BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014M05

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    242   5e-74   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    240   3e-73   Nicotiana tomentosiformis
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    233   1e-70   Sesamum indicum [beniseed]
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    233   1e-70   Solanum lycopersicum
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    233   2e-70   Solanum tuberosum [potatoes]
emb|CDP04798.1|  unnamed protein product                                232   4e-70   Coffea canephora [robusta coffee]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    231   3e-69   Sesamum indicum [beniseed]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               228   3e-69   Erythranthe guttata [common monkey flower]
ref|XP_002515557.1|  conserved hypothetical protein                     228   8e-69   
ref|XP_010106829.1|  hypothetical protein L484_006602                   223   1e-68   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         226   3e-68   Jatropha curcas
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    225   1e-67   Cucumis sativus [cucumbers]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             224   2e-67   
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    224   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    224   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    226   3e-67   
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             224   4e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    224   4e-67   Camelina sativa [gold-of-pleasure]
dbj|BAH57107.1|  AT5G25460                                              216   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    221   3e-66   Populus euphratica
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             221   3e-66   Capsella rubella
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    221   6e-66   Populus euphratica
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             221   6e-66   
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    221   7e-66   Tarenaya hassleriana [spider flower]
gb|AAM63507.1|  unknown                                                 220   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196703.1|  uncharacterized protein                               220   8e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29602.1|  Allergen Act d 3                                        220   9e-66   Gossypium arboreum [tree cotton]
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             221   1e-65   
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    220   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    220   1e-65   Populus euphratica
ref|XP_010110340.1|  GTP-binding nuclear protein                        225   1e-65   
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    220   1e-65   Fragaria vesca subsp. vesca
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    219   1e-65   Tarenaya hassleriana [spider flower]
dbj|BAD93856.1|  hypothetical protein                                   215   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    218   1e-65   Eucalyptus grandis [rose gum]
gb|KJB80694.1|  hypothetical protein B456_013G110800                    218   2e-65   Gossypium raimondii
gb|AAN31807.1|  unknown protein                                         219   3e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85713.1|  BnaA02g01000D                                          219   3e-65   
gb|KJB80693.1|  hypothetical protein B456_013G110800                    219   3e-65   Gossypium raimondii
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    219   3e-65   Brassica rapa
gb|ABK94923.1|  unknown                                                 219   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             219   3e-65   Capsella rubella
emb|CDX91217.1|  BnaC02g03800D                                          218   5e-65   
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    218   7e-65   Citrus sinensis [apfelsine]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    218   7e-65   Brassica rapa
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             219   7e-65   
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    217   7e-65   
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    218   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    218   8e-65   Camelina sativa [gold-of-pleasure]
gb|KJB07801.1|  hypothetical protein B456_001G045200                    218   8e-65   Gossypium raimondii
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    218   8e-65   Camelina sativa [gold-of-pleasure]
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    218   8e-65   Arabis alpina [alpine rockcress]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    218   8e-65   Tarenaya hassleriana [spider flower]
gb|KJB07802.1|  hypothetical protein B456_001G045200                    218   8e-65   Gossypium raimondii
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    218   8e-65   Arabis alpina [alpine rockcress]
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               218   1e-64   Gossypium arboreum [tree cotton]
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             217   1e-64   Citrus clementina [clementine]
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    217   2e-64   
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             217   2e-64   Prunus persica
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  217   2e-64   Theobroma cacao [chocolate]
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    217   2e-64   Prunus mume [ume]
emb|CDY19801.1|  BnaA09g04540D                                          217   2e-64   Brassica napus [oilseed rape]
emb|CAA22573.1|  putative protein                                       215   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             215   3e-64   
emb|CAA06490.1|  hypothetical protein                                   210   3e-64   Cicer arietinum [garbanzo]
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             216   3e-64   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     216   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    216   3e-64   Vitis vinifera
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             216   4e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    216   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    216   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  217   6e-64   
gb|AAL06839.1|  AT5g25460/F18G18_200                                    216   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             215   7e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             214   2e-63   Eutrema salsugineum [saltwater cress]
dbj|BAE98407.1|  hypothetical protein                                   214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    214   2e-63   Glycine max [soybeans]
ref|NP_567894.1|  uncharacterized protein                               214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    214   2e-63   Brassica rapa
gb|AAM61720.1|  unknown                                                 214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    214   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    214   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    214   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             214   3e-63   Phaseolus vulgaris [French bean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    213   3e-63   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     213   4e-63   Glycine soja [wild soybean]
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  212   4e-63   
emb|CDX68849.1|  BnaC01g06040D                                          213   4e-63   
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    213   6e-63   Nicotiana sylvestris
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    213   9e-63   Solanum lycopersicum
emb|CDX80516.1|  BnaC07g29280D                                          211   9e-63   
emb|CDY54909.1|  BnaC02g48660D                                          211   1e-62   Brassica napus [oilseed rape]
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    212   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    212   1e-62   Brassica rapa
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          211   1e-62   
gb|ACJ84308.1|  unknown                                                 212   1e-62   Medicago truncatula
gb|AES58962.2|  plant/F18G18-200 protein                                212   1e-62   Medicago truncatula
emb|CDX97108.1|  BnaC09g45170D                                          212   2e-62   
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    212   2e-62   Brassica rapa
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    212   2e-62   
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    211   2e-62   Nicotiana tomentosiformis
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    211   3e-62   Nicotiana tomentosiformis
gb|EPS73289.1|  hypothetical protein M569_01466                         210   6e-62   Genlisea aurea
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    210   9e-62   Solanum lycopersicum
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    210   9e-62   Cicer arietinum [garbanzo]
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    210   1e-61   Solanum tuberosum [potatoes]
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    209   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB41813.1|  unknown protein                                         209   2e-61   Medicago sativa [alfalfa]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    209   3e-61   Glycine max [soybeans]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     208   3e-61   Glycine soja [wild soybean]
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    208   6e-61   Nicotiana sylvestris
emb|CDX69757.1|  BnaA10g21060D                                          217   4e-60   
gb|AFK48067.1|  unknown                                                 200   5e-60   Lotus japonicus
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            202   1e-59   Phaseolus vulgaris [French bean]
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    204   1e-59   Eucalyptus grandis [rose gum]
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   201   3e-59   Citrus sinensis [apfelsine]
gb|AGV54541.1|  hypothetical protein                                    203   4e-59   Phaseolus vulgaris [French bean]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    203   4e-59   Cicer arietinum [garbanzo]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  202   7e-59   Medicago truncatula
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    202   8e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    202   8e-59   
gb|KHG21629.1|  GTPase Der                                              200   1e-58   Gossypium arboreum [tree cotton]
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    201   2e-58   Vitis vinifera
emb|CBI36253.3|  unnamed protein product                                202   2e-58   Vitis vinifera
gb|KHN07098.1|  hypothetical protein glysoja_023281                     200   2e-58   Glycine soja [wild soybean]
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             201   2e-58   Citrus clementina [clementine]
gb|KJB70569.1|  hypothetical protein B456_011G080100                    200   3e-58   Gossypium raimondii
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    201   3e-58   Elaeis guineensis
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    201   4e-58   
gb|KHG06895.1|  Agmatine deiminase                                      201   4e-58   Gossypium arboreum [tree cotton]
gb|KJB70568.1|  hypothetical protein B456_011G080100                    200   5e-58   Gossypium raimondii
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    200   7e-58   
gb|KHN44154.1|  hypothetical protein glysoja_031815                     200   8e-58   Glycine soja [wild soybean]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    199   1e-57   Nicotiana tomentosiformis
gb|KHN07099.1|  hypothetical protein glysoja_023282                     199   1e-57   Glycine soja [wild soybean]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    199   1e-57   
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 199   2e-57   Theobroma cacao [chocolate]
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             196   3e-57   
gb|KHG10708.1|  Allergen Act d 3                                        198   4e-57   Gossypium arboreum [tree cotton]
ref|XP_002517567.1|  conserved hypothetical protein                     197   6e-57   Ricinus communis
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    197   8e-57   Solanum lycopersicum
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    197   8e-57   Elaeis guineensis
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    197   1e-56   Phoenix dactylifera
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    196   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    197   1e-56   Phoenix dactylifera
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             196   1e-56   Prunus persica
gb|KJB68131.1|  hypothetical protein B456_010G227400                    196   1e-56   Gossypium raimondii
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   3e-56   Sesamum indicum [beniseed]
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    196   3e-56   Nicotiana sylvestris
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    195   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    195   5e-56   Populus euphratica
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             194   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             194   1e-55   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    194   2e-55   Populus euphratica
gb|KJB70570.1|  hypothetical protein B456_011G080200                    187   4e-55   Gossypium raimondii
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    192   4e-55   Cucumis sativus [cucumbers]
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     192   4e-55   Glycine max [soybeans]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    194   5e-55   Prunus mume [ume]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    192   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    192   6e-55   Malus domestica [apple tree]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    192   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    192   7e-55   Fragaria vesca subsp. vesca
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         192   7e-55   Jatropha curcas
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    192   7e-55   Malus domestica [apple tree]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                191   2e-54   Erythranthe guttata [common monkey flower]
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       189   2e-54   Triticum urartu
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    190   4e-54   Tarenaya hassleriana [spider flower]
dbj|BAK03126.1|  predicted protein                                      190   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002517797.1|  conserved hypothetical protein                     189   8e-54   Ricinus communis
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    189   1e-53   Eucalyptus grandis [rose gum]
ref|XP_007052493.1|  F17A17.37 protein                                  189   1e-53   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         188   1e-53   Jatropha curcas
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                189   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    189   2e-53   Prunus mume [ume]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             188   2e-53   Prunus persica
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    187   2e-53   Fragaria vesca subsp. vesca
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              188   2e-53   Gossypium arboreum [tree cotton]
gb|EMT16005.1|  hypothetical protein F775_13621                         187   3e-53   
gb|KJB24990.1|  hypothetical protein B456_004G171200                    188   3e-53   Gossypium raimondii
gb|ABF99456.1|  expressed protein                                       186   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             187   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    187   5e-53   Fragaria vesca subsp. vesca
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    187   6e-53   Pyrus x bretschneideri [bai li]
emb|CDO98108.1|  unnamed protein product                                187   7e-53   Coffea canephora [robusta coffee]
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    187   7e-53   Populus euphratica
gb|KJB24991.1|  hypothetical protein B456_004G171200                    188   7e-53   Gossypium raimondii
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    186   7e-53   Populus euphratica
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    187   8e-53   Brachypodium distachyon [annual false brome]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    186   1e-52   Eucalyptus grandis [rose gum]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    186   1e-52   Prunus mume [ume]
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             186   1e-52   
ref|XP_010088264.1|  hypothetical protein L484_005140                   186   2e-52   Morus notabilis
gb|EAY92272.1|  hypothetical protein OsI_13995                          185   2e-52   Oryza sativa Indica Group [Indian rice]
emb|CDO98109.1|  unnamed protein product                                184   2e-52   Coffea canephora [robusta coffee]
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    185   3e-52   Malus domestica [apple tree]
dbj|BAD16016.1|  unknown protein                                        183   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|KHG21630.1|  Adenosylhomocysteinase                                  185   4e-52   Gossypium arboreum [tree cotton]
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    185   4e-52   Cucumis melo [Oriental melon]
gb|AFK44456.1|  unknown                                                 179   5e-52   Lotus japonicus
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          184   5e-52   
ref|NP_001051644.1|  Os03g0807700                                       185   6e-52   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          184   7e-52   Sorghum bicolor [broomcorn]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    184   9e-52   Tarenaya hassleriana [spider flower]
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    184   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    183   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE56530.1|  hypothetical protein OsJ_05823                          184   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    183   1e-51   Vitis vinifera
gb|EMT25156.1|  hypothetical protein F775_26385                         184   1e-51   
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    183   2e-51   
dbj|BAJ89665.1|  predicted protein                                      184   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046247.2|  Os02g0205200                                       183   2e-51   
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    182   2e-51   
gb|EEC72709.1|  hypothetical protein OsI_06304                          183   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    182   4e-51   Citrus sinensis [apfelsine]
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    182   4e-51   Populus euphratica
gb|KJB36028.1|  hypothetical protein B456_006G137000                    182   6e-51   Gossypium raimondii
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     182   7e-51   
gb|KHG07966.1|  Imidazolonepropionase                                   181   8e-51   Gossypium arboreum [tree cotton]
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    182   8e-51   Setaria italica
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    181   9e-51   Arabis alpina [alpine rockcress]
gb|KJB19256.1|  hypothetical protein B456_003G091800                    179   9e-51   Gossypium raimondii
gb|AGV54808.1|  hypothetical protein                                    181   1e-50   Phaseolus vulgaris [French bean]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             181   1e-50   Phaseolus vulgaris [French bean]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    181   1e-50   Setaria italica
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              181   2e-50   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    181   2e-50   Nelumbo nucifera [Indian lotus]
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     181   2e-50   Glycine max [soybeans]
gb|KJB19257.1|  hypothetical protein B456_003G091800                    179   2e-50   Gossypium raimondii
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    180   2e-50   
gb|AFK39148.1|  unknown                                                 180   3e-50   Lotus japonicus
gb|AFK34548.1|  unknown                                                 179   4e-50   Lotus japonicus
