BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014M21

Length=787
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614932.1|  PREDICTED: polyribonucleotide nucleotidyltra...    125   1e-28   Nicotiana tomentosiformis
ref|XP_009768206.1|  PREDICTED: polyribonucleotide nucleotidyltra...    122   2e-27   Nicotiana sylvestris
ref|XP_010316293.1|  PREDICTED: polyribonucleotide nucleotidyltra...    119   3e-26   Solanum lycopersicum
ref|XP_006338583.1|  PREDICTED: polyribonucleotide nucleotidyltra...    114   8e-25   Solanum tuberosum [potatoes]
ref|XP_011047330.1|  PREDICTED: polyribonucleotide nucleotidyltra...  94.4    5e-18   Populus euphratica
ref|XP_002300042.2|  hypothetical protein POPTR_0001s35070g           94.4    5e-18   
emb|CBI34890.3|  unnamed protein product                              92.8    2e-17   Vitis vinifera
ref|XP_010660886.1|  PREDICTED: polyribonucleotide nucleotidyltra...  92.4    2e-17   Vitis vinifera
gb|EYU44773.1|  hypothetical protein MIMGU_mgv1a001063mg              88.2    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_002524669.1|  polyribonucleotide nucleotidyltransferase, p...  87.4    9e-16   Ricinus communis
ref|XP_011098446.1|  PREDICTED: polyribonucleotide nucleotidyltra...  87.0    1e-15   Sesamum indicum [beniseed]
gb|KDP45314.1|  hypothetical protein JCGZ_09563                       87.0    1e-15   Jatropha curcas
emb|CDP02087.1|  unnamed protein product                              85.5    3e-15   Coffea canephora [robusta coffee]
gb|KJB33814.1|  hypothetical protein B456_006G032100                  84.0    1e-14   Gossypium raimondii
ref|XP_007031538.1|  Polyribonucleotide nucleotidyltransferase, p...  82.4    3e-14   
ref|XP_010940149.1|  PREDICTED: polyribonucleotide nucleotidyltra...  81.6    6e-14   Elaeis guineensis
ref|XP_006446552.1|  hypothetical protein CICLE_v10014159mg           80.5    1e-13   Citrus clementina [clementine]
gb|KDO55206.1|  hypothetical protein CISIN_1g002054mg                 80.5    2e-13   Citrus sinensis [apfelsine]
ref|XP_006470281.1|  PREDICTED: polyribonucleotide nucleotidyltra...  79.0    5e-13   Citrus sinensis [apfelsine]
ref|XP_008796014.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  78.2    7e-13   
gb|KHG09808.1|  Polyribonucleotide nucleotidyltransferase             77.4    1e-12   Gossypium arboreum [tree cotton]
ref|XP_007031537.1|  Polyribonucleotide nucleotidyltransferase, p...  77.8    1e-12   
ref|XP_009121656.1|  PREDICTED: polyribonucleotide nucleotidyltra...  77.8    1e-12   Brassica rapa
ref|XP_004304642.1|  PREDICTED: polyribonucleotide nucleotidyltra...  77.4    1e-12   Fragaria vesca subsp. vesca
emb|CDX69573.1|  BnaA10g19220D                                        76.3    3e-12   
ref|XP_008230570.1|  PREDICTED: polyribonucleotide nucleotidyltra...  76.3    3e-12   Prunus mume [ume]
ref|XP_008341437.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  76.3    3e-12   
ref|XP_003554809.1|  PREDICTED: polyribonucleotide nucleotidyltra...  74.7    9e-12   Glycine max [soybeans]
ref|XP_009131416.1|  PREDICTED: polyribonucleotide nucleotidyltra...  74.7    9e-12   Brassica rapa
gb|KHN23516.1|  Polyribonucleotide nucleotidyltransferase             74.7    9e-12   Glycine soja [wild soybean]
emb|CDX78584.1|  BnaA03g04960D                                        74.7    9e-12   
ref|XP_009380405.1|  PREDICTED: polyribonucleotide nucleotidyltra...  74.7    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09870.1|  BnaC09g42910D                                        73.9    2e-11   Brassica napus [oilseed rape]
ref|XP_004489245.1|  PREDICTED: polyribonucleotide nucleotidyltra...  73.9    2e-11   Cicer arietinum [garbanzo]
ref|XP_010033299.1|  PREDICTED: polyribonucleotide nucleotidyltra...  73.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_007217697.1|  hypothetical protein PRUPE_ppa000918mg           73.6    3e-11   Prunus persica
ref|XP_006579768.1|  PREDICTED: polyribonucleotide nucleotidyltra...  71.6    4e-11   
ref|XP_009377194.1|  PREDICTED: polyribonucleotide nucleotidyltra...  72.4    6e-11   
ref|XP_006399970.1|  hypothetical protein EUTSA_v10012572mg           70.9    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010665719.1|  PREDICTED: polyribonucleotide nucleotidyltra...  70.1    3e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008443548.1|  PREDICTED: polyribonucleotide nucleotidyltra...  68.9    8e-10   Cucumis melo [Oriental melon]
gb|KFK25698.1|  hypothetical protein AALP_AA8G147400                  68.2    1e-09   Arabis alpina [alpine rockcress]
ref|XP_002454178.1|  hypothetical protein SORBIDRAFT_04g026110        67.4    3e-09   Sorghum bicolor [broomcorn]
ref|XP_004141096.1|  PREDICTED: polyribonucleotide nucleotidyltra...  67.0    4e-09   Cucumis sativus [cucumbers]
ref|XP_004164730.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  66.6    4e-09   
ref|NP_001047444.1|  Os02g0617700                                     65.5    5e-09   
ref|XP_007151009.1|  hypothetical protein PHAVU_004G011100g           66.2    5e-09   Phaseolus vulgaris [French bean]
gb|EPS73358.1|  hypothetical protein M569_01398                       66.2    6e-09   Genlisea aurea
ref|NP_001146202.1|  uncharacterized protein LOC100279772             65.1    1e-08   
gb|EEC73607.1|  hypothetical protein OsI_08089                        65.5    1e-08   Oryza sativa Indica Group [Indian rice]
sp|Q6KAI0.1|PNP2_ORYSJ  RecName: Full=Polyribonucleotide nucleoti...  65.1    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57382.1|  hypothetical protein OsJ_07542                        65.1    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643478.1|  PREDICTED: uncharacterized protein LOC100279...  65.1    1e-08   
ref|XP_010248545.1|  PREDICTED: polyribonucleotide nucleotidyltra...  64.7    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006648841.1|  PREDICTED: polyribonucleotide nucleotidyltra...  64.3    2e-08   Oryza brachyantha
ref|XP_004953116.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.9    3e-08   
dbj|BAJ93434.1|  predicted protein                                    63.5    4e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010235710.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.5    5e-08   Brachypodium distachyon [annual false brome]
ref|XP_010550151.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.2    7e-08   Tarenaya hassleriana [spider flower]
emb|CDX70572.1|  BnaC03g06560D                                        62.8    8e-08   
ref|XP_010108801.1|  Polyribonucleotide nucleotidyltransferase        62.4    1e-07   
gb|EMS68952.1|  Polyribonucleotide nucleotidyltransferase             60.8    4e-07   Triticum urartu
dbj|BAC42539.1|  putative polynucleotide phosphorylase                56.6    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492266.1|  PREDICTED: polyribonucleotide nucleotidyltra...  58.9    2e-06   Camelina sativa [gold-of-pleasure]
gb|AES74396.2|  polyribonucleotide nucleotidyltransferase             58.2    2e-06   Medicago truncatula
ref|XP_003618178.1|  Polyribonucleotide nucleotidyltransferase        58.2    3e-06   
ref|XP_010420100.1|  PREDICTED: polyribonucleotide nucleotidyltra...  56.6    9e-06   Camelina sativa [gold-of-pleasure]
ref|NP_196962.1|  polyribonucleotide nucleotidyltransferase           56.2    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289585.1|  hypothetical protein CARUB_v10003135mg           56.2    1e-05   Capsella rubella
ref|XP_002873678.1|  hypothetical protein ARALYDRAFT_488299           55.5    2e-05   
ref|XP_010453582.1|  PREDICTED: polyribonucleotide nucleotidyltra...  53.9    7e-05   Camelina sativa [gold-of-pleasure]



