDLYKKVHAAIRADPSTVKSTKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI RLNALN+A  
Sbjct  265  RYNLKKLTYEERKAKLIDRLNALNSATA  292



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKVHAAIRADP+  KS K+ P  HK
Sbjct  206  DYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKSTKKEPATHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  266  RYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K+LD ++HRKY++GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIHRKYVFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ LIEDEPEKYQ+ FS YIK+G++AD LE LYKKVHAAIRADP+ KKS K+ PKEHK
Sbjct  205  SYMKTLIEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKKSSKEAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L++RL A N+AA
Sbjct  265  RYNLKKLTYEERKAKLVARLQAFNSAA  291



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKVHAAIRADP+  KS K+ P  HK
Sbjct  206  DYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKSTKKEPATHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  266  RYNLKKLTYEQRKASLVERLNALNSSAG  293



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKVHAAIRADP+  KS K+ P  HK
Sbjct  206  DYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTKKEPATHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  266  RYNLKKLTYEQRKASLVERLNALNSSAG  293



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+++HRKYIYGGHVA
Sbjct  143  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA  202

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKVHAAIRADP+  KS K+ P  HK
Sbjct  203  DYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTKKEPATHK  262

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  263  RYNLKKLTYEQRKASLVERLNALNSSAG  290



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLD+++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKVHAAIRADP+  KS K+ P  HK
Sbjct  206  DYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKSTKKEPATHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct  266  RYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDA++HRKYIYG HVA
Sbjct  147  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIHRKYIYGLHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+NL ++EPEKYQ+ FS YIKKGI+AD++E LYKKVHAAIRADPS  KS K PPKEHK
Sbjct  207  EYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAKSTKTPPKEHK  266

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYN KKLTYE+RKASL+ RLNALN++ 
Sbjct  267  RYNPKKLTYEQRKASLVERLNALNSSG  293



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDA++HRKYI+GGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHRKYIFGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEKYQ+ FS Y+K+GIDAD +E LYKKVHAAIRADP+  KS K+PP  HK
Sbjct  206  DYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKSTKKPPTTHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKA L+ RLNALN++AG
Sbjct  266  RYNLKKLTYEQRKARLVERLNALNSSAG  293



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+ K+LDAEVHRKYI+GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ L EDEPEKYQS FS YIK+GI+AD LE+LYKKVHAAIRADPS KKS K  PKEHK
Sbjct  205  SYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKKSGKPEPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTY+ERK  LI+RL ALN+
Sbjct  265  RYNLKKLTYDERKNELIARLQALNS  289



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDA++HRKYI+GGHVA
Sbjct  149  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHRKYIFGGHVA  208

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR++ E+EPEKYQ+ FS Y+K+GIDAD +E LYKKVHAAIRADP+  KS K+PP  HK
Sbjct  209  DYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKSTKKPPTTHK  268

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYE+RKA L+ RLNALN++AG
Sbjct  269  RYNLKKLTYEQRKARLVERLNALNSSAG  296



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAGFSKD+KQLD++VHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEK+Q+ FSAYIKKG++A+ +E++YKKVHAAIRADP+ K +EK+  KEHK
Sbjct  205  AYMGILSEDEPEKFQTHFSAYIKKGVEAEGIEEMYKKVHAAIRADPTVKLTEKKEVKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTY+ERK  LI RLNA N+AAG
Sbjct  265  RFNLKKLTYDERKEKLIERLNAFNSAAG  292



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGF K+ K+LDAEVHRKYI+GGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM+ L EDEPEKYQS FS YIK+GI+AD LE+LYKKVHAAIRADPS KKS K  PKEHK
Sbjct  205  SYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKKSGKPEPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTY+ERK  LI+RL ALN+
Sbjct  265  RYNLKKLTYDERKNKLIARLQALNS  289



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGFSKDSKQLDAEVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+
Sbjct  133  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMRILMEDEPEKYQSHFSEYIKRGIE  192

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            ADN+E LYKKVHAAIRADPSAKKSEK PPK+HKR+NLKKLTYEERKA LI RL+ LNAAA
Sbjct  193  ADNIESLYKKVHAAIRADPSAKKSEKAPPKQHKRFNLKKLTYEERKAKLIDRLHTLNAAA  252

Query  247  G  245
            G
Sbjct  253  G  253



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAGFSKD+KQLD++VHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEK+Q+ FS YIKKG++A+ +E++YKKVHAAIRADP+ K +EK+  KEHK
Sbjct  205  AYMGILSEDEPEKFQTHFSGYIKKGVEAEGIEEMYKKVHAAIRADPTVKLTEKKEVKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            R+NLKKLTY+ERK  LI RLNA N+AAG
Sbjct  265  RFNLKKLTYDERKEKLIERLNAFNSAAG  292



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+SKQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+N+E+LYKKVHAAIRADP+ KK+ K  PKEHK
Sbjct  205  NYMKLLTEDEPEKFQTHFSQYVKKGVDAENIEELYKKVHAAIRADPNPKKTVKAAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKYI+GGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKYIFGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L ++EPEKYQ+ FS YIK+GI AD++E +YKKVHAAIRADP+  KS K PPK HK
Sbjct  206  DYMRSLADEEPEKYQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTKAPPKTHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  266  RYNPKKLTYEQRKASLVERLNALNNSAG  293



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKYI+GGHVA
Sbjct  142  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKYIFGGHVA  201

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L ++EPEK+Q+ FS YIK+GI AD++E +YKKVHAAIRADP+  KS K PPK HK
Sbjct  202  DYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTKAPPKTHK  261

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  262  RYNPKKLTYEQRKASLVERLNALNNSAG  289



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD K LDAE+HRKYI+GGHVA
Sbjct  142  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHRKYIFGGHVA  201

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR+L ++EPEK+Q+ FS YIK+GI AD++E +YKKVHAAIRADP+  KS K PPK HK
Sbjct  202  DYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKSTKAPPKTHK  261

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASL+ RLNALN +AG
Sbjct  262  RYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF KD KQLDA++HRKYIYG HVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIHRKYIYGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+NL ++EPEKYQ+ FS YIKKGI+AD++E LYKKVHAAIRADPS  KS K  PKEHK
Sbjct  206  EYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAKSTKAQPKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKA L+ RLNALN++ G
Sbjct  266  RYNPKKLTYEQRKARLVERLNALNSSGG  293



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVF ALKGALDGGLDIPHS+KRFAGF KD KQLDAEVH KYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHHKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L E+E EKYQS FS YIKKGI AD++E LYKKVHAAIRADPS  KS K+PPKEHK
Sbjct  205  DYMRTLAEEEFEKYQSHFSEYIKKGIKADDVETLYKKVHAAIRADPSVAKSTKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYN KKLT+EER++ L+ RLNALN+  
Sbjct  265  RYNSKKLTHEERRSRLVERLNALNSCG  291