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    179   4e-50   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    179   5e-50   Eucalyptus grandis [rose gum]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                177   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  179   5e-50   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          179   6e-50   Amborella trichopoda
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         179   7e-50   Jatropha curcas
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    179   8e-50   Nelumbo nucifera [Indian lotus]
gb|KHN45084.1|  hypothetical protein glysoja_040000                     179   9e-50   Glycine soja [wild soybean]
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     178   9e-50   Glycine max [soybeans]
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    178   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             178   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             178   1e-49   Populus trichocarpa [western balsam poplar]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               178   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    178   1e-49   Glycine max [soybeans]
gb|KHN11697.1|  hypothetical protein glysoja_006150                     178   2e-49   Glycine soja [wild soybean]
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             177   2e-49   
gb|ACL52831.1|  unknown                                                 171   2e-49   Zea mays [maize]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             177   2e-49   Citrus clementina [clementine]
ref|XP_007028767.1|  F17A17.37 protein                                  177   3e-49   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    177   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    177   4e-49   Populus euphratica
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             177   4e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             177   5e-49   Capsella rubella
emb|CDP07813.1|  unnamed protein product                                176   7e-49   Coffea canephora [robusta coffee]
gb|AES87990.2|  DUF642 family protein                                   176   7e-49   Medicago truncatula
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  176   8e-49   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    176   9e-49   Vitis vinifera
ref|XP_002532070.1|  conserved hypothetical protein                     176   1e-48   Ricinus communis
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    176   1e-48   Cicer arietinum [garbanzo]
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    176   1e-48   Populus euphratica
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    179   1e-48   
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    175   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    175   2e-48   Citrus sinensis [apfelsine]
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             175   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    175   3e-48   Camelina sativa [gold-of-pleasure]
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   175   3e-48   Citrus sinensis [apfelsine]
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    175   3e-48   Nicotiana sylvestris
gb|KHN32410.1|  hypothetical protein glysoja_026304                     173   3e-48   Glycine soja [wild soybean]
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          174   3e-48   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             174   4e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    174   4e-48   Camelina sativa [gold-of-pleasure]
gb|AFK39561.1|  unknown                                                 174   4e-48   Medicago truncatula
gb|KEH17090.1|  DUF642 family protein                                   174   5e-48   Medicago truncatula
ref|NP_001140426.1|  hypothetical protein precursor                     174   5e-48   Zea mays [maize]
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             173   8e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    173   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    173   1e-47   Populus euphratica
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    173   1e-47   Solanum tuberosum [potatoes]
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    172   1e-47   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    172   2e-47   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    172   2e-47   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    172   2e-47   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    172   3e-47   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    173   3e-47   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    172   3e-47   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    172   3e-47   
emb|CDY54317.1|  BnaC06g43150D                                          172   4e-47   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             171   5e-47   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             171   6e-47   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    171   8e-47   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    171   9e-47   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  171   1e-46   
emb|CDY57694.1|  BnaA07g38340D                                          171   1e-46   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     175   1e-46   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             170   2e-46   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    170   2e-46   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    170   2e-46   
emb|CDX79912.1|  BnaA05g02440D                                          171   2e-46   
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    170   3e-46   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                169   3e-46   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             169   3e-46   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    169   3e-46   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    169   3e-46   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    169   4e-46   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             169   4e-46   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    169   6e-46   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    168   6e-46   
dbj|BAD52536.1|  unknown protein                                        167   6e-46   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             167   6e-46   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    169   6e-46   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    168   7e-46   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    168   8e-46   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    168   1e-45   
emb|CDY48765.1|  BnaC04g02180D                                          169   1e-45   
ref|NP_974254.1|  germination-related protein                           166   1e-45   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    168   1e-45   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             167   1e-45   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    167   1e-45   
ref|NP_181712.1|  uncharacterized protein                               167   1e-45   
gb|EPS66311.1|  hypothetical protein M569_08463                         167   1e-45   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    167   2e-45   
ref|NP_181711.1|  uncharacterized protein                               167   2e-45   
emb|CDX79913.1|  BnaA05g02430D                                          162   2e-45   
gb|EAY74932.1|  hypothetical protein OsI_02826                          167   2e-45   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    167   3e-45   
emb|CDY28002.1|  BnaC05g44040D                                          166   4e-45   
ref|NP_566328.1|  germination-related protein                           166   4e-45   
emb|CDY14785.1|  BnaC04g47820D                                          166   4e-45   
dbj|BAB21293.1|  unknown protein                                        166   4e-45   
ref|NP_001043549.2|  Os01g0611000                                       166   6e-45   
emb|CDY48764.1|  BnaC04g02170D                                          161   6e-45   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             166   7e-45   
ref|XP_010097437.1|  hypothetical protein L484_003208                   165   1e-44   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    165   1e-44   
emb|CDY22149.1|  BnaC01g39520D                                          165   1e-44   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    165   1e-44   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             164   3e-44   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                164   3e-44   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    163   8e-44   
ref|XP_010541767.1|  PREDICTED: uncharacterized protein LOC104815148    155   8e-44   
emb|CDY06908.1|  BnaA04g24070D                                          163   8e-44   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    163   9e-44   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    162   1e-43   
dbj|BAK03627.1|  predicted protein                                      162   2e-43   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    162   2e-43   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    161   3e-43   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             161   3e-43   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             161   3e-43   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    161   4e-43   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    161   6e-43   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          160   7e-43   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    160   9e-43   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            160   9e-43   
gb|EMT06486.1|  hypothetical protein F775_26416                         159   2e-42   
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    156   8e-42   
emb|CDP21696.1|  unnamed protein product                                155   6e-41   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    154   1e-40   
ref|XP_006845338.1|  hypothetical protein AMTR_s00141p00087190          148   3e-40   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    153   3e-40   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    153   5e-40   
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              147   1e-39   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    151   2e-39   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    151   2e-39   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    151   3e-39   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    150   3e-39   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    149   8e-39   
gb|EEC81716.1|  hypothetical protein OsI_25327                          150   9e-39   
gb|AGV54847.1|  hypothetical protein                                    148   5e-38   
gb|ACG40327.1|  hypothetical protein                                    147   6e-38   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             147   6e-38   
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         147   6e-38   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    147   1e-37   
ref|NP_001145978.1|  hypothetical protein                               147   1e-37   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  145   1e-37   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    145   3e-37   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    145   3e-37   
emb|CAE01677.2|  OSJNBb0091E11.19                                       145   5e-37   
emb|CAH67378.1|  OSIGBa0159F11.2                                        145   5e-37   
gb|AGV54803.1|  hypothetical protein                                    145   6e-37   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    145   6e-37   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    145   8e-37   
gb|EMT04285.1|  hypothetical protein F775_14657                         144   1e-36   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    145   2e-36   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    144   2e-36   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    143   3e-36   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    143   3e-36   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    143   3e-36   
gb|AFK48735.1|  unknown                                                 143   3e-36   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       142   5e-36   
gb|KCW59326.1|  hypothetical protein EUGRSUZ_H02015                     136   5e-36   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    142   7e-36   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    142   8e-36   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              142   8e-36   
gb|EAY94676.1|  hypothetical protein OsI_16455                          142   9e-36   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    142   1e-35   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     141   1e-35   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    141   1e-35   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    141   1e-35   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                140   3e-35   
emb|CAH67292.1|  OSIGBa0103O01.10                                       140   3e-35   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    140   4e-35   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  139   5e-35   
gb|KHN33140.1|  La-related protein 7                                    143   6e-35   
emb|CAE01676.2|  OSJNBb0091E11.17                                       139   8e-35   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             139   8e-35   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    139   8e-35   
ref|XP_002893594.1|  predicted protein                                  139   8e-35   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    139   8e-35   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    139   9e-35   
gb|KHG06200.1|  Periplasmic nitrate reductase                           139   9e-35   
ref|NP_001053189.1|  Os04g0494800                                       139   9e-35   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    139   9e-35   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    139   1e-34   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    139   1e-34   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             139   1e-34   
gb|KJB69807.1|  hypothetical protein B456_011G043300                    139   1e-34   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              139   1e-34   
gb|KHG28355.1|  putative metabolite transport                           139   2e-34   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    138   2e-34   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             138   2e-34   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             138   2e-34   
emb|CDP19178.1|  unnamed protein product                                138   2e-34   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    138   2e-34   
gb|ACN30906.1|  unknown                                                 138   2e-34   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    138   2e-34   
gb|ACF86181.1|  unknown                                                 138   2e-34   
ref|NP_973938.1|  uncharacterized protein                               137   3e-34   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    137   3e-34   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    137   3e-34   
dbj|BAD87481.1|  unknown protein                                        134   4e-34   
ref|XP_002519690.1|  conserved hypothetical protein                     137   4e-34   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 138   4e-34   
ref|NP_001143445.1|  uncharacterized protein LOC100276100               135   4e-34   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         137   4e-34   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  137   5e-34   
ref|NP_564344.1|  uncharacterized protein                               137   5e-34   
gb|EPS66859.1|  hypothetical protein M569_07917                         137   5e-34   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    137   6e-34   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    137   6e-34   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    137   6e-34   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    137   7e-34   
emb|CDX84311.1|  BnaC04g10730D                                          137   7e-34   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    137   8e-34   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              137   8e-34   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    136   8e-34   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    136   8e-34   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             136   9e-34   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          136   1e-33   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          136   1e-33   
ref|XP_010110985.1|  hypothetical protein L484_021680                   137   1e-33   
emb|CBI30867.3|  unnamed protein product                                136   1e-33   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    136   1e-33   
gb|ACJ84883.1|  unknown                                                 132   1e-33   
emb|CDY17255.1|  BnaA05g09330D                                          136   2e-33   
gb|AFK49395.1|  unknown                                                 135   2e-33   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    135   2e-33   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             135   2e-33   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    135   2e-33   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    136   3e-33   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    135   3e-33   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    135   3e-33   
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    134   3e-33   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    135   3e-33   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    135   3e-33   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                135   4e-33   
ref|NP_001141282.1|  hypothetical protein precursor                     134   4e-33   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    135   4e-33   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    134   4e-33   
gb|EEC70811.1|  hypothetical protein OsI_02272                          135   4e-33   
ref|NP_180998.1|  uncharacterized protein                               134   5e-33   
ref|NP_001044289.1|  Os01g0756600                                       134   5e-33   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    134   5e-33   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             134   7e-33   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             134   7e-33   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    134   7e-33   
ref|NP_001053188.1|  Os04g0494600                                       133   9e-33   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    133   9e-33   
gb|EEC71507.1|  hypothetical protein OsI_03789                          134   1e-32   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    133   1e-32   
emb|CAH67377.1|  OSIGBa0159F11.1                                        133   1e-32   
emb|CAD41548.2|  OSJNBb0091E11.18                                       133   1e-32   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          133   1e-32   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    133   1e-32   
ref|NP_001053190.1|  Os04g0494900                                       133   1e-32   
emb|CDY26302.1|  BnaA09g26530D                                          133   2e-32   
emb|CDX99870.1|  BnaC05g22920D                                          133   2e-32   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    133   2e-32   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    133   2e-32   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    132   2e-32   
ref|NP_001143645.1|  hypothetical protein precursor                     133   2e-32   
gb|ACG32132.1|  hypothetical protein                                    132   2e-32   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          132   2e-32   
gb|EEE54731.1|  hypothetical protein OsJ_02078                          134   2e-32   
ref|NP_001043243.2|  Os01g0531400                                       134   3e-32   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    132   3e-32   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          132   3e-32   
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    132   5e-32   
emb|CDM84231.1|  unnamed protein product                                131   5e-32   
gb|EMT04284.1|  hypothetical protein F775_14656                         130   6e-32   