>ref|XP_009614932.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana tomentosiformis]
Length=981

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = -3

Query  767  RNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNK-DSTVETGIKANKLKLGMKL  591
            RN K  K+GK++I D++SD E E K+TS+    S++  +K D+T ET + ANKLKLGMK+
Sbjct  862  RNAKS-KRGKDAILDLLSDDESEQKHTSEVGLHSKTGSDKNDATTETPMTANKLKLGMKV  920

Query  590  IAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
             AKVHQIR LGLVLDLGGG+RGMYRFEPGAKRDFEVGD++ VKC+SFS+KGVPV+SLV++
Sbjct  921  TAKVHQIRTLGLVLDLGGGIRGMYRFEPGAKRDFEVGDELRVKCSSFSTKGVPVLSLVKE  980



>ref|XP_009768206.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana sylvestris]
Length=981

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 4/121 (3%)
 Frame = -3

Query  767  RNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQ--SDLNKDSTVETGIKANKLKLGMK  594
            RN K  K+ K++I D++SD E E K+TS+    S+  SD N D+T ET + ANKLKLGMK
Sbjct  862  RNAKS-KRRKDAILDLLSDDESEQKHTSEVGLHSKIGSDKN-DATTETPMTANKLKLGMK  919

Query  593  LIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            + AKVHQIRALGLVLDLGG +RGMYRFEPGAKRDFEVGD++ VKC+SFS+KGVPV+SLV+
Sbjct  920  VTAKVHQIRALGLVLDLGGAIRGMYRFEPGAKRDFEVGDELRVKCSSFSTKGVPVLSLVK  979

Query  413  D  411
            +
Sbjct  980  E  980



>ref|XP_010316293.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Solanum lycopersicum]
Length=983

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = -3

Query  767  RNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKD-STVETGIKANKLKLGMKL  591
            R+ KK K+ K++I D++SD E E K+T +    SQ   +KD +T ET + ANKLKLGMK+
Sbjct  863  RSAKKSKRSKDAILDLISDDESEQKHTPEVGLHSQIGSDKDDATSETPMSANKLKLGMKV  922

Query  590  IAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
             AKVHQIRALGLVLDLGGG+RGMYRFE G K+DFEVGD++ VKC+SFS+KG+PV+SLV++
Sbjct  923  TAKVHQIRALGLVLDLGGGIRGMYRFESGMKKDFEVGDELRVKCSSFSTKGIPVLSLVKE  982



>ref|XP_006338583.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Solanum tuberosum]
Length=977

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = -3

Query  767  RNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLI  588
            R+ KK K+ K++I D++SD E E K+T +    SQ   +K       + ANKLKLGM++ 
Sbjct  863  RSAKKSKRSKDAILDLISDDESEQKHTPEVGLHSQIGSDK-----APMSANKLKLGMRVT  917

Query  587  AKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            AKVHQIRALGLVLDLGGG+RGMYRFEPG KRDFEVGD++ VKC+SFS+KG+PV+SLV++
Sbjct  918  AKVHQIRALGLVLDLGGGIRGMYRFEPGMKRDFEVGDELRVKCSSFSTKGIPVLSLVKE  976



>ref|XP_011047330.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Populus euphratica]
Length=965

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            ++D+ V + + A  LKLGMK+ AKV+QIRALGLVLDLG G+RGMYRFE   KRDFE+GD+
Sbjct  884  DEDAKVVSPLSAKSLKLGMKIAAKVYQIRALGLVLDLGNGVRGMYRFETNGKRDFEIGDE  943

Query  473  VLVKCTSFSSKGVPVMSLVED  411
            +LVKCTSFSSKG+PVMSLV+D
Sbjct  944  LLVKCTSFSSKGLPVMSLVDD  964



>ref|XP_002300042.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
 gb|EEE84847.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
Length=961

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            ++D+ V + + A  LKLGMK+ AKV+QIRALGLVLDLG G+RGMYRFE   KRDFE+GD+
Sbjct  880  DEDAKVVSPLSAKSLKLGMKIAAKVYQIRALGLVLDLGNGVRGMYRFETNGKRDFEIGDE  939

Query  473  VLVKCTSFSSKGVPVMSLVED  411
            +LVKCTSFSSKG+PVMSLV+D
Sbjct  940  LLVKCTSFSSKGLPVMSLVDD  960



>emb|CBI34890.3| unnamed protein product [Vitis vinifera]
Length=905

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = -3

Query  773  SSRNVKKFK------KGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTV-ETGIKAN  615
            S++NVKK K      K   SI  I+S  E  DK+ S     SQ+DLN    V ET   A 
Sbjct  776  SAKNVKKSKISSQKEKDINSIFTILSMGEDGDKHGSAFNANSQNDLNDTKEVPETCTGAK  835