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E++YKKVHAAIRADP+ KK+EK  PKEHK
Sbjct  205  NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRADPNPKKTEKPAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAG++KD+KQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YM  L+EDEPEKYQS F  YIK+G++ADN+E++YKKVHAAIRADP+ KKS+KQ PKEHK
Sbjct  205  SYMNALMEDEPEKYQSHFKEYIKRGVEADNIEEMYKKVHAAIRADPTPKKSDKQQPKEHK  264

Query  328  RYNLKKLTYEERKASLISR  272
            RYNLKKLTYEERKA LI R
Sbjct  265  RYNLKKLTYEERKAKLIER  283



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   212 bits (539),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 6/147 (4%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LDAEVHRKY++GGH+ 
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYVFGGHI-  203

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
                 L EDEPEKYQS FS YIK+GI+AD +E LYKKVHAAIRADPS KKSEKQPPKEHK
Sbjct  204  -----LAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKKSEKQPPKEHK  258

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA LI+R+ A+N+AA
Sbjct  259  RYNLKKLTYEERKAKLIARVAAINSAA  285



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGFSKD+KQLDAEVH KYIYGGHVAAYMR L+EDEPEKYQS FS YIK+GI+
Sbjct  133  IPHSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            ADN+E LYK VHAAIRADP+AKK+EK+PPK+HKR+NLKKLTYEERK+ LI RL+ LNAAA
Sbjct  193  ADNIESLYKNVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKSKLIERLHTLNAAA  252

Query  247  G  245
            G
Sbjct  253  G  253



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+SKQLDAE HR YI+GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAETHRNYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L +DEPEKYQ+ FS Y+KKG+DADNLE LYKKVH AIRADP+ KKSEK  P EHK
Sbjct  205  NYMKLLNDDEPEKYQTHFSEYLKKGMDADNLEALYKKVHTAIRADPTLKKSEKPAPTEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYNLKKLTYEERK  LI RL ALN+
Sbjct  265  RYNLKKLTYEERKERLIERLKALNS  289



>ref|NP_001189970.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AEE77020.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=190

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++KQLDAE+HR YIYGGHV+
Sbjct  34   LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS  93

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  94   NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTVKPAPKQHK  153

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  154  RYNLKKLTYEERKNKLIERVKALNGAGG  181



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHSEKRFAGF+KDSKQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+
Sbjct  133  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            ADNLE +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AA
Sbjct  193  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  247  G  245
            G
Sbjct  253  G  253



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHSEKRFAGF+KDSKQLD EVHRKYIYGGHVA+YMR L+EDEPEKYQS FS YIK+GI+
Sbjct  140  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  199

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            ADNLE +YKKVHAAIRA+P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AA
Sbjct  200  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  259

Query  247  G  245
            G
Sbjct  260  G  260



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLD EVHRKYI+GGHV+
Sbjct  173  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDEKQLDPEVHRKYIFGGHVS  232

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +YMR L+EDEPEKYQ+ FS Y+K+GI+ D++E+LYKKVHAAIRADP+  KS K+PPKEHK
Sbjct  233  SYMRMLMEDEPEKYQTHFSEYVKRGIEPDDIEELYKKVHAAIRADPNMVKSTKEPPKEHK  292

Query  328  RYNLKKLTYEERKASLISR  272
            R+NLKKLTYEERKA LI R
Sbjct  293  RFNLKKLTYEERKARLIER  311



>ref|XP_010648788.1| PREDICTED: 60S ribosomal protein L5-like, partial [Vitis vinifera]
Length=191

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            L+VGLLRTTTGNRVFGALKGALDGGLDIPHS+KRF GFS DSKQLDAEVHRK IY GHV+
Sbjct  32   LNVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFFGFSNDSKQLDAEVHRKCIYVGHVS  91

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM   +EDEPE YQS FS YIKK ++ D +E++YKKVHA I A+P  KK EKQPPKEHK
Sbjct  92   AYMGTFMEDEPETYQSHFSEYIKKIVEQDGIEEMYKKVHATICANPIQKKVEKQPPKEHK  151

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L+ RLNALN+  
Sbjct  152  RYNLKKLTYEERKAKLVERLNALNSTT  178



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E++YKKVHAAIRA+P+ KK+EK  PKEHK
Sbjct  205  NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKKTEKSAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS F+ YIKKGID
Sbjct  133  IPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGID  192

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            AD LE LYKKVHAAIRADP+ KKSEK  PKEHKRYNLKKLTYEERKA L+ RLNALN+A 
Sbjct  193  ADGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  252



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ KQLDAE+HRKYIYGGHV 
Sbjct  145  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHRKYIYGGHVV  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQ+ FS ++KKG++ +N+E++YKKVHAAIRADP AKKS+K+ PKEHK
Sbjct  205  DYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKKVHAAIRADPLAKKSDKETPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYN KKLTYEERKASLI R+ ALN+
Sbjct  265  RYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQL+AE HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAY+KKG++A+++E++YKKVHAAIRADP+ KK+EK  PK+HK
Sbjct  205  NYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKTEKPAPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E++YKKVHAAIRADP+ KK+EK  PK HK
Sbjct  205  NYMKMLAEDEPEKLQTHFSAYIKKGVEAESIEEIYKKVHAAIRADPNPKKTEKPAPKGHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+ +E++YKKVHAAIRADP+ KK+EK  PK HK
Sbjct  205  NYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKTEKPAPKGHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+ +E++YKKVHAAIRADP+ KK+EK  PK HK
Sbjct  205  NYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKTEKPAPKGHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  205  NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTVKPAPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+ +E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  205  NYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTVKPAPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>dbj|BAH20263.1| AT3G25520 [Arabidopsis thaliana]
Length=202

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++KQLDAE+HR YIYGG V+
Sbjct  46   LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGDVS  105

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  106  NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTVKPAPKQHK  165

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  166  RYNLKKLTYEERKNKLIERVKALNGAGG  193



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ K LDAE+HRKYIYGGHVA
Sbjct  149  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVA  208

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQS FS Y+KK +  +N+E++YK VHAAIRADPS KKS+K+ PKEHK
Sbjct  209  DYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSDKEAPKEHK  268

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTY+ERKASLI R+ ALN+A G
Sbjct  269  RYNPKKLTYDERKASLIQRVKALNSAIG  296



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQL+AE HR YIYGGHV+
Sbjct  166  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHRNYIYGGHVS  225

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAY+KKG++A+++E++YKKVHAAIRADP+ KK+EK  PK+HK
Sbjct  226  NYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKTEKPAPKQHK  285

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  286  RYNLKKLTYEERKNKLIERVKALNGAGG  313



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ K LDAE+HRKYIYGGHVA
Sbjct  145  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQS FS Y+KK +  +N+E++YK VHAAIRADPS KKS+K+ PKEHK
Sbjct  205  DYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSDKEAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTY+ERKASLI R+ ALN+A G
Sbjct  265  RYNPKKLTYDERKASLIQRVKALNSAIG  292