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D++HFSVP G+RA+ELVAGKESAIAQ+ RT +GK+Y+L+F VGDASNS
Sbjct  233  WMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG  TLKVPYESKGKGG+K A LRFKATANRTRIMF STYYHTRSDDFVS
Sbjct  293  CEGSMIVEAFAGMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSVR+P
Sbjct  353  LCGPVVDDVKLLSVRNP  369



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D++HFSVP G+RA+ELVAGKESAIAQ+ RT +GK+Y+L+F VGDASNS
Sbjct  233  WMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPYESKGKGGFK A LRFKA ANRTRIMF STYYHTRSDD+VS
Sbjct  293  CEGSMIVEAFAGRDTLKVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSVR+P
Sbjct  353  LCGPVVDDVKLLSVRNP  369



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYIDA HFSVPHG+RA+ELV GKESAIAQ+ RTI+GK Y+LTF +GDASNS
Sbjct  229  WIVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGG+K A LRF ATA RTRIMFFSTYYH RSDDF S
Sbjct  289  CEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFAS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSV  P
Sbjct  349  LCGPVVDDVKLLSVHKP  365



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D++HFSVPHG+RA+ELVAGKESAIAQ+ RT +GK+Y L+F VGDASN+
Sbjct  231  WMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPYES GKGG+K A LRFKATA+RTRIMF STYYHTRSDDFVS
Sbjct  291  CEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V LLSVR
Sbjct  351  LCGPVVDDVTLLSVR  365



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D++HFSVPHG+RA+ELVAGKESAIAQ+ RT +GK+Y L+F VGDASN+
Sbjct  231  WMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPYES GKGG+K A LRFKATA+RTRIMF STYYHTRSDDFVS
Sbjct  291  CEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V LLSVR
Sbjct  351  LCGPVVDDVTLLSVR  365



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDA HFSVPH  RAVELVAGKESAIAQ+ RTI+GK Y LTFLVGDASNS
Sbjct  231  WMIESLKAVKYIDAAHFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNS  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEA+AG  T+K+PY S+GKGG+KPA L F AT NRTRIMFFSTYYHTRSDD  S
Sbjct  291  CEGSMIVEAYAGIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNAS  350

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPV+D V+LLSVR+P  L
Sbjct  351  LCGPVIDDVKLLSVRNPRKL  370



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYIDA HFSVPHG+RA+ELV GKESAIAQ+ RTIVGK Y LTF VGDASNS
Sbjct  265  WMVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASNS  324

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGG+K A LRF AT  RTRIMF ST+YH RSDD+ S
Sbjct  325  CEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDYAS  384

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPVVD V+LLSVR P  L
Sbjct  385  LCGPVVDDVKLLSVRKPRRL  404



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID  HFSVPHG RA+ELV GKESAIAQ+ RTI GK Y LTF VGDASNS
Sbjct  196  WMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDASNS  255

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYES+GKGG+K A LRF A  NRTRIMF STYYH RSDD+ S
Sbjct  256  CEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDYAS  315

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPVVD V+LLSVR+P  L
Sbjct  316  LCGPVVDDVKLLSVRNPRKL  335



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID +HFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDASNS
Sbjct  228  WMVESLKAVKYIDVDHFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNS  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A LRF A ANRTRIMF+ST+Y  RSDDF S
Sbjct  288  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  348  LCGPVLDDVKLLSVRKP  364



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVPHG+RAVELVAGKESAIAQ+ RTIVGK Y LTF VGDASNS
Sbjct  80   WMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNS  139

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG++T+KVPYESKGKGGFK   L F AT  RTRIMF ST+Y  RSDDF S
Sbjct  140  CEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSS  199

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D ++LLSVR P
Sbjct  200  LCGPVLDDIKLLSVRKP  216



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP  RRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDASNS
Sbjct  228  WMIESLKAVKYIDSDHFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNS  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A LRF A +NRTRIMF+ST+Y  RSDDF S
Sbjct  288  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFSS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  348  LCGPVIDDVKLLSVRKP  364



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQI RTI GK Y L+F+VGDASNS
Sbjct  230  WMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG++TLKVPY+SKG GG KPA L+FKA + RTRIMF ST+Y  RSDDF S
Sbjct  290  CEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRLLSVR+P
Sbjct  350  LCGPVLDKVRLLSVRNP  366



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  204  WMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  263

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTR+MF+ST+Y  RSDDF S
Sbjct  264  CQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSS  323

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  324  LCGPVIDDVKLLSVRKP  340



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  231  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTRIMF+ST+Y  RSDDF S
Sbjct  291  CQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  351  LCGPVIDDVKLLSVRKP  367



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  231  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTRIMF+ST+Y  RSDDF S
Sbjct  291  CQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  351  LCGPVIDDVKLLSVRKP  367



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQI RTI GK Y L+F+VGDASNS
Sbjct  284  WMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNS  343

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG++TLKVPY+SKG GG KPA L+FKA + RTRIMF ST+Y  RSDDF S
Sbjct  344  CEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSS  403

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRLLSVR+P
Sbjct  404  LCGPVLDKVRLLSVRNP  420



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  230  WMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTR+MF+ST+Y  RSDDF S
Sbjct  290  CQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  350  LCGPVIDDVKLLSVRKP  366



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  231  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTRIMF+ST+Y  RSDDF S
Sbjct  291  CQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  351  LCGPVIDDVKLLSVRKP  367



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  50   WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNA  109

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYESKG GGFK A +RF A + R+RIMF+ST+Y  RSDDF S
Sbjct  110  CKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSS  169

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  170  LCGPVIDDVKLISVRKP  186