Query  614  KLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP-GAKRDFEVGDQVLVKCTSFSSKG  438
             LKLGMKL AKV+QIR  GLVLDLGGG+RGMYRFE    KRDF+VGD++ V C+SFS+KG
Sbjct  836  NLKLGMKLNAKVYQIRTHGLVLDLGGGIRGMYRFEGDNDKRDFKVGDELHVMCSSFSTKG  895

Query  437  VPVMSLVED  411
            +PVMSLVED
Sbjct  896  IPVMSLVED  904



>ref|XP_010660886.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Vitis vinifera]
Length=997

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = -3

Query  773  SSRNVKKFK------KGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTV-ETGIKAN  615
            S++NVKK K      K   SI  I+S  E  DK+ S     SQ+DLN    V ET   A 
Sbjct  868  SAKNVKKSKISSQKEKDINSIFTILSMGEDGDKHGSAFNANSQNDLNDTKEVPETCTGAK  927

Query  614  KLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP-GAKRDFEVGDQVLVKCTSFSSKG  438
             LKLGMKL AKV+QIR  GLVLDLGGG+RGMYRFE    KRDF+VGD++ V C+SFS+KG
Sbjct  928  NLKLGMKLNAKVYQIRTHGLVLDLGGGIRGMYRFEGDNDKRDFKVGDELHVMCSSFSTKG  987

Query  437  VPVMSLVED  411
            +PVMSLVED
Sbjct  988  IPVMSLVED  996



>gb|EYU44773.1| hypothetical protein MIMGU_mgv1a001063mg [Erythranthe guttata]
Length=899

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -3

Query  656  LNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGD  477
            L K    ++ I A  LK+GM+L  KVHQIRA GLVLDLGG LRGMYRFE G+KRDFEVGD
Sbjct  818  LRKIPKAKSCIDAKTLKIGMELTGKVHQIRAHGLVLDLGGDLRGMYRFENGSKRDFEVGD  877

Query  476  QVLVKCTSFSSKGVPVMSLVE  414
            ++ VKC SFS+KGVPVMSLV+
Sbjct  878  EMRVKCCSFSTKGVPVMSLVQ  898



>ref|XP_002524669.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
 gb|EEF37688.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
Length=958

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            N ++ VE+ I A  LKLG K+ AKV+QIR  GLVLDLGG +RGM+RFE   KRDFEVGD+
Sbjct  877  NVENEVESPINARNLKLGTKVAAKVYQIRKHGLVLDLGGEVRGMFRFEENGKRDFEVGDE  936

Query  473  VLVKCTSFSSKGVPVMSLVED  411
            + VKCT+FSSKG+PVMSLV+D
Sbjct  937  LRVKCTNFSSKGIPVMSLVDD  957



>ref|XP_011098446.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Sesamum indicum]
Length=901

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = -3

Query  737  ESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlg  558
            ES++ IV     E  +  K+     + LN+    E  + A KLKLG ++ AKVHQIRA G
Sbjct  798  ESLSSIVIRSAAECDDEEKS-----AGLNRSCKGEVPMDAKKLKLGTEVTAKVHQIRAHG  852

Query  557  lvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLV  417
            LVLDLGGG+RGM+RFE G++RDFEVG+++ VKC+SFSSKG+PVM+LV
Sbjct  853  LVLDLGGGIRGMFRFETGSRRDFEVGEEMRVKCSSFSSKGIPVMTLV  899



>gb|KDP45314.1| hypothetical protein JCGZ_09563 [Jatropha curcas]
Length=938

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -3

Query  692  NTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRF  513
              SK  +K +++  K++ VE  + AN LKLG K+ AKV QIR  GLVL+LGGG+RGMYRF
Sbjct  844  QASKRDQKPKTNPPKEAKVEAPMSANNLKLGTKVTAKVFQIRKHGLVLELGGGVRGMYRF  903

Query  512  EPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            E  +K +FEVGD++ VKCTSFSSKG+PVM LV+D
Sbjct  904  ETNSKTNFEVGDELQVKCTSFSSKGIPVMCLVDD  937



>emb|CDP02087.1| unnamed protein product [Coffea canephora]
Length=972

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = -3

Query  779  DLSSRN----VKKFKKGKESIADI--VSDYEGEDKNTSKAPRKSQSDLNKDSTVETG-IK  621
            DLSSRN     +   K K    D+   SD E  D+  S  P   Q++ N   T     I 
Sbjct  843  DLSSRNGSSTSRSSLKLKTEAPDLNFRSDDEDTDERHSADPSLLQNNPNDMETDNVANIS  902

Query  620  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  441
            A +LK+GM L AKVHQIRA GLVLDLGGG+RGMYRFE G KR F VG+++ VKC+SFS K
Sbjct  903  ARRLKIGMVLTAKVHQIRARGLVLDLGGGIRGMYRFETGVKRYFGVGEELRVKCSSFSGK  962

Query  440  GVPVMSLVED  411
            G+PVMSL E+
Sbjct  963  GIPVMSLFEE  972



>gb|KJB33814.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=980

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = -3

Query  737  ESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlg  558
            ES++ +  + E   ++  +A    Q+D  K++  +T +   KLKLG K+ AK++QIRA G
Sbjct  873  ESLSQMGGNKEFTSQDEGEANLSDQND--KETGGKTPVTPQKLKLGTKVTAKIYQIRARG  930

Query  557  lvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LVLDLGGG+RGMY+FEP  +R+F VGD++LV+C+SF+SKG+PVMS+V++
Sbjct  931  LVLDLGGGIRGMYKFEPNGEREFTVGDELLVQCSSFTSKGIPVMSMVDE  979



>ref|XP_007031538.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
 gb|EOY02464.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
Length=896

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = -3

Query  725  DIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvld  546
            + +S+ EGE+  +++         +K++  +T +   KLKLG K+ AKV+QIRA GLVLD
Sbjct  799  EFISEDEGENNLSNQK--------DKETDDKTPMTPQKLKLGTKVTAKVYQIRARGLVLD  850