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ K LDAE+HRKYIYGGHVA
Sbjct  145  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L+EDEPEKYQS FS Y+KK +  +N+E++YKKVHAAIRADPS KKS+K+ PKEHK
Sbjct  205  DYMRLLMEDEPEKYQSHFSDYLKKDLAPENMEEMYKKVHAAIRADPSVKKSDKEAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYN KKLTY+ERKASLI R+ ALN+ 
Sbjct  265  RYNPKKLTYDERKASLIQRVKALNSV  290



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ KQLDAE+HRKYIYGGHV 
Sbjct  145  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHRKYIYGGHVV  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQ+ FS ++KKG++ +N+E++YK VHAAIRADP AKKS+K+ PKEHK
Sbjct  205  DYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKNVHAAIRADPLAKKSDKEAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            RYN KKLTYEERKASLI R+ ALN+
Sbjct  265  RYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+++E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  205  NYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKTEKPAPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  265  RYNLKKLTYEERKNKLIERVKALN  288



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  152  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  211

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  212  NYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKTEKPAPKAHK  271

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  272  RYNLKKLTYEERKNKLIERVKALN  295



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  175  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  234

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+++E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  235  NYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKTEKPAPKTHK  294

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  295  RYNLKKLTYEERKNKLIERVKALN  318



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+ +E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  205  NYMKILAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTVKPAPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009384264.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 128/147 (87%), Gaps = 6/147 (4%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR      D KQLDAEVHR YI+GGHVA
Sbjct  24   LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVHRNYIFGGHVA  77

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +Y++ L+EDEPEKYQ  FS YIK+GI+ D++E++YKKVHAAI ADP+  KS KQPPKEH+
Sbjct  78   SYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIKSTKQPPKEHR  137

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERKA LI RLNALNA+A
Sbjct  138  RFNLKKLTYEERKAKLIERLNALNASA  164



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  169  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  228

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+++E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  229  NYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKTEKPAPKTHK  288

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  289  RYNLKKLTYEERKNKLIERVKALN  312



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgg---lDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGG  518
            LDVGL+RTTTGNRVFGALK         LDIPHS+KRFAGF+K++KQLDAE+HR YIYGG
Sbjct  145  LDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGG  204

Query  517  HVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPK  338
            HV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRADP+ KK+EK  PK
Sbjct  205  HVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKTEKPAPK  264

Query  337  EHKRYNLKKLTYEERKASLISRLNALNAAAG  245
            +HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  QHKRYNLKKLTYEERKNKLIERVKALNGAGG  295



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAG+SKD K LDAEVHRKYIYGGHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYSKDDKSLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L EDEPEKYQS F  Y+K+ I+ +++E++YKKVH AIRADPS+ K +K  PKEHK
Sbjct  205  AYMSMLREDEPEKYQSHFVEYLKREIEPESIEEMYKKVHTAIRADPSSVK-KKPAPKEHK  263

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA L+ RLNALN+AAG
Sbjct  264  RYNLKKLTYEERKAKLVERLNALNSAAG  291



>ref|XP_009384265.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 128/147 (87%), Gaps = 6/147 (4%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KR      D KQLDAEVHR YI+GGHVA
Sbjct  75   LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVHRNYIFGGHVA  128

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            +Y++ L+EDEPEKYQ  FS YIK+GI+ D++E++YKKVHAAI ADP+  KS KQPPKEH+
Sbjct  129  SYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIKSTKQPPKEHR  188

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERKA LI RLNALNA+A
Sbjct  189  RFNLKKLTYEERKAKLIERLNALNASA  215



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA++HR YIYGGHV+
Sbjct  153  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDADIHRNYIYGGHVS  212

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  213  NYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKTEKPAPKAHK  272

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  273  RYNLKKLTYEERKNKLIERVKALN  296



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ K LDAE+HRKYIYGGHVA
Sbjct  155  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVA  214

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQS FS Y+KK +  +N+E++YK VHAAIRADPS KKS+K+ PKEHK
Sbjct  215  DYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSDKEAPKEHK  274

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYN KKLTY+ERKASLI R+ ALN+A
Sbjct  275  RYNPKKLTYDERKASLIQRVKALNSA  300



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FS YIKKG++A+ +E++YKKVHAAIRA+P+ KK+ K  PKEHK
Sbjct  205  NYMKMLAEDEPEKLQTHFSGYIKKGVEAEGIEEMYKKVHAAIRAEPNHKKTVKSAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  162  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  221

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+++E+LYKKVHAAIRADP+ KK+EK  PK H 
Sbjct  222  NYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKTEKPAPKTHN  281

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  282  RYNLKKLTYEERKNKLIERVKALN  305



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+ +E+LYKKVHAAIRADP+ KK+ K  PK HK
Sbjct  205  NYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKTAKPAPKAHK  264

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  265  RYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   203 bits (517),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGFS+D KQLDA+VHRKYI+GGHVAAYM  L+EDEPEKYQS FS YIK+GI+
Sbjct  134  IPHSDKRFAGFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIE  193

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
             D +E++YKKVHA+IRADP+ KKSEK+PPK HKR+NLKKLTYEERKA LI RLNALN+AA
Sbjct  194  PDGIEEMYKKVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAA  253

Query  247  G  245
            G
Sbjct  254  G  254



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYKKVHAAIRA P+ +K+ K  PK+HK
Sbjct  205  NYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRAXPNXRKTVKPAPKQHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERK  LI R+ ALN A G
Sbjct  265  RYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGF K+ K+LD EVHRKYI+GGHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFEKEKKELDPEVHRKYIFGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ LIEDEPEKYQS FS YIK+GI+AD LE LYKKVHAAIRADP+ KK+EK+PPK+ K
Sbjct  205  AYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEDLYKKVHAAIRADPTIKKAEKKPPKKSK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKLTYEERKA LI+RL ALN+AAG
Sbjct  265  RYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSK++KQLD   H KYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKENKQLDFATHAKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKGI+AD +E LYKKVHAAIRADP AKK+ KQ  KEHK
Sbjct  206  DYMKTLNEDEPEKFQTHFSEYVKKGIEADEMEALYKKVHAAIRADPLAKKAGKQSLKEHK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTY++RKA+LI R+  LN+AA
Sbjct  266  RFNLKKLTYKQRKANLIDRITTLNSAA  292



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+ TTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K+ K LDAE+HRKYIYGGHVA
Sbjct  237  LDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHRKYIYGGHVA  296

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L+EDEPEKYQS FS Y+KK +  +N+E++YK VHAAIRADPS KKS+K+ PKEHK
Sbjct  297  DYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKSDKEAPKEHK  356

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            RYN KKLTY+ERKASLI R+ ALN+A
Sbjct  357  RYNPKKLTYDERKASLIQRVKALNSA  382