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVK+ID EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDASNS
Sbjct  207  WMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNS  266

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A L+F A ++RTR+MF+ST+Y  RSDDF S
Sbjct  267  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSS  326

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+LLS+R
Sbjct  327  LCGPVVDDVKLLSLR  341



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  231  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A +RF A +NRTRIMF+ST+Y  RSDDF S
Sbjct  291  CQGSMVVEAFAGRDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LL VR P
Sbjct  351  LCGPVIDDVKLLGVRKP  367



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVK+ID EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A L+F A ++RTR+MF+ST+Y  RSDDF S
Sbjct  289  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+LLS+R
Sbjct  349  LCGPVVDDVKLLSLR  363



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  230  WMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKVPYES+GKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CQGSMIVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  350  LCGPVIDDVKLLSARKP  366



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  229  WMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ T+KVPYES+G GGFK A LRF A ++RTRIMF+ST+Y  RSDDF S
Sbjct  289  CKGSMIVEAFAGRDTIKVPYESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSVR P
Sbjct  349  LCGPVVDDVKLLSVRKP  365



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  230  WMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  350  LCGPVIDDVKLLSARKP  366



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  230  WMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  350  LCGPVIDDVKLLSARKP  366



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ VP GRRAVELV GKESAIAQITRTIVGK Y L+F VGDA+NS
Sbjct  233  WVVESLKAVKYIDSAHYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG++TLKVPYESKG GGFK A LRF A +NRTRIMF ST+Y  RSDDF S
Sbjct  293  CAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R+P
Sbjct  353  LCGPVVDDVKLLSIRNP  369



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID EHFSVP GRRAVELVAGKESAIAQ+ RT++GK Y L+F VGDASNS
Sbjct  262  WMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNS  321

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A L+F A + RTRIMF+ST+Y  RSDDF S
Sbjct  322  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSS  381

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D ++LLS+R
Sbjct  382  LCGPVIDDIKLLSLR  396



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHFSVP GRRAVELVAGKESAIAQI RTI GK+Y LTF VGDA+N 
Sbjct  231  WMIESLKAVKYIDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANNK  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFA ++T+KVPYESKG GGFK A LRF A + RTRIMF ST+Y  RSDD  S
Sbjct  291  CEGSMVVEAFADRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMAS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R+P
Sbjct  351  LCGPVVDDVKLLSIRNP  367



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID EHFSVP GRRAVELVAGKES IAQ+ RT++GK Y L+F VGDASNS
Sbjct  230  WMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ TLKVPYESKGKGGFK A L+F A + RTRIMF+ST+Y  RSDDF S
Sbjct  290  CEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D ++LLS+R
Sbjct  350  LCGPVIDDIKLLSLR  364



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVPHG+RAVELVAGKESAIAQ+ RTIVGK Y LTF VGDASNS
Sbjct  227  WMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNS  286

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG++T+KVPYESKGKGGFK   L F AT  RTRIMF ST+Y  RSDDF S
Sbjct  287  CEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSS  346

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D ++LLSVR PN
Sbjct  347  LCGPVLDDIKLLSVRKPN  364



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQI RTI GK Y LTF VGDASNS
Sbjct  230  WMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A L+F+A   RTRIMF ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+R P
Sbjct  350  LCGPVLDDVKLLSLRRP  366



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVK+ID++HFSVP GRRAVELVAGKESAIAQ+ RTI GK Y L+F VGDASN+
Sbjct  227  WIVESLKAVKFIDSDHFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNA  286

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T+KVPYESKGKGGFK A LRF A +NRTRIMFFST+Y  RSDDF S
Sbjct  287  CSGSMVVEAFAGKDTVKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSS  346

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  347  LCGPVIDDVKLLSARKP  363



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  88   WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNA  147

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYESKG GGFK A +RF A + R+RIMF+ST+Y  RSDDF S
Sbjct  148  CKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSS  207

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  208  LCGPVIDDVKLISVRKP  224



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  189  WMVESLKAVKYIDSGHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDASNS  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T+KVPYESKGKGG+K A LRFKA + RTRIMF+ST+Y  RSDDF S
Sbjct  249  CEGSMVVEAFAGKDTVKVPYESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDFSS  308

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  309  LCGPVLDDVKLLSVRFP  325



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ +P GRRAVELV GKESAIAQITRTIVGK Y L+F VGDA+NS
Sbjct  189  WVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNS  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG++TLKVPYESKG GGFK A LRF A +NRTRIMF ST+Y  RSDDF S
Sbjct  249  CAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSS  308

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R+P
Sbjct  309  LCGPVVDDVKLLSIRNP  325



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ +T+VGK Y L+F VGDA+N+
Sbjct  230  WMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+GKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  350  LCGPVIDDVKLLSARKP  366



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  230  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPYESKGKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  350  LCGPVIDDVKLLSV  363



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ +P GRRAVELV GKESAIAQITRTIVGK Y L+F VGDA+NS
Sbjct  233  WVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG++TLKVPYESKG GGFK A LRF A +NRTRIMF ST+Y  RSDDF S
Sbjct  293  CAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R+P
Sbjct  353  LCGPVVDDVKLLSIRNP  369



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  230  WMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPYESKGKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  350  LCGPVIDDVKLLSV  363



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVK+ID EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ T+KVPYESKGKGGFK A L+F A ++RTRIMF+ST+Y  RSDDF S
Sbjct  289  CQGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+LLS+R
Sbjct  349  LCGPVVDDVKLLSLR  363



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQI RT++GK Y L+F VGDA+N+
Sbjct  234  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNA  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A +NR+RIMF+ST+Y  RSDDF S
Sbjct  294  CKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFSS  353

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  354  LCGPVIDDVKLISVRKP  370



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  230  WMVESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPY+SKGKGGFK A LRF A + RTR+MF+ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGRDTLKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  350  LCGPVIDDVKLLSV  363



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP G+RA+ELVAGKESAIAQI RTI GK Y LTF VGDA+N+
Sbjct  229  WMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T+KVPYESKGKGGFK A LRF A +NRTRIMF ST+Y  RSDDF S
Sbjct  289  CAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRH  369
            LCGPV+D V+LLSVR+
Sbjct  349  LCGPVIDDVKLLSVRN  364



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  230  WIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKV YESKGKGGFK A LRF A +NRTR+MF+ST+Y  RSDDF S
Sbjct  290  CKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSV  P
Sbjct  350  LCGPVIDDVKLLSVGKP  366



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVK+ID EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDASNS
Sbjct  279  WMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNS  338

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T+KVPYESKGKGGFK A L+F A ++RTRIMF+ST+Y  RSDDF S
Sbjct  339  CEGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSS  398

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+LLS+R
Sbjct  399  LCGPVVDDVKLLSLR  413



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  209  WMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNS  268

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+IVEAFAG++T+KVPYESKGKGGFK A L+F A + RTR+MF STYY  RSDDF S
Sbjct  269  CEGSLIVEAFAGKNTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSS  328

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+R P
Sbjct  329  LCGPVLDDVKLLSLRKP  345



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQI RT++GK Y L+F VGDA+N+
Sbjct  234  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNA  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A +NR+R+MF+ST+Y  RSDDF S
Sbjct  294  CKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSS  353

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  354  LCGPVIDDVKLISVRKP  370



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQI RT++GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A +NR+R+MF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ VP GRRAVELVAGKESAIAQI RTIVGK+Y L+F VGDA+NS
Sbjct  233  WIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG+ TLKVPYESKGKGGFK A+L+FKA +NRTRIMF ST+Y  RSDDF S
Sbjct  293  CVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVR-HPN  363
            LCGPV+D V+LLS++  PN
Sbjct  353  LCGPVLDDVKLLSIQTSPN  371



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQI RT++GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A +NR+R+MF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  231  WMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ TLKVPY+S GKGGFK A LRF A + RTRIMF+ST+Y  RSDDF S
Sbjct  291  CEGSMIVEAFAGRDTLKVPYKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LL+ R P
Sbjct  351  LCGPVIDDVKLLTARKP  367



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID EHFSVP GRRA+ELVAGKESAIAQ+   I GK Y L+F VGDASN+
Sbjct  228  WMVESLKAVKYIDIEHFSVPQGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDASNA  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKVPYES+G GGFK A +RF AT+NRTR+MF+ST+Y  RSDDF S
Sbjct  288  CKGSMIVEAFAGRDTLKVPYESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDFSS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  348  LCGPVIDDVKLLSVRKP  364



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ VP GRRAVELVAGKESAIAQI RTIVGK+Y L+F VGDA+NS
Sbjct  238  WIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNS  297

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG+ TLKVPYESKGKGGFK A+L+FKA +NRTRIMF ST+Y  RSDDF S
Sbjct  298  CVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSS  357

Query  416  LCGPVVDHVRLLSVR-HPN  363
            LCGPV+D V+LLS++  PN
Sbjct  358  LCGPVLDDVKLLSIQTSPN  376



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  234  WMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  294  CKGSMVVEAFAGKETLKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFSS  353

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  354  LCGPVIDDVKLLSVRKP  370



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ H+ VP GRRAVELVAGKESAIAQI RTIVGK+Y L+F VGDA+NS
Sbjct  238  WIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNS  297

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEAFAG+ TLKVPYESKGKGGFK A+L+FKA +NRTRIMF ST+Y  RSDDF S
Sbjct  298  CVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSS  357

Query  416  LCGPVVDHVRLLSVR-HPN  363
            LCGPV+D V+LLS++  PN
Sbjct  358  LCGPVLDDVKLLSIQTSPN  376



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP G+RA+ELVAGKESAIAQI RTI GK Y LTF VGDA+N+
Sbjct  229  WMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T+KVPYESKGKGGFK A LRF A +NRTRIMF ST+Y  RSDDF S
Sbjct  289  CAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  349  LCGPVIDDVKLLSVR  363



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFA ++T+KVPYESKGKGGFK A L+F A + RTR+MF STYY  RSDDF S
Sbjct  289  CEGSMIVEAFADKNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R P
Sbjct  349  LCGPVVDDVKLLSLRKP  365



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A L+F A + RTR+MF STYY  RSDDF S
Sbjct  289  CEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+++P
Sbjct  349  LCGPVLDDVKLLSLKNP  365