Query  545  lggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LGGG+RGMYRFEP  ++DF VGD++ V+C+SF+SKG+PVMSLV++
Sbjct  851  LGGGIRGMYRFEPNGEKDFNVGDELPVQCSSFTSKGIPVMSLVDE  895



>ref|XP_010940149.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Elaeis guineensis]
Length=989

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 80/129 (62%), Gaps = 12/129 (9%)
 Frame = -3

Query  776  LSSRNVKKFKKGKESIADIVSDYEGEDKNTSKAP-------RKSQSDLNKDSTVETGIKA  618
            +SS N    KK  E       D+ G    T   P        ++ +D+   S   T ++A
Sbjct  865  ISSPNQIPMKKESEP-----KDFCGSKPETDSGPGTLLHALMQNDADVKPKSLGSTSVRA  919

Query  617  NKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKG  438
              LKLG ++IAKV+QIR  GLVL+LGGGLRGMY+FE   +RDFEVG ++ V+C+SFSSKG
Sbjct  920  GSLKLGDRVIAKVYQIRTHGLVLELGGGLRGMYKFEINGRRDFEVGKELHVQCSSFSSKG  979

Query  437  VPVMSLVED  411
            +PV SL+ED
Sbjct  980  IPVFSLLED  988



>ref|XP_006446552.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
 gb|ESR59792.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
Length=973

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            NK + VE  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  893  NKGTRVEAIVSAKNLKLGTKVAAKVYQVRARGLVLDLGGGIRGMYRFENNEKKDFVVGDE  952

Query  473  VLVKCTSFSSKGVPVMSLVE  414
            +LVKC+SF+ KG+PV+SLV+
Sbjct  953  LLVKCSSFTGKGIPVVSLVD  972



>gb|KDO55206.1| hypothetical protein CISIN_1g002054mg [Citrus sinensis]
Length=974

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            NK + VE  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  894  NKGTRVEAIVSAKNLKLGTKVAAKVYQVRARGLVLDLGGGIRGMYRFENNEKKDFVVGDE  953

Query  473  VLVKCTSFSSKGVPVMSLVE  414
            +LVKC+SF+ KG+PV+SLV+
Sbjct  954  LLVKCSSFTGKGIPVVSLVD  973



>ref|XP_006470281.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Citrus sinensis]
Length=974

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            NK +  E  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  894  NKGTRAEAIVSAKNLKLGTKVAAKVYQVRAHGLVLDLGGGIRGMYRFENNEKKDFVVGDE  953

Query  473  VLVKCTSFSSKGVPVMSLVE  414
            +LVKC+SF+ KG+PV+SLV+
Sbjct  954  LLVKCSSFTGKGIPVVSLVD  973



>ref|XP_008796014.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Phoenix dactylifera]
Length=993

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = -3

Query  713  DYEGEDKNTSKAP-------RKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlgl  555
            DY G    T   P        ++ +D    S   T ++A  LKLG ++ AK++QIRA GL
Sbjct  885  DYCGSKPETDSRPGNLLHVLMQNDADEKPKSFGSTSVRAGSLKLGDRVTAKIYQIRAHGL  944

Query  554  vldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            VL+LGGG+RGMY+FE   +RDFEVG ++ V+C+SFSSKG+PV SL+ED
Sbjct  945  VLELGGGVRGMYKFEVNGRRDFEVGKELPVQCSSFSSKGIPVFSLLED  992



>gb|KHG09808.1| Polyribonucleotide nucleotidyltransferase [Gossypium arboreum]
Length=743

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = -3

Query  737  ESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlg  558
            ES++ +  + E   ++  +A    Q+D  K++   T +   KLKLG K+ AK++QIRA G
Sbjct  636  ESLSRMGGNQEFTSQDEDEANLSDQND--KETGGNTPVTPQKLKLGTKVTAKIYQIRARG  693

Query  557  lvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LVLDLGGG+RGMY+FE   +R+F VGD++LV+C+SF+SKG+PV+S+V++
Sbjct  694  LVLDLGGGIRGMYKFESNGEREFTVGDELLVQCSSFTSKGIPVVSMVDE  742



>ref|XP_007031537.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
 gb|EOY02463.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
Length=980

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 79/107 (74%), Gaps = 10/107 (9%)
 Frame = -3

Query  725  DIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvld  546
            + +S+ EGE+  +++         +K++  +T +   KLKLG K+ AKV+QIRA GLVLD
Sbjct  881  EFISEDEGENNLSNQK--------DKETDDKTPMTPQKLKLGTKVTAKVYQIRARGLVLD  932

Query  545  lggglrGMYRFE--PGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LGGG+RGMYRFE  P  ++DF VGD++ V+C+SF+SKG+PVMSLV++
Sbjct  933  LGGGIRGMYRFEMQPNGEKDFNVGDELPVQCSSFTSKGIPVMSLVDE  979



>ref|XP_009121656.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Brassica rapa]
Length=975

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = -3

Query  737  ESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlg  558
            E+ ++IVS  +G      K P + +   + ++     I A KLK+G ++ AKVHQIR  G
Sbjct  870  ENNSNIVSSSKG------KKPSRKEKQSDNEAGESPSISARKLKIGTEMTAKVHQIRTHG  923

Query  557  lvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LVLDLGGG+RGMY+FE   + +FE+GD + VKCTSFSSKG+PVM+LV++
Sbjct  924  LVLDLGGGIRGMYKFEGDEETEFEIGDTLQVKCTSFSSKGIPVMALVDE  972



>ref|XP_004304642.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=969

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  474
            N  S+ E  + A  LKLG K+ AKV+Q+R  GLVLDLGGGLRGMYRFE   K+DF+V D+
Sbjct  888  NDLSSKEDYVTARSLKLGTKVTAKVYQVRTGGLVLDLGGGLRGMYRFEADGKKDFDVNDE  947

Query  473  VLVKCTSFSSKGVPVMSLVED  411
            + V+C SFSSKG+PVMSLV+D
Sbjct  948  LQVECVSFSSKGIPVMSLVDD  968



>emb|CDX69573.1| BnaA10g19220D [Brassica napus]
Length=975

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = -3

Query  737  ESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlg  558
            E+ ++IVS  +G      K P + +   + ++     I A KLK+G +  AKVHQIR  G
Sbjct  870  ENNSNIVSSSKG------KKPSRKEKQSDNEAGESPSISARKLKIGTETTAKVHQIRTHG  923