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L  DEPEK+Q+ FS ++KKG+DA+++E+LYKKVHAAIRADP+ KK+EK  PK HK
Sbjct  205  NYMKMLNYDEPEKFQTHFSQHLKKGVDAESMEELYKKVHAAIRADPNPKKTEKPAPKTHK  264

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  265  RYNLKKLTYEERKNKLIERVKALN  288



>gb|EYU36673.1| hypothetical protein MIMGU_mgv1a0142632mg, partial [Erythranthe 
guttata]
Length=140

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAG++KDSK LDAEVHRKYIYGGHVAAYM  L+EDEP+KYQ+ FS Y+K G++
Sbjct  9    IPHSDKRFAGYAKDSKSLDAEVHRKYIYGGHVAAYMNTLMEDEPDKYQTHFSKYVKNGLE  68

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            AD LE LYKKVHAAIRADP+ KKS+KQP KEHKR+NLKKLTYEERK  LI RLNALN+AA
Sbjct  69   ADELEALYKKVHAAIRADPTPKKSDKQPRKEHKRFNLKKLTYEERKNKLIERLNALNSAA  128



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQL+AE+HR YI+GGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAEIHRNYIFGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++ +++E++YKKVH AIRADP+ KK EK  PKEHK
Sbjct  205  NYMKMLAEDEPEKLQTHFSAYIKKGVEPESIEEMYKKVHLAIRADPNPKKCEKPAPKEHK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            R+NLKKLTYEERK  LI R+ ALN A+
Sbjct  265  RHNLKKLTYEERKNKLIERVKALNRAS  291



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPH +KRFAGF+KDSKQLD EVHRKYIYGGHVAAYMR L+EDEPEKYQS FS YIK+ I+
Sbjct  133  IPHGDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRSIE  192

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
             D +E +YKKVH AIRA P AKKSEK PPKEHKRYNLKKL+YEERKA LI RL ALN+AA
Sbjct  193  PDTIEGMYKKVHTAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  247  G  245
            G
Sbjct  253  G  253



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAG++K+SK LDA++HRKYI GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKESKSLDADLHRKYILGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+ L EDEPEKYQS FS Y KKGI+ +N+E+LYKKVHAAIRADP+ K SEK  PK  K
Sbjct  205  AYMKTLREDEPEKYQSQFSEYHKKGIEPENIEELYKKVHAAIRADPTIKYSEKHVPKVQK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
             Y  +KLTYEERK  LI+RLNALNA A
Sbjct  265  HYLTRKLTYEERKNKLIARLNALNAGA  291



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIY GHVA
Sbjct  145  LDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS F  YIK+GI+ADNLE+LYKKVHAAIRADP+ KKSEK+PP EHK
Sbjct  205  AYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKSEKKPPAEHK  264

Query  328  RYN  320
            RY 
Sbjct  265  RYG  267



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALD GLDIPHS+KRFAGFSKD+KQLDAEVH KYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHSKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQS FS YIK+GI+ADN+E LYKKVHAAIRADP+AKK+EK+PPK+HK
Sbjct  205  AYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKTEKEPPKQHK  264

Query  328  R  326
            R
Sbjct  265  R  265



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 131/148 (89%), Gaps = 4/148 (3%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVF  LKGALDGG+DIPHSEKRFAGF+KDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM+      PEKYQS FS YIK+GI+ D++E +YKKVHAAIRADP AKKS+K+PPKEHK
Sbjct  205  AYMKM----SPEKYQSHFSEYIKRGIEPDSIEGMYKKVHAAIRADPEAKKSKKEPPKEHK  260

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYNLKKL+YEERKA LI RL ALN+AAG
Sbjct  261  RYNLKKLSYEERKAKLIDRLKALNSAAG  288



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 120/137 (88%), Gaps = 3/137 (2%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLD +VHRKYIYGGHVA
Sbjct  145  LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIK+G++AD+LE LYKKVHAAIRADP  KKSEK+PPKEHK
Sbjct  205  AYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKKSEKEPPKEHK  264

Query  328  RYNLKKLTYEERKASLI  278
            R+      Y + K +L+
Sbjct  265  RWG---YIYADEKMTLV  278



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLD EVHRKYIYGGHVA
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L+EDEPEKYQ+ FS YIKKGI+ADN+E +YKKV AAIRADP+AKK EKQPPKEHK
Sbjct  205  AYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVQAAIRADPTAKKIEKQPPKEHK  264



>gb|KCW63927.1| hypothetical protein EUGRSUZ_G016041, partial [Eucalyptus grandis]
Length=150

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKDSKQLD +VHRKYIYGGHVA
Sbjct  31   LDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHRKYIYGGHVA  90

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYMR L EDEPEKYQS FS YIK+G++AD+LE LYKKVHAAIRADP  KKSEK+PPKEHK
Sbjct  91   AYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKKSEKEPPKEHK  150



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG+SK+ K L+AE+HRKYI GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAEIHRKYILGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L EDEPEKYQS FS +IK+GI+AD+L  +Y KVHAAIRADP+++K+ K+ P E +
Sbjct  205  DYMRLLKEDEPEKYQSHFSGFIKEGIEADDLADMYSKVHAAIRADPTSQKTAKKAPAEKR  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            ++ ++KLTYEER+A+L+ RLNA+N 
Sbjct  265  KWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAGFSK+ K L+AE HRKYI GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKEDKSLNAETHRKYILGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L EDEPEKYQS F+ +IK+GI+AD L ++Y KVHAAIRADP  +K+EK+ P E +
Sbjct  205  DYMRLLKEDEPEKYQSHFNKFIKEGIEADELAEMYTKVHAAIRADPDQQKTEKKAPAEKR  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            ++ ++KLT+EER+A+L+ RLNA+NA
Sbjct  265  KWKIQKLTFEERQAALVQRLNAINA  289



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG+SK+ K L+AE HRKYI GGH+A
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAETHRKYILGGHIA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L EDEPEKYQS FS +IK G++ADNL ++Y  VHAAIRADP+ +K+EK+ P E +
Sbjct  205  DYMRLLKEDEPEKYQSHFSGFIKAGVEADNLAEMYTSVHAAIRADPTQQKTEKKAPAEKR  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            ++ ++KLTYEER+A+L+ RLNA+N 
Sbjct  265  KWKIQKLTYEERQAALVKRLNAVNG  289



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS+KRFAGFSKD KQLDAEVHRKYIYGGHVA
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
            AYM  L+EDEPEKYQS F+ YIKKGIDAD LE LYKKVHAAIRADP+ KKSEK  PKEHK
Sbjct  205  AYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKKSEKPAPKEHK  264



>sp|P93779.1|RL5_SOLME RecName: Full=60S ribosomal protein L5, partial [Solanum melongena]
 dbj|BAA19415.1| ribosomal protein L5 [Solanum melongena]
Length=121

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -3

Query  574  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV  395
            SKDSKQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS FS+YIK  +  DN+E++YKKV
Sbjct  2    SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV  61