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++H+ VP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+NS
Sbjct  239  WMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNS  298

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPYESKG GGFK A L FKA + RTRIMF ST+Y  RSDDF S
Sbjct  299  CAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSS  358

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSVR P
Sbjct  359  LCGPVVDDVKLLSVRKP  375



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A L+F A + RTR+MF STYY  RSDDF S
Sbjct  289  CEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+++P
Sbjct  349  LCGPVLDDVKLLSLKNP  365



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFS+P GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  234  WMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNA  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  294  CKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSS  353

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  354  LCGPVIDDVKLLSVRKP  370



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  189  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNA  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK + LRF A ++RTR+MF+ST+Y  R+DDF S
Sbjct  249  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSS  308

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  309  LCGPVIDDVKLLSARRP  325



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  189  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNA  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK A LRF A + RTR+MF+ST+Y  R DDF S
Sbjct  249  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSS  308

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  309  LCGPVIDDVKLLSARRP  325



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RA+ELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  44   WMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  103

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY+SKGKGGFK A L+F A  +RTRIMF ST+Y  R+DD  S
Sbjct  104  CEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSS  163

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+R P
Sbjct  164  LCGPVIDDVKLLSLRKP  180



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  218  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNA  277

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK A LRF A + RTR+MF+ST+Y  R+DDF S
Sbjct  278  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSS  337

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  338  LCGPVIDDVKLLSARRP  354



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYESKG GGFK A +RF A + R+RIMF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP  +RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  228  WMVESLKAVKYIDSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNS  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T+KVPYESKGKGGFK A LRF A +NRTRIMF ST+Y  RSDD+ S
Sbjct  288  CEGSMVVEAFAGRDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYAS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+R P
Sbjct  348  LCGPVLDDVKLLSLRTP  364



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A ++R+RIMF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVEAFAGKETLKVPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  229  WMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFA ++T+KVPYESKGKGG+K A L+F A + RTR+MF STYY  RSDDF S
Sbjct  289  CEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R P
Sbjct  349  LCGPVVDDVKLLSLRKP  365



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  233  WMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFA ++T+KVPYESKGKGG+K A L+F A + RTR+MF STYY  RSDDF S
Sbjct  293  CEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R P
Sbjct  353  LCGPVVDDVKLLSLRKP  369



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++H+ VP GRRAVELVAGKESAIAQ+ RTI+GK Y L+F VGDA+NS
Sbjct  276  WMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNS  335

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPYESKG GGFK A L FKA + RTRIMF ST+Y  RSDDF S
Sbjct  336  CAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSS  395

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLSVR P
Sbjct  396  LCGPVVDDVKLLSVRKP  412



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYESKG GGFK A +RF A   R+RIMF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK + LRF A ++RTR+MF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  349  LCGPVIDDVKLLSARRP  365



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT+VGK Y L+F VGDA+N+
Sbjct  231  WMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  291  CKGSMVVEAFAGKDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  351  LCGPVIDDVKLLSVR  365



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK + LRF A ++RTR+MF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  349  LCGPVIDDVKLLSARRP  365



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G+RAVEL+AGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  230  WMVESLKAVKYIDSGHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A L+F A   RTRIMF ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+S+R P
Sbjct  350  LCGPVIDDVKLVSLRKP  366



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK + LRF A ++RTR+MF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  349  LCGPVIDDVKLLSARRP  365



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFS+P GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  231  WMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  291  CKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  351  LCGPVIDDVKLLSVR  365



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFSVP GRRA+ELVAGKESAIAQ+ RT++GK Y L+F VGDA+N+
Sbjct  233  WMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VE+FAG+ TLKVPYESKG GGFK A +RF A + R+R+MF+ST+Y  RSDDF S
Sbjct  293  CKGSMVVESFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDFSS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR P
Sbjct  353  LCGPVIDDVKLISVRKP  369



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHFSVP G+RAVELVAGKESAIAQ+ RT+ GK Y L F VGDA+N 
Sbjct  230  WMIESLKAVKYIDAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANNR  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T+KVPYESKG GGFK A L+F A + RTRIMF ST+Y  RSDD  S
Sbjct  290  CEGSMVVEAFAGRDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDMAS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+LLS+R+P
Sbjct  350  LCGPVVDDVKLLSIRNP  366



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  229  WMVESLKAVKYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGFK A LRF A + RTR+MF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  349  LCGPVIDDVKLLSARRP  365



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RTI GK Y L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ T+KVPYESKGKGGF+ A LRF A + RTR+MF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTIKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS R P
Sbjct  349  LCGPVIDDVKLLSARRP  365



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVEL+AGKESAIAQ+ RTI GK Y L+F VGDASN 
Sbjct  230  WMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNY  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A L+F A   RTR+MF ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD V+L+S+R P
Sbjct  350  LCGPVVDDVKLVSLRKP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVEL+AGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  230  WMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKG GGFK A L+F A   RTR+MF ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+S+R P
Sbjct  350  LCGPVIDDVKLVSLRKP  366



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+RAVEL+AGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  230  WMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKG GGFK A L+F A   RTR+MF ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+S+R P
Sbjct  350  LCGPVIDDVKLVSLRKP  366



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  190  WMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  249

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY SKGKGGFK A L+F A   RTR+MF ST+Y  RSDD  S
Sbjct  250  CEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSS  309

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  310  LCGPVIDDVKLLSVRKP  326



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVEL+AGKESA+AQ+ RT  GKIY L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ TLKVPYESKGKGGFK A L+F A ++RTRIMF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTLKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLS R
Sbjct  349  LCGPVIDDVKLLSAR  363



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDA HF+VP G+RA+ELVAG+ESAIAQ+  T  GK+YDL F VGDASNS
Sbjct  236  WMIESLKAVKYIDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASNS  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM++EAFAGQ TL+VPYESKG GGFK AKLRFKA + RTR+ F STYYH +SD   S
Sbjct  296  CQGSMLIEAFAGQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGS  355

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+ VRHP
Sbjct  356  LCGPVVDDVRLVGVRHP  372



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHF+VP G+RA+ELVAG+ESAIAQI RT  GK+YDL F VGDASNS
Sbjct  237  WMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNS  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM++EAFAG+ TL+VPYES GKGGFK AKLRF A   RTR+ F STYYH ++D   S
Sbjct  297  CQGSMLIEAFAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHSGS  356

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD +RL+ VRHP
Sbjct  357  LCGPVVDDMRLVGVRHP  373



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFS+P GRRA+ELV GKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  170  WMVESLKAVKYVDTEHFSIPQGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDANNA  229

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RT++MF+ST+Y  RSDDF S
Sbjct  230  CKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDFSS  289

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  290  LCGPVIDDVKLLSVR  304



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFS+P GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  204  WMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  263

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  264  CKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSS  323

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+L+S R
Sbjct  324  LCGPVIDDVKLISAR  338



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D++HF VP G+RA+ELVAGKESAIAQ+ RT+ GK+Y LTF VGDA+N+
Sbjct  231  WMIESLKAVKYLDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T KVPY SKGKGGFK A LRF AT  RTRIMF+ST+Y  RSDDF S
Sbjct  291  CSGSMVVEAFAGKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRL+SVR P
Sbjct  351  LCGPVIDDVRLVSVRRP  367



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP GRRAVELVAGKESA+AQ+ RT  GKIY L+F VGDASN+
Sbjct  229  WMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSMIVEAFAG+ TLKVP+ESKGKGGFK A L+F A ++RTRIMF+ST+Y  R+DDF S
Sbjct  289  CAGSMIVEAFAGKDTLKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSS  348

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLS R
Sbjct  349  LCGPVIDDVKLLSAR  363



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G+RAVELVAGKESAIAQ+ RTI GK+Y LTF VGDASN+
Sbjct  189  WMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDASNA  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPYESKG GGFK A LRF A + RTR++F ST+Y  RSDDF S
Sbjct  249  CTGSMVVEAFAGRDTLKVPYESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDFSS  308

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  309  LCGPVIDDVKLLSV  322



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  240  WMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  299

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY SKGKGGFK A L+F A   RTR+MF ST+Y  RSDD  S
Sbjct  300  CEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSS  359

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  360  LCGPVIDDVKLLSVRKP  376



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  240  WMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  299

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY SKGKGGFK A L+F A   RTR+MF ST+Y  RSDD  S
Sbjct  300  CEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSS  359

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR P
Sbjct  360  LCGPVIDDVKLLSVRKP  376



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  230  WIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKV YES GKGGFK A LRF A ++RTR+MF+ST+Y  RSDDF S
Sbjct  290  CKGSMIVEAFAGKDTLKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  350  LCGPVIDDVKLLSV  363



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D EHFS+P GRRA+ELVAGKESAIAQ+ RTI+GK Y L+F VGDA+N+
Sbjct  231  WMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNA  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVPYES+G GGFK A +RF A + RTR+MF+ST+Y  RSDDF S
Sbjct  291  CKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+L+S R
Sbjct  351  LCGPVIDDVKLISAR  365



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHF+VP G+RA+ELVAG+ESAIAQI RT  GK+YDL F VGDASNS
Sbjct  232  WMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNS  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM++EAFAG  TL+VPYES GKGGFK AKLRF A   RTR+ F STYYH +SD   S
Sbjct  292  CQGSMLIEAFAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHSGS  351

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+ VR+P
Sbjct  352  LCGPVVDDVRLVGVRYP  368



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHF+VP G+RAVELVAG+ESAIAQ+ RT  GK+YDL F +GDASNS
Sbjct  233  WMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++ PYESKGKGGFK A+LRF A + RTR+ F STYYH +SD+  S
Sbjct  293  CEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+ VR+P
Sbjct  353  LCGPVVDDVRLVGVRNP  369



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDA HF+VP G+RA+ELVAG+ESAIAQ   T  GK+YDL F VGDASNS
Sbjct  236  WMIESLKAVKYIDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASNS  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM++EAFAGQ TL+VPYESKG GGFK AKLRFKA + RTR+ F STYYH +SD   S
Sbjct  296  CQGSMLIEAFAGQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGS  355

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+ VRHP
Sbjct  356  LCGPVVDDVRLVGVRHP  372