Query  557  lvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            LVLDLGGG+RGMY+FE   + +FE+GD + VKCTSFSSKG+PVM+LV++
Sbjct  924  LVLDLGGGIRGMYKFEGDEETEFEIGDTLQVKCTSFSSKGIPVMALVDE  972



>ref|XP_008230570.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Prunus mume]
Length=963

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  644  STVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLV  465
            + V + + A  LK+G K+ AKV+QIR  GLVLDLGGG+RGMYRFE   K DFEV D++ V
Sbjct  884  TEVRSPVTAKTLKIGTKVTAKVYQIRTGGLVLDLGGGIRGMYRFETNGKNDFEVDDELRV  943

Query  464  KCTSFSSKGVPVMSLVED  411
             C SFSSKG+PVMSLV+D
Sbjct  944  VCVSFSSKGIPVMSLVDD  961



>ref|XP_008341437.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Malus domestica]
Length=945

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  692  NTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRF  513
            N   +   SQ   +K++ V   +    LK+G K+ AKV+QIR  GLVLDLGGGLRGMYRF
Sbjct  850  NVKTSKSXSQKGGDKEAEVGGSVTEKSLKIGTKVTAKVYQIRTGGLVLDLGGGLRGMYRF  909

Query  512  EPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            E   + DFEV D++ V+C SFS KG+PVMSLV+D
Sbjct  910  ETNGRTDFEVNDELXVECVSFSGKGIPVMSLVDD  943



>ref|XP_003554809.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
Length=959

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            + A  LKLG ++ AKV QIRA GLVLDLGGGLRGMYRFE   KRDF++GD++ V C+SFS
Sbjct  887  VTAEDLKLGTQVTAKVSQIRAHGLVLDLGGGLRGMYRFEENNKRDFKIGDEMRVVCSSFS  946

Query  446  SKGVPVMSLVED  411
            SKG+PV+S V D
Sbjct  947  SKGIPVLSFVND  958



>ref|XP_009131416.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brassica rapa]
Length=963

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -3

Query  683  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  504
            K PRK +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE  
Sbjct  871  KPPRKKKQS-GDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFEGD  929

Query  503  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
             + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  930  EETEFEIGDALQVKCTSFTTKGIPVMALVDD  960



>gb|KHN23516.1| Polyribonucleotide nucleotidyltransferase [Glycine soja]
Length=853

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            + A  LKLG ++ AKV QIRA GLVLDLGGGLRGMYRFE   KRDF++GD++ V C+SFS
Sbjct  781  VTAEDLKLGTQVTAKVSQIRAHGLVLDLGGGLRGMYRFEENNKRDFKIGDEMRVVCSSFS  840

Query  446  SKGVPVMSLVED  411
            SKG+PV+S V D
Sbjct  841  SKGIPVLSFVND  852



>emb|CDX78584.1| BnaA03g04960D [Brassica napus]
Length=964

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -3

Query  683  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  504
            K PRK +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE  
Sbjct  872  KPPRKKKQS-GDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFEGD  930

Query  503  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
             + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  931  EETEFEIGDALQVKCTSFTTKGIPVMALVDD  961



>ref|XP_009380405.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=1048

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  626   IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
             I+A+ LKLG  + AKV+QIRA GLVL+L GG+RGM++FE   +RDFEVG +++V+C+SFS
Sbjct  976   IRADSLKLGDTVTAKVYQIRAHGLVLELNGGIRGMFKFEVNGRRDFEVGKELVVRCSSFS  1035

Query  446   SKGVPVMSLVED  411
             SKG+PV SL++D
Sbjct  1036  SKGIPVFSLLKD  1047



>emb|CDY09870.1| BnaC09g42910D [Brassica napus]
Length=959

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  620  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  441
            A KLK+G ++ AKVHQIR  GLVLDLGGG+RGMY+FE   + +FE+GD + VKCTSFSSK
Sbjct  887  ARKLKIGTEMTAKVHQIRTHGLVLDLGGGIRGMYKFEGDEETEFEIGDTLQVKCTSFSSK  946

Query  440  GVPVMSLVED  411
            G+PVM+LV++
Sbjct  947  GIPVMALVDE  956



>ref|XP_004489245.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cicer arietinum]
Length=976

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  674  RKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR  495
            R+++ D  K+   +T + A  LKLG ++ AKV+QIRA GLVLDLGGG+RGMYR+E   K+
Sbjct  887  RRAEGD-EKEGKNKTPLTAKDLKLGTEVTAKVYQIRAHGLVLDLGGGVRGMYRYEEDGKK  945

Query  494  DFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            DF++GD++ V C+SFSSKG+PV+S V+D
Sbjct  946  DFKIGDEMRVVCSSFSSKGIPVLSAVDD  973



>ref|XP_010033299.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Eucalyptus grandis]
 gb|KCW52909.1| hypothetical protein EUGRSUZ_J02224 [Eucalyptus grandis]
Length=946

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  620  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  441
            A  LKLGM++ AKVH++   GLVLDLG G+RGMYRFE   K D+EVGD + V CTSFSSK
Sbjct  876  AKNLKLGMRVTAKVHKVLGRGLVLDLGNGVRGMYRFEGEGKADYEVGDLLRVVCTSFSSK  935

Query  440  GVPVMSLVED  411
            GVPVMSL++D
Sbjct  936  GVPVMSLLKD  945



>ref|XP_007217697.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
 gb|EMJ18896.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
Length=962

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -3

Query  638  VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKC  459
            V + + A  LK+G K+ AKV+QIR  GLVLDLGGG+RGMYRFE   K DFEV D++ V C
Sbjct  886  VRSPVTAKTLKIGTKVTAKVYQIRTGGLVLDLGGGIRGMYRFETNGKNDFEVDDELRVVC  945

Query  458  TSFSSKGVPVMSLVED  411
             SFSSKG+PVMSL +D
Sbjct  946  VSFSSKGIPVMSLEDD  961



>ref|XP_006579768.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
 gb|KHN27449.1| Polyribonucleotide nucleotidyltransferase [Glycine soja]
Length=348

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = -3

Query  674  RKSQSDLNKDSTVETG----IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP  507
            ++S+SDL +    E G    + A  LKLG ++ AKV QI A GLVLDLGGGLRG+YRFE 
Sbjct  256  KESKSDLQRPKGDEQGPKDKVTAEDLKLGSEVTAKVSQIGAHGLVLDLGGGLRGIYRFEE  315