Query  394  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG  245
            HAAIR DPS KKS+KQPPK HKRYNLKKLTYEERKA LI RLNALNAA G
Sbjct  62   HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGG  111



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDAE+HR YIYGGHV+
Sbjct  178  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVS  237

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK+Q+ FS Y+KKG+DA+++E+LYKKVHAAIRADP+ KK++K  PK HK
Sbjct  238  NYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKTKKPAPKTHK  297

Query  328  RYNLKKLTYEERKASLISRLNALN  257
            RYNLKKLTYEERK  LI R+ ALN
Sbjct  298  RYNLKKLTYEERKNKLIERVKALN  321



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLD+PHSEKRFAG++K+ K L+AE+HRKYI GGHVA
Sbjct  145  LDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYNKEDKSLNAEIHRKYILGGHVA  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEKYQS FS +IK G++A+NL ++Y  VHAAIRADP+ +K+EK+ P E +
Sbjct  205  DYMKLLKEDEPEKYQSHFSGFIKAGVEAENLAEMYTSVHAAIRADPTQQKTEKKAPAEKR  264

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
            ++ ++KLTY+ER+A+L+ RLNA+N 
Sbjct  265  KWKIQKLTYDERQAALVKRLNAING  289



>ref|XP_010451808.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=143

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGF+K++KQLDA +HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++
Sbjct  13   IPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVE  72

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            A+ +E+LYKKVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A 
Sbjct  73   AEGIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAG  132

Query  247  G  245
            G
Sbjct  133  G  133



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++TTTGNRVFGALKGALDGGLDIPHS++RFAG SKD K+L  E HRKY++G  + 
Sbjct  145  LDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFAGISKDKKELGPEFHRKYVFGDWLR  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ LIEDEP KYQ+ F  Y   G   ++LE+++KKVHAAIRA+P+ KK EKQPPKE K
Sbjct  205  PYMKTLIEDEPGKYQTPFMDYFSGGKKPEDLEEVFKKVHAAIRANPTFKKVEKQPPKEPK  264

Query  328  RYNLKKLTYEERKASLISRLNALNAAA  248
            RYNLKKLTYEERKA L++RL ALN AA
Sbjct  265  RYNLKKLTYEERKAKLVARLQALNFAA  291



>gb|KHF99386.1| 60S ribosomal L5 [Gossypium arboreum]
Length=259

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IP SEKRFAGF+K SKQLD EVHRKYIYGGHVAAYM+NL+EDEPEKYQS FS YIK+GI 
Sbjct  129  IPLSEKRFAGFNKGSKQLDPEVHRKYIYGGHVAAYMKNLMEDEPEKYQSHFSEYIKRGIQ  188

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
             D++E +YKKVHAAIRADP AKKS+K+PPKEHKRYNLKKL+YEERKA LI RL ALN+AA
Sbjct  189  PDSIEGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  248

Query  247  G  245
            G
Sbjct  249  G  249



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 127/150 (85%), Gaps = 7/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG+SK+ K L+AEVHRKYIYGGHVA
Sbjct  146  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKE--  335
            AYM  L +++PEKYQS FS +IK+G++ ++LE+LY KVHAAIRADPS ++    PPK+  
Sbjct  206  AYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIRADPSPREP---PPKKDH  262

Query  334  --HKRYNLKKLTYEERKASLISRLNALNAA  251
              HK+    KL+YE+RKA+LI+R+ ALNAA
Sbjct  263  GPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 126/150 (84%), Gaps = 7/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAG+SK+ K L+AEVHRKYIYGGHVA
Sbjct  146  LDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKE--  335
            AYM  L +++PEKYQS FS +IK+G++ ++LE+LY KVHAAIR DPS ++    PPK+  
Sbjct  206  AYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIREDPSPREP---PPKKDH  262

Query  334  --HKRYNLKKLTYEERKASLISRLNALNAA  251
              HK+    KL+YE+RKA+LI+R+ ALNAA
Sbjct  263  GPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGLLRTTTGNRVFGALKGALD G+DIPHS+KRFAGFSKD KQLDA+VHRKYIYGGHVA
Sbjct  121  LDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGFSKDGKQLDAKVHRKYIYGGHVA  180

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEK-QPPKEH  332
            AYM  L EDEPEKY+  FS + K+ I+AD LE+LY+KVHAAIRADP  KKSE+ QPPKE 
Sbjct  181  AYMNTLAEDEPEKYERHFSEFAKREIEADGLEELYRKVHAAIRADPMPKKSERQQPPKEP  240

Query  331  KR  326
            KR
Sbjct  241  KR  242



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 112/148 (76%), Gaps = 24/148 (16%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF K                    
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKK--------------------  185

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
                NL E+EPEKYQS FSAYIKKG++AD +E LYKKVHAAIRADPS  KS KQPPKEHK
Sbjct  186  ----NLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKSTKQPPKEHK  241

Query  328  RYNLKKLTYEERKASLISRLNALNAAAG  245
            RYN KKLTYE+RKASLI RLN LN++ G
Sbjct  242  RYNPKKLTYEQRKASLIERLNQLNSSGG  269



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHS+KRFAGF+K++KQLDA +HR YIYGGHV+
Sbjct  145  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM+ L EDEPEK Q+ FSAYIKKG++A+ +E+LYKKVHAAIRADP+ KK+ K  PK+HK
Sbjct  205  NYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKTVKPAPKQHK  264

Query  328  R  326
            R
Sbjct  265  R  265



>ref|XP_009383145.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L5-2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPH++KRFAGF KD KQLDAE+HRKYI+GGHVA+ MRNL+EDEPEK Q+ F  YIK+  +
Sbjct  11   IPHNDKRFAGFKKDKKQLDAEIHRKYIFGGHVASSMRNLMEDEPEKXQAHFIEYIKRQAE  70

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
             D +E++YKKVHAAIR+    K +       H R+NLKKLTYEERKA LI RLNALNA A
Sbjct  71   PDGMEEMYKKVHAAIRSSKIDKVTTNGAL--HCRFNLKKLTYEERKARLIERLNALNACA  128

Query  247  G  245
            G
Sbjct  129  G  129



>gb|KHN36791.1| 60S ribosomal protein L5 [Glycine soja]
Length=240

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 16/120 (13%)
 Frame = -3

Query  607  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID  428
            IPHS+KRFAGF K+ K+LDAE+                L EDEPEKYQS FS YIK+GI+
Sbjct  130  IPHSDKRFAGFDKEKKELDAEI----------------LAEDEPEKYQSHFSEYIKRGIE  173

Query  427  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA  248
            AD +E LYKKVHAAIRADP+ KKS+KQPPKEHKRYN+KKLTYEERKA L++R+ A+N+AA
Sbjct  174  ADGIEALYKKVHAAIRADPTLKKSDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAA  233