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+YID+ HFSVP GRRA+ELV G+ESAIAQ+ RT  GK Y LTF VGDASNS
Sbjct  209  WMVESLKAVRYIDSAHFSVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDASNS  268

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG S++++PYES G+GG+K A L+F A ++RTRIMF STYYH RSDD+ S
Sbjct  269  CEGSMVVEAFAGGSSVRIPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDDYAS  328

Query  416  LCGPVVDHVRLLSVRH  369
            LCGPVVD V LLSVR 
Sbjct  329  LCGPVVDDVELLSVRE  344



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+EHF VP G+RAVELVAG+ESAIAQ+ RT  GKIYDL F +GDASNS
Sbjct  233  WMIESLKAVKYIDSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++ PYESKGKGGFK A+LRF A + RTR+ F STYYH +SD+  S
Sbjct  293  CEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVRHPNF  360
            LCGPVVD VRL+ +R+P+ 
Sbjct  353  LCGPVVDDVRLVGLRNPHL  371



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RA+ELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  230  WMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY+SKGKGGFK A L+F A  +RTRIMF ST+Y  R+DD  S
Sbjct  290  CEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSS  349

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLS+R P
Sbjct  350  LCGPVIDDVKLLSLRKP  366



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+EHF VP G+RAVELVAG+ESA+AQ+ RT  GKIYDL F +GDASNS
Sbjct  232  WMIESLKAVKYIDSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASNS  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++ PYESKGKGGFK A+LRF A + RTR+ F STYYH +SD+  S
Sbjct  292  CEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGS  351

Query  416  LCGPVVDHVRLLSVRHPNF  360
            LCGPVVD VRL+ VR+P+ 
Sbjct  352  LCGPVVDDVRLVGVRNPHL  370



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+DAEHFSVP GRRAVEL+AGKESAIAQ+ RT+ G+ Y L+F VGDASN+
Sbjct  228  WMVESLKAVKYLDAEHFSVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASNA  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VEAFAG+ T+KVPYESKG+GG K A L+F AT  RTR++F+S+YY+TRSDD  S
Sbjct  288  CEGSLLVEAFAGEHTIKVPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDLSS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V L+SVR+P
Sbjct  348  LCGPVLDDVALVSVRYP  364



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D+ HFSVP G RAVELVAGKESAIAQ+ RTI GK Y L+F VGDASNS
Sbjct  239  WMVESLKAVKYLDSGHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNS  298

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPY SKGKGGFK A L+F A   RTR+MF ST+Y  RSDD  S
Sbjct  299  CEGSMIVEAFAGKDTIKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSS  358

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  359  LCGPVIDDVKLLSVR  373



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP G+RA+ELVAGKESAIAQ+  TI+GK+YDLTF+VGDA+NS
Sbjct  235  WMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNS  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++V Y+SKGKGGF   KLRFKA + RTRI F ST+Y T+SD+  S
Sbjct  295  CEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGS  354

Query  416  LCGPVVDHVRLLSVRH  369
            LCGP++D +RLLSVR+
Sbjct  355  LCGPIIDDIRLLSVRY  370



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP G+RA+ELVAGKESAIAQ+  TI+GK+YDLTF+VGDA+NS
Sbjct  233  WMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++V Y+SKGKGGF   KLRFKA + RTRI F ST+Y T+SD+  S
Sbjct  293  CEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGS  352

Query  416  LCGPVVDHVRLLSVRH  369
            LCGP++D +RLLSVR+
Sbjct  353  LCGPIIDDIRLLSVRY  368



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYIDAEHF+VP G+RAVELVAG+ESAIAQ+ RT  GK+YDL F +GDASNS
Sbjct  233  WMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG+ T++ PYESKGKGG K ++LRF A + RTR+ F STYYH +SD+  S
Sbjct  293  CEGSMLVEAFAGKITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+ VR+P
Sbjct  353  LCGPVVDDVRLVGVRNP  369



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D EHFSVP GRRAVELVAGKESAIAQ+ RTIVGK Y L+F VGDA+N+
Sbjct  230  WIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNA  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSMIVEAFAG+ TLKV YESKGKGGFK A LRF A +NRTR+MF+ST+Y  RSDDF S
Sbjct  290  CKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+LLSV
Sbjct  350  LCGPVIDDVKLLSV  363



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HF+VP G+RAVELVAGKES IAQ  +T +GK+Y LTF VGDA+NS
Sbjct  65   WMVESLKAVKYIDSNHFAVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDANNS  124

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG  T++VPY+SKGKGGF   KLRFKA + RTR+ F ST+Y  ++D+  S
Sbjct  125  CEGSMVVEAFAGGDTVQVPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDNSGS  184

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGP++D +RLLSVR+P
Sbjct  185  LCGPIIDDIRLLSVRYP  201



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP G+RA+ELVAGKESA+AQ+  T +G++YDLTF VGDA+N+
Sbjct  155  WIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNA  214

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG  T+++PY+SKGKGG    KLRFKA A RTR+ F ST+Y  +SD+  S
Sbjct  215  CEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGS  274

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR+P
Sbjct  275  LCGPVIDDVKLLSVRYP  291



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+ HFSVP G RA+ELVAGKESAIAQ+ RTI GK Y L F VGDASNS
Sbjct  230  WMVESLKAVKYIDSAHFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKGKGGFK A LRFKA + RTRIMF+ST+Y  RSDDF S
Sbjct  290  CEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFSS  349

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPVVD V LLSVR+P  +
Sbjct  350  LCGPVVDDVVLLSVRNPRLM  369



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP+G  AVELVAG+ESAIAQI RT+  K Y+LTF +GDA N 
Sbjct  156  WIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNG  215

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM VEAFAG+ T+ VP+ESKGKGGFK A L+FKA A RTRI FFSTYYHT+ +DF S
Sbjct  216  CHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGS  275

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VR+LS+R
Sbjct  276  LCGPVLDEVRVLSIR  290



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP G+RA+ELVAGKESA+AQ+  T +G++YDLTF VGDA+N+
Sbjct  237  WIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNA  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG  T+++PY+SKGKGG    KLRFKA A RTR+ F ST+Y  +SD+  S
Sbjct  297  CEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGS  356

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LLSVR+P
Sbjct  357  LCGPVIDDVKLLSVRYP  373



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF VP G RA+ELVAGKESA+AQ+  T +GK+YDLTF VGDA+NS
Sbjct  233  WIVESLKAVKYIDSKHFYVPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM VEAFAG  T++VPYESKGKGGF   KLRF A + RTRI F ST+Y  ++D+  S
Sbjct  293  CEGSMTVEAFAGGDTVQVPYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSGS  352

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D V+LLSVR+PN
Sbjct  353  LCGPVIDDVKLLSVRYPN  370



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID+EHF+VP G+RA+ELVAGKESA+AQ   T +GK+Y LTF VGDA+N+
Sbjct  233  WIVESLKAVKYIDSEHFTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM VEAFAG+ T++VPY+SKGKGGF   KLRFKA+  RTRI F ST+Y  ++D+  S
Sbjct  293  CEGSMTVEAFAGRDTVQVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSGS  352

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D V+LLSVR+PN
Sbjct  353  LCGPVIDDVKLLSVRYPN  370



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVPHG+RAVELVAGKESA+AQ+ RTI GK+Y LTF VGDA N 
Sbjct  229  WMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNG  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T+K+PYESKG GG+K A LRF A   RTR++F ST+YHT++D   S
Sbjct  289  CVGSMVVEAFASRGTVKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG--S  346

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPVVD V LLSVR P  L
Sbjct  347  LCGPVVDDVSLLSVRSPRAL  366



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+DA+HF+VP G+RA+ELVAG+ESAIAQ   T  G+IYDLTF VGDA+NS
Sbjct  241  WIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDANNS  300

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG   L+  Y SKGKGGFK AKLRF AT+ RTR+ F S+YYH +SD+  S
Sbjct  301  CEGSMVVEAFAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNSGS  360

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPVVD VRL+SVR+P
Sbjct  361  LCGPVVDDVRLVSVRNP  377



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KYID+EHFSVP G+RA+EL+AGKESA+AQI +T +G+ Y L+FLVGDA+N 
Sbjct  163  WIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNG  222

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++T+KV Y SKGKGGFK A+L F+A + RTRIMF+ST+Y  +SD+  S
Sbjct  223  CEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGS  282

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  283  LCGPVLDDVKLLSVR  297



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF+VP G+R VELVAGKESA++Q+  TI  ++Y L+F VGDA+NS
Sbjct  234  WMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNS  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG  T+KVPYESKGKGGFK AKLRFKA + RTR+MF STYY  ++D+  S
Sbjct  294  CEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGS  353

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  354  LCGPVLDDVKLLSVR  368



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF+VP G+R VELVAGKESA++Q+  TI  ++Y L+F VGDA+NS
Sbjct  234  WMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNS  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG  T+KVPYESKGKGGFK AKLRFKA + RTR+MF STYY  ++D+  S
Sbjct  294  CEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGS  353

Query  416  LCGPVVDHVRLLSVRHPNF  360
            LCGPV+D V+LLSVR   F
Sbjct  354  LCGPVLDDVKLLSVRKARF  372



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+ AVEL+ GKESAIAQ+ RTI GK Y L+F VGDA NS
Sbjct  192  WIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNS  251

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ VEA+ G+ ++KVPYESKGKGGFK A L+F A + RTRI+F ST+Y  RSDDF S
Sbjct  252  CEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFAS  311

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V L+S+R P
Sbjct  312  LCGPVIDDVTLISLRKP  328



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP+G  AVELVAG+ESAIAQI RT+  K Y+LTF +GDA N 
Sbjct  233  WIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM VEAFAG+ T+ VP+ESKGKGGFK A L+FKA A RTRI FFSTYYHT+ +DF S
Sbjct  293  CHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGS  352

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VR+LS+R
Sbjct  353  LCGPVLDEVRVLSIR  367



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KYID+EHFSVP G+RA+EL+AGKESA+AQI +T +G+ Y L+FLVGDA+N 
Sbjct  189  WIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNG  248

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++T+KV Y SKGKGGFK A+L F+A + RTRIMF+ST+Y  +SD+  S
Sbjct  249  CEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGS  308