Query  506  GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
              KR F++GD++ V C+SFSSKGVPV+S V+D
Sbjct  316  NNKRHFKIGDEMRVVCSSFSSKGVPVLSFVDD  347



>ref|XP_009377194.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Pyrus x bretschneideri]
Length=944

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -3

Query  668  SQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDF  489
            SQ   +K++ V   +    LK+G K+ AKV+QIR  GLVLDLGGGLRGMYRFE   + DF
Sbjct  857  SQKGGDKEAEVGGSVTEKSLKIGTKVTAKVYQIRTGGLVLDLGGGLRGMYRFETNGRTDF  916

Query  488  EVGDQVLVKCTSFSSKGVPVMSLVED  411
            EV D++ V+C SFS KG+PVMS V+D
Sbjct  917  EVNDELRVECVSFSVKGIPVMSPVDD  942



>ref|XP_006399970.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
 gb|ESQ41423.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
Length=984

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            I    LK+G +++AKVHQ+R  GLVLDLGGG+RGMY+FE   + +F++GD + VKCTSF+
Sbjct  910  ISPRTLKIGTEMMAKVHQVRTRGLVLDLGGGIRGMYKFEGDEETEFDIGDALKVKCTSFT  969

Query  446  SKGVPVMSLVED  411
            SKG+PVM+LV+D
Sbjct  970  SKGIPVMALVDD  981



>ref|XP_010665719.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=957

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = -3

Query  698  DKNTSKAPRKSQSDLNKDSTVETG--IKANKLKLGMKLIAKVHQIRAlglvldlggglrG  525
            D   S+ P  +   + KD   E G  ++A  LKLG  + AKV QIRA GLVLDLGGGL+G
Sbjct  859  DSACSRQPFSTVKSIRKDKKDEVGFGLRAKDLKLGTMVTAKVFQIRARGLVLDLGGGLKG  918

Query  524  MYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            MYRFE    ++  VGD++ V+C SF++KGVPVMS V+D
Sbjct  919  MYRFEMNDDKEINVGDELRVQCCSFTAKGVPVMSRVKD  956



>ref|XP_008443548.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Cucumis melo]
Length=1026

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -3

Query  668   SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  492
             +Q+D+N +   V+  +  + L++G K+ AKV+QIR  GLVLDLGGGLRGMYRFE     +
Sbjct  940   TQNDVNNNEVEVKDPLTPSNLRIGTKVKAKVYQIRLHGLVLDLGGGLRGMYRFEGDDNSN  999

Query  491   FEVGDQVLVKCTSFSSKGVPVMSLVED  411
             F+VGD++ V+C+SFS +G+PVMSLV++
Sbjct  1000  FKVGDELHVQCSSFSGRGIPVMSLVDN  1026



>gb|KFK25698.1| hypothetical protein AALP_AA8G147400 [Arabis alpina]
Length=998

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = -3

Query  734  SIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlgl  555
            SIA IVSD      + +K P + +      +     +    LK+G ++  KV QIR  GL
Sbjct  886  SIASIVSDSIPVSSSKAKKPSRKEKQSENKAEDSAPVTFQNLKIGTEMTVKVQQIRTHGL  945

Query  554  vldlggglrGMYRFEP--GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            VLDLGGG+RGMYRFEP    K  FE+G+ + VKCTSF++KG+PVM LV++
Sbjct  946  VLDLGGGIRGMYRFEPRDDEKTKFEIGETLQVKCTSFTTKGIPVMVLVDE  995



>ref|XP_002454178.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
 gb|EES07154.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
Length=983

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -3

Query  716  SDYEGEDKNTSKAPRKSQS---DLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvld  546
            S   G   + S  P K+     DLN+  T     ++  +KLG  + AKV+QIRA GLVL+
Sbjct  883  SGSNGLQTSGSDVPEKTADNTLDLNQSPT---NFQSGAMKLGDVVTAKVYQIRAFGLVLE  939

Query  545  lggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            L  G RGM++FE   +++FEVG ++LVKC+SF++KG+PV SL++
Sbjct  940  LSDGARGMHKFEANGQKEFEVGQELLVKCSSFNAKGIPVFSLLD  983



>ref|XP_004141096.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cucumis sativus]
 gb|KGN59689.1| hypothetical protein Csa_3G838680 [Cucumis sativus]
Length=1032

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -3

Query  668   SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  492
             +Q+D+N +   V+  +  + L++G K+ AK++QIR  GLVLDLGGG+RGMYRFE   + +
Sbjct  946   TQNDVNNNEVEVQDPLTPSNLRIGTKVKAKIYQIRLHGLVLDLGGGVRGMYRFEGDNQSN  1005

Query  491   FEVGDQVLVKCTSFSSKGVPVMSLVED  411
             ++VGD++ V+C+SFS +G+PVMSLV +
Sbjct  1006  YKVGDELHVQCSSFSGRGIPVMSLVNN  1032



>ref|XP_004164730.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial-like [Cucumis sativus]
Length=955

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -3

Query  668  SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  492
            +Q+D+N +   V+  +  + L++G K+ AK++QIR  GLVLDLGGG+RGMYRFE   + +
Sbjct  869  TQNDVNNNEVEVQDPLTPSNLRIGTKVKAKIYQIRLHGLVLDLGGGVRGMYRFEGDNQSN  928

Query  491  FEVGDQVLVKCTSFSSKGVPVMSLVED  411
            ++VGD++ V+C+SFS +G+PVMSLV +
Sbjct  929  YKVGDELHVQCSSFSGRGIPVMSLVNN  955



>ref|NP_001047444.1| Os02g0617700 [Oryza sativa Japonica Group]
 dbj|BAF09358.1| Os02g0617700, partial [Oryza sativa Japonica Group]
Length=322

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -3

Query  677  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  498
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  236  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  294

Query  497  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  295  KDFEVGEELLVKCSSFNAKGIPVFSLLD  322



>ref|XP_007151009.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
 gb|ESW23003.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
Length=982

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  620  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  441
            A  L+LG K+ AKV+QIRA GLVLDLG GLRGMYRFE    R+F++GD++ V C+SFSSK
Sbjct  913  AKDLELGTKVTAKVYQIRAHGLVLDLGSGLRGMYRFEENNSRNFKIGDEMRVVCSSFSSK  972