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL+RTTTGNRVFGALKGALDGGLDIPHSEKRFAGF KD KQLDA++HRKYIYGGHVA
Sbjct  146  LDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHRKYIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIR  380
             YM+NL E+EPEKYQS FS YIKKGI+A+++E LYKKVHAAIR
Sbjct  206  DYMKNLAEEEPEKYQSHFSDYIKKGIEAEDMEGLYKKVHAAIR  248



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD GL RT+TG++VF ALKGALDGGLD+PHS+KRF G+S+++K+LD+EV RKYI GGHVA
Sbjct  146  LDTGLKRTSTGSKVFAALKGALDGGLDVPHSDKRFVGYSRETKELDSEVLRKYILGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM +L E+EPEKY+  FS Y+K G++A+ LE+LY  VHAAIRADP  K+ E++ P + K
Sbjct  206  EYMESLKEEEPEKYERHFSRYVKAGLEAEGLEELYTSVHAAIRADPVQKRKERKAPADKK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
             +   KLTYE RK  L ++L  L AA
Sbjct  266  AWKESKLTYEARKEKLKAKLAELTAA  291



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD GL RT+TG++VF ALKGALDGGLDIPH+EKRF GF  DSK+ DAEV RKYIYGGHV 
Sbjct  146  LDAGLKRTSTGSKVFAALKGALDGGLDIPHNEKRFVGFDPDSKEFDAEVLRKYIYGGHVG  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM  + E++PEKY + F+ Y+K G+++D+LE +Y KVH AIRADP+ +   +  P E K
Sbjct  206  EYMEEMQEEDPEKYTAHFAEYLKAGLESDDLEDMYTKVHDAIRADPAPQLKARSKPAESK  265

Query  328  RYNLKKLTYEERKASLISRLNALNAA  251
            R+   KLTYE+RK  L ++L+ L A 
Sbjct  266  RWKEVKLTYEQRKDKLKAKLSELMAG  291



>gb|EFX90266.1| hypothetical protein DAPPUDRAFT_299917 [Daphnia pulex]
Length=302

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 112/152 (74%), Gaps = 5/152 (3%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG R+FGA+KGA+DGG+D+PHS KRF G+  +SK  +AEVHRK+I G HVA
Sbjct  146  LDVGLARTTTGARIFGAMKGAVDGGIDVPHSTKRFPGYDSESKDFNAEVHRKHIMGAHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPK-EH  332
             YMR L++++ E Y+  FS +IK G+ AD +E +YKK H AIRADP  +KS K P K + 
Sbjct  206  DYMRQLVDEDEEAYKKQFSQFIKHGLVADTIETMYKKAHEAIRADPEKQKSSKDPSKIKK  265

Query  331  KRYNLKKLTYEERKASLISR----LNALNAAA  248
            KR+N K+LT EERKA + ++    L+ L A+A
Sbjct  266  KRWNAKRLTLEERKARVAAKKKEFLSKLEASA  297



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD GL RT+TG++VF ALKGALDGGLD+PHSEKRF G+S++SK LD++V RKYI+GGHV 
Sbjct  146  LDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRFVGYSRESKSLDSDVLRKYIFGGHVG  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM ++ E++ EK++  FS YIK G++AD LE LY KVHAAIRA P A K  +  P +  
Sbjct  206  EYMESMAEEDEEKFKRHFSCYIKAGLEADGLEALYTKVHAAIRASPEAAKKSRSKPAKAG  265

Query  328  RYNLKKLTYEERKASLISRLNALNA  254
             +   K TYEERK  L ++L  L A
Sbjct  266  SWKTPKSTYEERKERLKAKLAELMA  290



>ref|XP_011014769.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=87

 Score =   138 bits (348),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  490  IEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKK  311
            +EDEPEKYQS FS Y+K+GIDAD +E LYKKVHAAIRADP+AKKSEKQP KEHKRYNLKK
Sbjct  1    MEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKKSEKQPSKEHKRYNLKK  60

Query  310  LTYEERKASLISRLNALNAAA  248
            LTYEERKA L+ RLNALN+AA
Sbjct  61   LTYEERKAKLVERLNALNSAA  81



>ref|XP_008198550.1| PREDICTED: 60S ribosomal protein L5 [Tribolium castaneum]
 gb|EEZ97412.1| hypothetical protein TcasGA2_TC011241 [Tribolium castaneum]
Length=300

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVF A+KGA+DGGL+IPHS KRF G+  +SK  +A+VHR +I+G HVA
Sbjct  146  LDVGLQRTTTGARVFAAMKGAVDGGLNIPHSTKRFPGYDAESKSFNADVHRSHIFGQHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSA-KKSEKQPPKEH  332
             YMR+L E++PE ++  FS YIK GI+AD +E +YK  HAAIRA+P+A KK EK P    
Sbjct  206  DYMRSLEEEDPEAFKRQFSQYIKLGINADQIEGIYKNAHAAIRANPTAEKKPEKAPSATK  265

Query  331  KRYNLKKLTYEERK  290
            KR+N KKLT  ERK
Sbjct  266  KRWNRKKLTLAERK  279



>emb|CBI38287.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  502  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  323
            M  L+EDEPEKYQS FS YIK+GI+ D +E++YKKVHA+IRADP+ KKSEK+PPK HKR+
Sbjct  1    MTTLMEDEPEKYQSHFSEYIKRGIEPDGIEEMYKKVHASIRADPTPKKSEKEPPKVHKRH  60

Query  322  NLKKLTYEERKASLISRLNALNAAAG  245
            NLKKLTYEERKA LI RLNALN+AAG
Sbjct  61   NLKKLTYEERKAKLIERLNALNSAAG  86



>gb|KEZ38694.1| hypothetical protein SAPIO_CDS10715 [Scedosporium apiospermum]
Length=301

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 109/154 (71%), Gaps = 9/154 (6%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RT+TG RVFGA+KGA DGGL IPHSEKRF G+  ++K+LD+EV RKYI+GGHVA
Sbjct  149  LDVGLHRTSTGARVFGAMKGASDGGLYIPHSEKRFPGYDIETKELDSEVLRKYIFGGHVA  208

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YM  L +D+ E+Y+S F  YI   IDAD LE+LY + HAAIR DP  KK E + PK+ K
Sbjct  209  EYMETLADDDEERYKSQFQKYIDDDIDADGLEELYTEAHAAIREDP-FKKVEGKGPKKSK  267

Query  328  --------RYNLKKLTYEERKASLISRLNALNAA  251
                    +Y  +KLTYE+RKA++  R+  +  A
Sbjct  268  EEWKAISQKYKTRKLTYEQRKANVQKRIAEIRDA  301



>gb|ABK92743.1| unknown [Populus trichocarpa]
Length=91

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -3

Query  502  MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY  323
            MR L+EDEPEKYQS FS Y+K+ IDAD +E LYKKVHAAIRADP+ KKSEK+P KEHKRY
Sbjct  1    MRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKKSEKEPLKEHKRY  60