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  309  LCGPVLDDVKLLSVR  323



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV YID+ HF VP G+RAVELV GKESA+AQ+ RT+VG++Y L+FLVGDA N+
Sbjct  229  WMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAGNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M+VEAFA +ST+KVPY+SKG GGFK A LRF A A RTR++F STYY+TR+D   S
Sbjct  289  CTGPMVVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG--S  346

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPVVD V LLSVR+P+
Sbjct  347  LCGPVVDDVTLLSVRNPS  364



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D+ HF+VP G+RAVELVAG+ESA+AQ  RT+ GK Y+L F +GDA NS
Sbjct  262  WMIESLKAVKYVDSNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKNS  321

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM VEA AG+  L+VPYESKG GGFK AKLRFKA ++RTR+ F ST+YH +SD+  S
Sbjct  322  CEGSMTVEANAGRDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSGS  381

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGP++D VRL+S+R+P
Sbjct  382  LCGPIIDDVRLVSIRYP  398



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KYID+EHFSVP G+RA+EL+AGKESA+AQI +T +G+ Y L+FLVGDA+N 
Sbjct  235  WIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++T+KV Y SKGKGGFK A+L F+A + RTRIMF+ST+Y  +SD+  S
Sbjct  295  CEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGS  354

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  355  LCGPVLDDVKLLSVR  369



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KYID+EHFSVP G+RA+EL+AGKESA+AQI +T +G+ Y L+FLVGDA+N 
Sbjct  235  WIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++T+KV Y SKGKGGFK A+L F+A + RTRIMF+ST+Y  +SD+  S
Sbjct  295  CEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGS  354

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  355  LCGPVLDDVKLLSVR  369



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HFSVP G+ AVEL+ GKESAIAQ+ RTI GK Y L+F VGDA NS
Sbjct  229  WIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNS  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ VEA+ G+ ++KVPYESKGKGGFK A L+F A + RTRI+F ST+Y  RSDDF S
Sbjct  289  CEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFAS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V L+S+R P
Sbjct  349  LCGPVIDDVTLISLRKP  365



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP G+RA+ELVAGKESA+AQ+  T +GK YDLTF VGDA+N 
Sbjct  235  WIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANNE  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CE SM+VEAFAG +T++VPY+SKGKGGF   KLRFKA + RTR+ F ST+Y  +SD+  S
Sbjct  295  CEASMMVEAFAGANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNSGS  354

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+LL VR+P
Sbjct  355  LCGPVIDDVKLLGVRYP  371



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID EHF+VP G+RAVELVAG+ESA+AQ   T  GKIYDL F VGDA+NS
Sbjct  240  WIIESLKAVKYIDTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNS  299

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM++EAFAG+  L+VPY SKGKGGFK AK RF A + RTR+ F ST YH ++D+  S
Sbjct  300  CEGSMLIEAFAGKVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNSGS  359

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRL+SVR+P
Sbjct  360  LCGPVIDDVRLVSVRNP  376



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+YID++HFSVP G+RAVEL+ GKESAIAQ+ RTI GK Y L F VGDA NS
Sbjct  217  WMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNS  276

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ VEA+ G+ ++KVPYESKGKGGFK A L+F A + RTRI+F ST+Y+ RSDD  S
Sbjct  277  CEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLAS  336

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D V L+S+R P+
Sbjct  337  LCGPVIDDVTLISLRKPH  354



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+YID++HFSVP G+RAVEL+ GKESAIAQ+ RTI GK Y L F VGDA NS
Sbjct  230  WMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNS  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ VEA+ G+ ++KVPYESKGKGGFK A L+F A + RTRI+F ST+Y+ RSDD  S
Sbjct  290  CEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLAS  349

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D V L+S+R P+
Sbjct  350  LCGPVIDDVTLISLRKPH  367



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+EHFSVP G+RA+ELVAGKESA+AQ+ +T +G+ Y L+F VGDA+N+
Sbjct  233  WIIESLKAVKYIDSEHFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNA  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG++T+K  Y+SKGKGGFK A L FKA ++RTRIMF+ST+Y  +SD+  S
Sbjct  293  CEGSMVVEAFAGKNTVKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  353  LCGPVLDDVKLLSVR  367



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G+ AVELVAG+ESAIAQ+ RT+  KIYDL+F+VGDA N 
Sbjct  157  WIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNG  216

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S+GKGGFK A L+FKA + RTRI F+S++YHTR DD+ +
Sbjct  217  CHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGA  276

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  V
Sbjct  277  LCGPILDQVRVYPV  290



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W +DSLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT +G+ Y L+F +GDA+N+
Sbjct  235  WIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNA  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFA ++T+KV Y+SKGKGGFK A+LRFKA + RTRIMF+ST+Y  ++D+  S
Sbjct  295  CEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGS  354

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+L+S+R
Sbjct  355  LCGPVVDDVKLVSIR  369



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID +HF+VP G+RA+ELVAGKESA+AQ+ +TI GK Y LTF VGDA+N+
Sbjct  238  WIIESLKAVKYIDLDHFAVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNA  297

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEA+AG+  ++ PY SKGKGGFK AKL+FKA +  TRIMF S++Y  +SD+  S
Sbjct  298  CEGSMIVEAYAGKDKIQFPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSGS  357

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPV+D V+L+SVR P  L
Sbjct  358  LCGPVLDDVKLISVRQPRRL  377



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+DA+HF+VP G+RA+ELVAG+ESAIAQ   T  G+IYDL F VGDA+N+
Sbjct  241  WIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDANNA  300

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFAG   L+  Y SKGKGGFK AKLRF A + RTR+ F S+YYH +SD+  S
Sbjct  301  CEGSMVVEAFAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNSGS  360

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRL+SVR+P
Sbjct  361  LCGPVIDDVRLVSVRNP  377



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDS KAVKY+D+ HFSVP G RAVEL+AGKESA+AQ  RT+ G+ Y L F VGDASN+
Sbjct  228  WMVDSPKAVKYLDSTHFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNA  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+G+MIVEAFAG+ T+KVPYESKG GG K A LRF+A+  RTRI+FFS+ Y+TRSDD  S
Sbjct  288  CQGTMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLSS  347

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V L+S+R+P
Sbjct  348  LCGPVLDDVALVSIRNP  364



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDS KAVKY+D+ HF VPHGRRAVEL+AGKESA+AQ  RT+ G+ Y L F VGDASN+
Sbjct  229  WMVDSPKAVKYLDSAHFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNA  288

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSMIVEAFAG+ T+KVPYESKG GG K A LRF+A+  RTRI+F S+ Y TR DD  S
Sbjct  289  CEGSMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLSS  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V L+S+R+P
Sbjct  349  LCGPVLDDVALVSIRNP  365



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            WTV+SLKAVKYID++HFSVP G+RAVELVAGKESA+AQ+ RT+ GK+Y L F +GDA N 
Sbjct  231  WTVESLKAVKYIDSDHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T K+PYESKG GG+K   LRF A A RTR++FFST+YHT+ D   S
Sbjct  291  CVGSMVVEAFAGRGTAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG--S  348

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGP +D V LLSVR P
Sbjct  349  LCGPSLDDVSLLSVRSP  365



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV YID+ HF VP G+RAVELV GKESA+AQ+ RT+VG++Y L+F VGDA N+
Sbjct  235  WMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGNA  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G+M+VEAFA +ST+KVPY+SKG GGFK A LRF A A RTR++F STYY+TR+D   S
Sbjct  295  CAGTMMVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG--S  352

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPVVD V LLSVR P+
Sbjct  353  LCGPVVDDVTLLSVRKPS  370



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G+ AVELVAG+ESAIAQ+ RT+  KIYDL+F+VGDA N 
Sbjct  233  WIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S+GKGGFK A L+FKA + RTRI F+S++YHTR DD+ +
Sbjct  293  CHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGA  352

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  V
Sbjct  353  LCGPILDQVRVYPV  366



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W +DSLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT +G  Y L+F +GDA+N+
Sbjct  235  WIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDANNA  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VEAFA ++T+KV Y+SKGKGGFK A+LRFKA + RTRIMF+ST+Y  ++D+  S
Sbjct  295  CEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGS  354

Query  416  LCGPVVDHVRLLSVR  372
            LCGPVVD V+L+S+R
Sbjct  355  LCGPVVDDVKLVSIR  369



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVA---GKESAIAQITRTIVGKIYDLTFLVGDA  606
            W ++SLKAVKYID++HF VP G+RAVELVA   G+E A+AQ  RT+ GK YDL F +GDA
Sbjct  231  WMIESLKAVKYIDSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGDA  290

Query  605  SNSCEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDD  426
             NSCEGSM+VEA AG+  L+VPYESKG GGFK AKLRFKA + RTRI F STYYH +SD+
Sbjct  291  KNSCEGSMMVEATAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKSDN  350

Query  425  FVSLCGPVVDHVRLLSVRHP  366
              SLCGPV+D V+L+ VR P
Sbjct  351  SGSLCGPVIDDVKLVGVRRP  370



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+DAEHF+VP G+RAVELVAG+ESA+AQ   T  GKIYDL F VGDA+NS
Sbjct  240  WIIESLKAVKYVDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNS  299

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM++EAFAG+  L+V Y SKGKGGFK AKLRF A + RT + F ST YH +SD+  S
Sbjct  300  CEGSMLIEAFAGKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNSGS  359

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRL+SVR+P
Sbjct  360  LCGPVIDDVRLVSVRNP  376



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID+ HF+VP+G  AVELVAGKESAIAQ+ RT+  K+Y+LTF VGDA N 
Sbjct  230  WIIESLKAVKFIDSAHFNVPYGSAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDARNG  289

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM VEAFAG  TLKVP+ESKGKGGFK    +FKA   RTRI FFS++YHTR DD+ S
Sbjct  290  CHGSMSVEAFAGAETLKVPFESKGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDYGS  349

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  V
Sbjct  350  LCGPILDQVRVFPV  363



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDSLKAVKYID+EHF+VP G+RAVEL+AGKESAI+QI +TI+ KIY LTF VGD SNS
Sbjct  233  WIVDSLKAVKYIDSEHFTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VE +AG+   +VPY+S GKGGFK AK  FKA +N TRI F S++Y  +SD+  S
Sbjct  293  CVGSMVVEVYAGKDRTQVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR+P
Sbjct  353  LCGPVLDDVKLVSVRNP  369