Query  440  GVPVMSL  420
            G+P++S 
Sbjct  973  GIPILSF  979



>gb|EPS73358.1| hypothetical protein M569_01398 [Genlisea aurea]
Length=882

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  614  KLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGV  435
            KLK+G  + ++V Q+R  GLVLDLGGG+RGMYRFE G++R+F +G++V VKC SFS KG+
Sbjct  817  KLKIGTIVTSRVRQVRQHGLVLDLGGGIRGMYRFENGSRREFSIGEEVRVKCCSFSGKGI  876

Query  434  PVMSL  420
            PVMSL
Sbjct  877  PVMSL  881



>ref|NP_001146202.1| uncharacterized protein LOC100279772 [Zea mays]
 gb|ACL53457.1| unknown [Zea mays]
Length=733

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -3

Query  704  GEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrG  525
            G + + S  P +S  + +  +   T  ++  +KLG  + AKV+QIRA GLVL+L  G+RG
Sbjct  637  GLETSGSDVPEQSADNTSDQNQSPTKFQSGAMKLGDVVTAKVYQIRAYGLVLELSDGVRG  696

Query  524  MYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            M++FE    ++FEVG +++VKC+SF++KG+P+ SL++
Sbjct  697  MHKFEANGLKEFEVGQELVVKCSSFNAKGIPLFSLLD  733



>gb|EEC73607.1| hypothetical protein OsI_08089 [Oryza sativa Indica Group]
Length=1030

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -3

Query  677   PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  498
             P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  944   PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  1002

Query  497   RDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
             +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  1003  KDFEVGEELLVKCSSFNAKGIPVFSLLD  1030



>sp|Q6KAI0.1|PNP2_ORYSJ RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
AltName: Full=Polynucleotide phosphorylase 2; Short=PNPase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD21450.1| putative polyribonucleotide nucleotidyltransferase [Oryza sativa 
Japonica Group]
Length=982

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -3

Query  677  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  498
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  896  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  954

Query  497  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  955  KDFEVGEELLVKCSSFNAKGIPVFSLLD  982



>gb|EEE57382.1| hypothetical protein OsJ_07542 [Oryza sativa Japonica Group]
Length=941

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -3

Query  677  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  498
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  855  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  913

Query  497  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  914  KDFEVGEELLVKCSSFNAKGIPVFSLLD  941



>ref|XP_008643478.1| PREDICTED: uncharacterized protein LOC100279772 isoform X1 [Zea 
mays]
 gb|AFW72337.1| hypothetical protein ZEAMMB73_632002 [Zea mays]
Length=980

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -3

Query  704  GEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrG  525
            G + + S  P +S  + +  +   T  ++  +KLG  + AKV+QIRA GLVL+L  G+RG
Sbjct  884  GLETSGSDVPEQSADNTSDQNQSPTKFQSGAMKLGDVVTAKVYQIRAYGLVLELSDGVRG  943

Query  524  MYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            M++FE    ++FEVG +++VKC+SF++KG+P+ SL++
Sbjct  944  MHKFEANGLKEFEVGQELVVKCSSFNAKGIPLFSLLD  980



>ref|XP_010248545.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=991

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 12/123 (10%)
 Frame = -3

Query  776  LSSRNVK-KFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLG  600
             S RNVK +  K K++         G + + + AP   Q +++K++       A  +KL 
Sbjct  879  FSQRNVKSEHAKQKQA---------GTESDRTHAP--VQKNVSKEAVDTARKTAKTIKLS  927

Query  599  MKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSL  420
             K  AKV+QIR  GLVLDLGGG+RGMY+FE   K++++VG+++ V+C+SFS+KG+PVMSL
Sbjct  928  DKFTAKVYQIRVHGLVLDLGGGIRGMYKFEENGKKNYKVGEELRVQCSSFSTKGIPVMSL  987

Query  419  VED  411
            + D
Sbjct  988  LVD  990



>ref|XP_006648841.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=947

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = -3

Query  677  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  498
            P +++S +   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++FE   +
Sbjct  861  PEQNKSSVQNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFEENGR  919

Query  497  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
              FEVG ++LVKC SF+SKG+PV SL++
Sbjct  920  NTFEVGQELLVKCASFNSKGIPVFSLLD  947



>ref|XP_004953116.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Setaria italica]
Length=899

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  701  EDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGM  522
            E   + + P  + S+           ++  +KLG  + AKV+QIRA GLVL+L  G RGM
Sbjct  804  ETSGSEEVPEPTASNTLDLKQTPVNFRSGSMKLGDVVTAKVYQIRAFGLVLELSDGARGM  863

Query  521  YRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  414
            ++FE   + +FEVG ++LVKC SF++KG+PV SL++
Sbjct  864  HKFEANGQMEFEVGQELLVKCASFNAKGIPVFSLLD  899



>dbj|BAJ93434.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  623  KANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSS  444
            ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++ +FEVG++VLVKC +FS+
Sbjct  657  RSGSIKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENSQTNFEVGEEVLVKCATFSA  716

Query  443  KGVPVMSLVE  414
            KGVPV SL++
Sbjct  717  KGVPVFSLLD  726



>ref|XP_010235710.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brachypodium distachyon]
Length=976

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -3

Query  644  STVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLV  465
            S+V    ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++++FE+G+++LV
Sbjct  900  SSVLKNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFVESSRKNFEIGEELLV  959

Query  464  KCTSFSSKGVPVMSLVE  414
            KC SF++KGVPV SL++
Sbjct  960  KCASFNAKGVPVFSLLD  976



>ref|XP_010550151.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010550152.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
Length=960

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 81/123 (66%), Gaps = 5/123 (4%)
 Frame = -3

Query  770  SRNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVE---TGIKANKLKLG  600
            +R VK      +++  I+SD   +   ++KA   SQ D   +S  E   T + A KLK+G
Sbjct  839  NRKVKSASPKDDTLLSILSD--SKLLTSAKAKITSQKDKQSESEAEDRSTSMNAQKLKIG  896

Query  599  MKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSL  420
             ++ AKV Q+R  GLVLDLGGG+RGMY+FE   + DFE+GD + VKCTSF+ KG+PVMSL
Sbjct  897  TEVTAKVSQVRTRGLVLDLGGGIRGMYKFEDEEETDFELGDTMRVKCTSFTGKGIPVMSL  956

Query  419  VED  411
            VE+
Sbjct  957  VEE  959



>emb|CDX70572.1| BnaC03g06560D [Brassica napus]
Length=963

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  689  TSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE  510
            T K P + +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE
Sbjct  868  TLKKPSRKKKQSGDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFE  927