Query  322  NLKKLTYEERKASLISRLNALNAAAG  245
            NLKKLTYEERK  L+ RLN  N+AA 
Sbjct  61   NLKKLTYEERKEKLVERLNTFNSAAD  86



>gb|KIK30810.1| hypothetical protein PISMIDRAFT_86523 [Pisolithus microcarpus 
441]
Length=310

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG+RVFGA+KGA DGG+ IPHSEKRF G+  +SK+LDAEV +KYIYGGHVA
Sbjct  148  LDVGLKRTTTGHRVFGAMKGASDGGIFIPHSEKRFPGYDPESKELDAEVLKKYIYGGHVA  207

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPP--KE  335
             YM +L E++ E+++  FS+Y+  GI ++++E++Y   +AAIR DP+ K +EK      E
Sbjct  208  EYMESLEEEDDERFKKQFSSYLADGIGSEDIEEMYTNAYAAIREDPTFKPTEKTKDWKAE  267

Query  334  HKRYNLKKLTYEERKASLISRLNALNAAAG  245
              +Y   K T EERKA++ +++ A  A+ G
Sbjct  268  SLKYKTPKRTLEERKAAIQAKIEAFQASGG  297



>ref|XP_005643753.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE19209.1| 60S ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD GL RT+TG++VF ALKGALDGGLDIPHS+KRF G+S + K+LD EV RK+IYGGHVA
Sbjct  146  LDTGLKRTSTGSKVFAALKGALDGGLDIPHSDKRFVGYSGEDKKLDPEVLRKHIYGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKE-H  332
             YM  + E+ PEKYQS F+ +I+  +D +++E+LYK VH  IR +P  +K E+  P+   
Sbjct  206  EYMEEMQEEAPEKYQSHFAKWIEAEVDPEDIEELYKGVHEKIRENPIGEKKERSKPETAQ  265

Query  331  KRYNLKKLTYEERKASLISRLNAL  260
            K++   KLTYEERKA+L ++L  L
Sbjct  266  KKWKPSKLTYEERKAALKTKLAQL  289



>ref|XP_004533872.1| PREDICTED: 60S ribosomal protein L5-like [Ceratitis capitata]
Length=298

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL+IPHS KRF G+S ++K  +A+VHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAEAKSFNADVHRAHIFGQHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L E++ E ++  FS YIK GI AD+LE +YKK H +IRADP+ KK E++     K
Sbjct  206  DYMRTLEENDEESFKRQFSRYIKLGIRADDLETIYKKAHQSIRADPTHKKKEQKSGGVKK  265

Query  328  RYNLKKLTYEERKASL  281
            R+N KKLT E+RK  +
Sbjct  266  RWNAKKLTNEQRKVKV  281



>dbj|BAN20290.1| ribosomal protein L5 [Riptortus pedestris]
Length=299

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 102/143 (71%), Gaps = 0/143 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL++T+ G RVFGALKGA+DGGL+IPHS KRF G+  +SK+ +AEVHRK+I+G HVA
Sbjct  146  LDVGLMKTSAGARVFGALKGAVDGGLNIPHSMKRFPGYDSESKEFNAEVHRKHIFGVHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L E + + Y+  FS YIK GI AD +E++YKK HAAIRADPS K   K      K
Sbjct  206  DYMRQLAESDDDAYKKQFSQYIKNGITADQVEEIYKKAHAAIRADPSKKAPAKTKTPVKK  265

Query  328  RYNLKKLTYEERKASLISRLNAL  260
            R+N  KLT  ERK S+  +  A 
Sbjct  266  RWNRAKLTLAERKNSIAQKKAAF  288



>ref|XP_002550737.1| 60S ribosomal protein L5 [Candida tropicalis MYA-3404]
 gb|EER31305.1| 60S ribosomal protein L5 [Candida tropicalis MYA-3404]
Length=298

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 5/151 (3%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD+GL RTTTG RVFG LKGA DGGL +PHS  RF G+  ++++LDAE+ RKYI+GGHVA
Sbjct  146  LDIGLQRTTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGGHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEH-  332
             YM  L++D+ EK++S+F  Y+   ID++++E++Y   H AIRADPS K +EK+  KE  
Sbjct  206  EYMEELLDDDEEKFKSIFKGYLDDEIDSEDIEEIYANAHEAIRADPSFKPTEKKFTKEQY  265

Query  331  ----KRYNLKKLTYEERKASLISRLNALNAA  251
                K+Y   KLT EERKA +  R+    AA
Sbjct  266  KAESKKYRQTKLTREERKAKIAERIAEFKAA  296



>gb|EHJ70750.1| ribosomal protein L5 [Danaus plexippus]
Length=297

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 107/150 (71%), Gaps = 8/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF GF  ++K+ +AEVHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPGFDAEAKKFNAEVHRAHIFGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE-KQPPKEH  332
             YM+NL +++ + ++  F  YIK G+ AD +E LYKK H  IRADPS KK E K+ P + 
Sbjct  206  EYMKNLEQEDEDSFKRQFGKYIKLGVSADAIESLYKKAHELIRADPSHKKKESKKDPAKQ  265

Query  331  KRYNLKKLTYEER-------KASLISRLNA  263
            KR+N +KLT  ER       KAS I RL A
Sbjct  266  KRWNKRKLTLAERKNRIKQKKASFIKRLQA  295



>gb|EMF17397.1| 60S ribosomal protein L5 [Sphaerulina musiva SO2202]
Length=302

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 106/150 (71%), Gaps = 7/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RT+TG RVFGA+KGA DGGL +PHSEKRF G+  ++K+LDAE  RKYI+ GHVA
Sbjct  149  LDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDIETKELDAETLRKYIFAGHVA  208

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADP-------SAKKSEK  350
             YM  L +D+ E+Y+S FS YI   I+AD LE+LY++ H AIR DP         KK+++
Sbjct  209  EYMETLADDDEERYKSQFSGYIDDEIEADGLEELYQEAHKAIREDPWKKDEDAGEKKTKE  268

Query  349  QPPKEHKRYNLKKLTYEERKASLISRLNAL  260
            +   E ++Y LKKLT+EER+  +  ++  L
Sbjct  269  EWKAESQKYKLKKLTHEERRQRVQEKIKTL  298



>ref|NP_001037008.1| 60S ribosomal protein L5 [Bombyx mori]
 sp|O76190.1|RL5_BOMMO RecName: Full=60S ribosomal protein L5 [Bombyx mori]
 gb|AAC24960.1| ribosomal protein L5 [Bombyx mori]
Length=299

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF G+  +SK+ +AEVHR +I+G HVA
Sbjct  146  LDVGLARTTTGRRVFGAMKGAVDGGLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE-KQPPKEH  332
             YMR+L +D+ + ++  FS YIK G+ AD +E +YKK H AIRADPS KK E K+   + 
Sbjct  206  EYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQ  265

Query  331  KRYNLKKLTYEER-------KASLISRLNA  263
            KR+N +KLT  ER       KAS I RL A
Sbjct  266  KRWNKRKLTLAERKNRIKQKKASFIKRLQA  295



>gb|ADT80695.1| ribosomal protein L5 [Euphydryas aurinia]
Length=297

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF G+  ++K+ +AEVHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPGYDAEAKKFNAEVHRAHIFGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE-KQPPKEH  332
             YMRNL +++ + ++  F  YIK G+ AD++E LYKK H AIRADPS KK E K+ P + 
Sbjct  206  EYMRNLEQEDEDSFKRQFGKYIKLGVTADSIESLYKKAHEAIRADPSHKKKEGKKDPAKQ  265

Query  331  KRYNLKKLTYEER-------KASLISRLNA  263
            KR+N +KLT  ER       K S + RL A
Sbjct  266  KRWNKRKLTLAERKNRIKQKKESFLKRLQA  295



>gb|AAV34814.1| ribosomal protein L5 [Bombyx mori]
Length=299

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF G+  +SK+ +AEVHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE-KQPPKEH  332
             YMR+L +D+ + ++  FS YIK G+ AD +E +YKK H AIRADPS KK E K+   + 
Sbjct  206  EYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQ  265

Query  331  KRYNLKKLTYEER-------KASLISRLNA  263
            KR+N +KLT  ER       KAS I RL A
Sbjct  266  KRWNKRKLTLAERKNRIKQKKASFIKRLQA  295



>gb|ABS18358.1| ribosomal protein L5 [Artemia franciscana]
Length=158

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG ++FGALKGA+DGG+DIPHS KRF G+  + K  D+EVHRK+I+G HVA
Sbjct  6    LDVGLARTTTGAKIFGALKGAVDGGIDIPHSTKRFPGYDAEEKHFDSEVHRKHIFGLHVA  65

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPK-EH  332
             YM+NL +++ + ++  FS YIK G++AD +E+LYKK HAAIRADP  K   K   K   
Sbjct  66   EYMKNLADEDEDAFKRQFSQYIKAGVNADAVEELYKKAHAAIRADPEHKPIVKDRSKVAK  125

Query  331  KRYNLKKLTYEERKASLISR  272
            KR+N KKLT E+RK  + ++
Sbjct  126  KRFNPKKLTLEQRKERVAAK  145



>gb|ACY95338.1| ribosomal protein L5 [Manduca sexta]
Length=299

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF G+  ++K+ +AEVHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPGYDAEAKKFNAEVHRAHIFGLHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSE-KQPPKEH  332
             YMRNL +D+ + ++  F  YIK G++AD +E LYKK H  IRADPS KK E K+ P + 
Sbjct  206  EYMRNLEQDDEDSFKRQFGKYIKLGVNADAVESLYKKAHENIRADPSHKKKEVKKDPAKQ  265

Query  331  KRYNLKKLTYEER-------KASLISRLNA  263
            KR++ +KLT  ER       KAS + RL A
Sbjct  266  KRWSKRKLTLAERKNRISQKKASFLKRLQA  295



>ref|XP_002497480.1| 60S ribosomal protein L5 [Zygosaccharomyces rouxii]
 emb|CAR28547.1| ZYRO0F06490p [Zygosaccharomyces rouxii]
Length=298

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LD+GL RTTTG RVFGALKGA DGGL +PHS KRF GF  +S++LDA++ R YI+GGHV+
Sbjct  145  LDIGLQRTTTGARVFGALKGASDGGLYVPHSPKRFPGFDFESEELDADLLRSYIFGGHVS  204

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPK---  338
             YM  L +D+ E+YQ +F  YI   IDA+++E++Y++ H AIRADPS K +EK+  K   
Sbjct  205  QYMEELADDDEERYQELFRGYIADDIDAESVEEIYQQAHEAIRADPSFKPTEKKFSKDQY  264

Query  337  --EHKRYNLKKLTYEERKASLISRLNALNAAA  248
              E K+Y  +KL+ E+++  + +++N L AA+
Sbjct  265  AAESKKYKQRKLSKEQKRERVAAKINLLAAAS  296



>gb|KIO13004.1| hypothetical protein M404DRAFT_706860 [Pisolithus tinctorius 
Marx 270]
Length=314

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG+RVFGA+KGA DGG+ IPHS+KRF G+  +SK+LDAEV +KYIYGGHVA
Sbjct  148  LDVGLKRTTTGHRVFGAMKGASDGGIFIPHSDKRFPGYDPESKELDAEVLKKYIYGGHVA  207

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPP--KE  335
             YM +L E++ E+++  FS+Y+  GI ++++E++Y   +AAIR DP+ K +EK      E
Sbjct  208  EYMESLEEEDDERFKKQFSSYLADGIGSEDIEEMYTNAYAAIREDPTFKPTEKTKDWKAE  267

Query  334  HKRYNLKKLTYEERKASLISRLNALNAAAG  245
              +Y   K T EERKA++ +++ A  A+ G
Sbjct  268  TLKYKKPKRTLEERKAAIQAKIEAFQASGG  297



>ref|XP_007880337.1| hypothetical protein PFL1_04620 [Pseudozyma flocculosa PF-1]
 gb|EPQ27876.1| hypothetical protein PFL1_04620 [Pseudozyma flocculosa PF-1]
Length=297

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RT+TG+RVFGALKGA DGG+ IPHSEKRF G+  +SK+LD+E+ R YI+GGHVA
Sbjct  147  LDVGLKRTSTGSRVFGALKGASDGGIFIPHSEKRFPGYDPESKELDSELLRSYIFGGHVA  206

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQP--PKE  335
             YM +L E++ E+++  FS+Y+   I +D+LE++Y+  +AAIR DPS K +EK      E
Sbjct  207  EYMESLEEEDDERFKKAFSSYLADDIGSDDLEEIYENAYAAIREDPSFKPTEKTKDWAAE  266

Query  334  HKRYNLKKLTYEERKASLISRLNALNAA  251
             K+Y   KL+YE+RKA + +++ A  + 
Sbjct  267  SKKYKETKLSYEQRKAKIQTKIEAFKSG  294



>ref|XP_011197235.1| PREDICTED: 60S ribosomal protein L5 [Bactrocera dorsalis]
Length=298

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  688  LDVGLLRTTTGNRVFgalkgaldgglDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA  509
            LDVGL RTTTG RVFGA+KGA+DGGL+IPHS KRF G++ ++K  +A+VHR +I+G HVA
Sbjct  146  LDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYNAEAKNFNADVHRAHIFGQHVA  205

Query  508  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHK  329
             YMR L E++ E ++  FS YIK GI AD+LE +YKK H AIR+DP+ KK +++     K
Sbjct  206  DYMRTLEENDEESFKRQFSRYIKLGIRADDLETIYKKAHQAIRSDPTHKKKDQKSGVVKK  265

Query  328  RYNLKKLTYEERKASL  281
            R+N KKLT E+RK  +
Sbjct  266  RWNAKKLTNEQRKVKV  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520