Query  509  PGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
               + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  928  GEEETEFEIGDALQVKCTSFTTKGIPVMALVDD  960



>ref|XP_010108801.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
 gb|EXC20316.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
Length=827

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 59/99 (60%), Gaps = 18/99 (18%)
 Frame = -3

Query  653  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE------------  510
            + ++   T I A  LKLG K+ AKV Q+R  GL+LDLGG +RGMY FE            
Sbjct  728  DSEAETRTTISAKSLKLGTKVTAKVFQVRTNGLILDLGGDIRGMYLFESNEILFNRVAKG  787

Query  509  ------PGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
                     +RDFE GD++ V+CT F+ KGVPVMSLV+D
Sbjct  788  PCVFMQTNGRRDFEEGDELRVQCTRFNRKGVPVMSLVDD  826



>gb|EMS68952.1| Polyribonucleotide nucleotidyltransferase [Triticum urartu]
Length=1374

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  623   KANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSS  444
             ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++ +FEVG++VLVKC +FS+
Sbjct  1305  RSGSIKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFVENSQNNFEVGEEVLVKCDTFSA  1364

Query  443   KGVPVMSLVE  414
             KGVPV S+++
Sbjct  1365  KGVPVFSVLD  1374



>dbj|BAC42539.1| putative polynucleotide phosphorylase [Arabidopsis thaliana]
Length=90

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            +   KLK+G ++ A V  +RALGLVLDLGG +RGMY F+ G K  F+ GD + VKCTSF+
Sbjct  16   VSTRKLKIGTEMTATVDHVRALGLVLDLGGEIRGMYIFQ-GDKDKFKKGDTLRVKCTSFN  74

Query  446  SKGVPVMSLVED  411
            +KGVPVM+LV++
Sbjct  75   TKGVPVMALVDE  86



>ref|XP_010492266.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010492267.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=996

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            +    LK+G +++AKV ++R LGLVLDLGGG+RGMY+FE   + +F+ GD + VKCTSF+
Sbjct  922  VSTRNLKIGTEMMAKVQEVRPLGLVLDLGGGIRGMYKFEDNEETEFKKGDTLQVKCTSFT  981

Query  446  SKGVPVMSLVED  411
            +KGVP M LV++
Sbjct  982  TKGVPEMVLVDE  993



>gb|AES74396.2| polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=973

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            + A  L LG K  AKV QIRA GLVLDLGGG+RGMYRFE   K D +VGD++ V  +SFS
Sbjct  901  LTAKDLPLGTKFKAKVFQIRAHGLVLDLGGGVRGMYRFEGDGKTDLKVGDEMPVVLSSFS  960

Query  446  SKGVPVMSLVED  411
            SKG+PV+  V+D
Sbjct  961  SKGIPVVFPVDD  972



>ref|XP_003618178.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=1106

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -3

Query  626   IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
             + A  L LG K  AKV QIRA GLVLDLGGG+RGMYRFE   K D +VGD++ V  +SFS
Sbjct  1034  LTAKDLPLGTKFKAKVFQIRAHGLVLDLGGGVRGMYRFEGDGKTDLKVGDEMPVVLSSFS  1093

Query  446   SKGVPVMSLVED  411
             SKG+PV+  V+D
Sbjct  1094  SKGIPVVFPVDD  1105



>ref|XP_010420100.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Camelina sativa]
Length=996

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -3

Query  767  RNVKKFKKGKESIADIVSDYEGEDKNTSKAPRKSQSDLNKDSTVETGIKANKLKLGMKLI  588
            R +K       S A IVSD      + +K   + +      +     +   +LK+G +++
Sbjct  875  RKLKPASPKNNSTASIVSDSNLVSSSKAKKSTRKEDQYENKAEESATVSTRELKIGTEMM  934

Query  587  AKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  411
            AKV Q+R LGLVLDLGGG+RGMY+FE   + +FE GD + VKCTSF++KG+P M LV++
Sbjct  935  AKVQQVRPLGLVLDLGGGIRGMYKFEDNEETEFEEGDTLQVKCTSFTTKGIPEMVLVDE  993



>ref|NP_196962.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
 sp|Q9S7G6.1|PNP2_ARATH RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
Short=AtmtPNPase; AltName: Full=Polynucleotide 
phosphorylase 2; Short=PNPase 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43864.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB43865.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB87625.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 gb|AED92050.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
Length=991

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            +   KLK+G ++ A V  +RALGLVLDLGG +RGMY F+ G K  F+ GD + VKCTSF+
Sbjct  917  VSTRKLKIGTEMTATVDHVRALGLVLDLGGEIRGMYIFQ-GDKDKFKKGDTLRVKCTSFN  975

Query  446  SKGVPVMSLVED  411
            +KGVPVM+LV++
Sbjct  976  TKGVPVMALVDE  987



>ref|XP_006289585.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
 gb|EOA22483.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
Length=944

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR-DFEVGDQVLVKCTSF  450
            +   KLK+G +++AKV Q R LGLVLDLGGG+RGMY+FE G K   F++GD + VKCTSF
Sbjct  869  VSTRKLKIGTEMMAKVVQTRELGLVLDLGGGIRGMYKFEAGDKEAQFKIGDTLQVKCTSF  928

Query  449  SSKGVPVMSLVE  414
            ++KG+ VM+ V+
Sbjct  929  TTKGIAVMASVD  940



>ref|XP_002873678.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49937.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            +    LK+G ++ AKVH+IRA GLVLDLGG LRGMY+F+   + +FE GD + VKCTSFS
Sbjct  917  VSTRNLKIGTEMTAKVHEIRARGLVLDLGGELRGMYKFKEDEETEFEEGDTLQVKCTSFS  976

Query  446  SKGVPVMSLVED  411
            +KG+PVM+LV++
Sbjct  977  TKGIPVMALVDE  988



>ref|XP_010453582.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Camelina sativa]
Length=993

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  626  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  447
            +   KLK+G +++AKV ++R LGLVLDLGGG+RGMY+FE   + +FE GD + VKCTSF+
Sbjct  919  VSTRKLKIGTEMMAKVQEVRPLGLVLDLGGGIRGMYKFEDNEETEFEEGDTLQVKCTSFT  978

Query  446  SKGVPVMSLVED  411
            +KGVP M LV++
Sbjct  979  TKGVPKMVLVDE  990



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360