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDSLKAVKYID EHF+VP G+RAVELVAGKESAI+Q  +TI+ KIY LTF VGD SNS
Sbjct  249  WIVDSLKAVKYIDREHFTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSNS  308

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VE +AG+   +VPYES GKGGFK AK  FKA +N TRI F S++Y  +SD+  S
Sbjct  309  CVGSMVVEVYAGKDRTQVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGS  368

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR+P
Sbjct  369  LCGPVLDDVKLVSVRNP  385



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDSLKAVKYID++HF+VP G+RAVELVAGKESAI+Q+ +T + KIY LTF VGD SNS
Sbjct  233  WMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VE +AG+   +VPYES GKGGFK AK  FKA +N TRI F S++Y  +SD+  S
Sbjct  293  CVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSGS  352

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR+P
Sbjct  353  LCGPVLDDVKLVSVRNP  369



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W VDSLKAVKYID++HF+VP G+RAVELVAGKESAI+Q+ +T + KIY LTF VGD SNS
Sbjct  255  WMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNS  314

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VE +AG+   +VPYES GKGGFK AK  FKA +N TRI F S++Y  +SD+  S
Sbjct  315  CVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSGS  374

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D V+L+SVR+P
Sbjct  375  LCGPVLDDVKLVSVRNP  391



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+KYID+EH SVP G+ A+EL+AGKESA+AQI +T +G+ Y L+F+VGDA+N 
Sbjct  64   WIIESLKAIKYIDSEHLSVPQGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDANNG  123

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++ + V Y SKGKGGFK A+L F+A + RTRIMF+ST Y  +SD+  S
Sbjct  124  CEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDNSGS  183

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V LLSVR
Sbjct  184  LCGPVLDDVMLLSVR  198



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  A+ELVAG+ESA+AQI RTI  K+Y LTF VGDA N 
Sbjct  234  WIIESLKAVKFIDSKHFNVPVGLAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAKNG  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T+KVP++S+GKG +K A L+FKAT+ RTRI FFS+YYHTR+DDF S
Sbjct  294  CHGSMMVEAFAAKETVKVPFQSQGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDFGS  353

Query  416  LCGPVVDHVRLLS  378
            LCGPV+D VR++S
Sbjct  354  LCGPVLDDVRVIS  366



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+YID++HFSVP G+RAVEL+ GKESAIAQ+ RTI GK Y L F VGDA NS
Sbjct  228  WMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNS  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
             EGS+ VEA+ G+ ++KVPYESKGKGGFK A L+F A + RT I+F ST+Y+ RSDD  S
Sbjct  288  SEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDLAS  347

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPV+D V L+S+R P+
Sbjct  348  LCGPVIDDVTLISLRKPH  365



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G+ AVELVAG+ESAIAQ+ RT+  KIY+L+F+VGDA N 
Sbjct  320  WIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYNLSFVVGDARNG  379

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S+GKGGFK A L+FKA + RTRI F+S++YHTR DD+ +
Sbjct  380  CHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGA  439

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  V
Sbjct  440  LCGPILDQVRVYPV  453



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID+ HF+VP+G +AVELVAG+ESAIAQI RT+  ++Y ++F VGDA N 
Sbjct  231  WIIESLKAVKFIDSAHFNVPYGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVPYES GKGGFK A  +FKA   RTRI F+S++YHTR DD+ S
Sbjct  291  CHGSMMVEAFAAKETLKVPYESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDYGS  350

Query  416  LCGPVVDHVRLLSVRH  369
            LCGP++D VR++ VR+
Sbjct  351  LCGPILDQVRVVPVRY  366



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF VP GR+A+ELV GKESA+AQ+  T  GK+Y LTF VGD++N+
Sbjct  236  WIIESLKAVKYIDSQHFFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNA  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+IVEAFAG+ TLKVPY+SKGKGGFK A+L F A   RTRIMF+ST+Y   +D   S
Sbjct  296  CEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGS  355

Query  416  LCGPVVDHVRLLSVR  372
            LCGP++D V+LLSVR
Sbjct  356  LCGPIIDDVKLLSVR  370



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF VP GRRA+ELV GKESA+AQ+  T  GK+Y LTF VGD++N+
Sbjct  236  WIIESLKAVKYIDSKHFFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNA  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+IVEAFAG+ TLKVPY+SKGKGGFK A+L F A   RTRIMF+ST+Y   +D   S
Sbjct  296  CEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGS  355

Query  416  LCGPVVDHVRLLSVR  372
            LCGP++D V+LLSVR
Sbjct  356  LCGPIIDDVKLLSVR  370



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G+ AVELVAG+ESAIAQ+ RT+  K+Y L+F +GDA N 
Sbjct  234  WIIESLKAVKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARNG  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S+GKGGFK A  +FKAT+ RTRI FFS++YHTR+DD+ +
Sbjct  294  CHGSMMVEAFAGKDTLKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYGA  353

Query  416  LCGPVVDHVRL  384
            LCGP++D V++
Sbjct  354  LCGPILDEVKV  364



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYI++EHF VP G+RA+ELVAGKESA++QI +TI  K Y LTF VGDA+NS
Sbjct  235  WIIESLKAVKYINSEHFKVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANNS  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VE +AG   +++PY SKGKGGFKPA+ +F+A +  TR+MF S++Y  +SD+  S
Sbjct  295  CEGSLVVEVYAGNDKIEIPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNSGS  354

Query  416  LCGPVVDHVRLLSVRHPNFL  357
            LCGPV+D V+LLSVR P  L
Sbjct  355  LCGPVIDDVKLLSVRRPRHL  374



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+EHF VP GRRA+ELV GKESA+ Q+  T  GK+Y LTF VGD++NS
Sbjct  236  WIIESLKAVKYIDSEHFFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNS  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VEAFAG+ TLKVPY+SKGKGGFK A+L F A   RTRIMF+ST+Y   +D   S
Sbjct  296  CEGSLVVEAFAGKDTLKVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSGS  355

Query  416  LCGPVVDHVRLLSVR  372
            LCGP++D V+LLSVR
Sbjct  356  LCGPIIDDVKLLSVR  370



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+++F VP G+RAVELV G+ES +AQ+ RT   K+YDL F VGD++N 
Sbjct  231  WMIESLKAVKYIDSDNFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNK  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+V A+AG   L+VPYESKG GGFK A++RFKAT+ RTRI F S YYH +SD+  S
Sbjct  291  CEGSMMVVAYAGVDILQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSGS  350

Query  416  LCGPVVDHVRLLSVRHPN  363
            LCGPVVD VRL+ +R+P+
Sbjct  351  LCGPVVDDVRLVRIRYPS  368



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ GK Y L+F VGDASN+
Sbjct  170  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNT  229

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            C GS++VEA+AG+ + KVPYES G+GG  K A L F+AT++RTR++FFS++Y+TR+DD  
Sbjct  230  CRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMS  289

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  290  SLCGPVIDDVAVVSVR  305



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP+G  A+ELVAGKESAIAQ+ RT+  K+Y L+F VGDA N 
Sbjct  231  WIIESLKAVKFIDSKHFNVPYGEAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S G G +K A L+FKA   RTRI FFSTYYHT+ DDF S
Sbjct  291  CHGSMVVEAFAGKDTLKVPHNSVGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDFGS  350

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D +R++ V
Sbjct  351  LCGPIIDDIRVVPV  364



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 117/140 (84%), Gaps = 3/140 (2%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ GK Y L+F VGDASN+
Sbjct  232  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNT  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            C GS++VEA+AG+ + KVPYES G+GG  K A L F+AT+ RTR++FFS++Y+TR+DD  
Sbjct  292  CRGSLMVEAYAGRESAKVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMS  351

Query  419  SLCGPVVDHVRLLSV--RHP  366
            SLCGPV+D V ++SV  RHP
Sbjct  352  SLCGPVIDDVAVVSVRARHP  371



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQI RTI  K+YDLTF VGDA N 
Sbjct  231  WIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP+ES+GKG FK     FKA + RTRI F+S+YYHTR DDF S
Sbjct  291  CHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDFGS  350

Query  416  LCGPVVDHVRLL  381
            LCGPV+D VR+ 
Sbjct  351  LCGPVLDQVRVF  362



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK++D++HF+VP G+RAVELVAGKESAIAQ+  T  GK+Y LTF VGDA NS
Sbjct  233  WIIESLKAVKFVDSDHFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNS  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM VEA+AG +++ VPY S GKGG+  AKLRF AT++RTR+ F S+YY+ +SD   S
Sbjct  293  CEGSMAVEAYAGTASVTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSGS  352

Query  416  LCGPVVDHVRLLSVRH  369
            LCGPV+D VRL+SVR+
Sbjct  353  LCGPVIDDVRLVSVRN  368



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G+ AVELVAG+ESAIAQI RT+  ++YDLTF++GDA N 
Sbjct  251  WIIESLKAVKFIDSKHFNVPAGKAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDARNG  310

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M+VEAFA ++T+KVP+ S+GKG FK A L+FKA   RTRI FFS+YYHTR +DF S
Sbjct  311  CHGEMMVEAFADKNTVKVPFTSRGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDFGS  370

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR+  V
Sbjct  371  LCGPVLDEVRVSPV  384



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQI RTI  K+Y LTF VGDA N 
Sbjct  231  WIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAKNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP+ES+GKG FK    +FKA + RTRI F+S+YYHTR DDF S
Sbjct  291  CHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDFGS  350

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR+  +
Sbjct  351  LCGPVLDQVRVFPI  364



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D++H+ VP G+RAVELVAG+ESA+AQI +T+ GK YDL FL+GDA NS
Sbjct  235  WIIESLKAVKYVDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKNS  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M VEA AG+++L+  YESKG GGF+ +KLRFKA + RTR+ F S  YH +SD+  S
Sbjct  295  CEGMMTVEAAAGKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNTGS  354

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VRL+ VR+P
Sbjct  355  LCGPVIDDVRLVGVRNP  371



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HFSVP G  A+ELVAG+ESAIAQI RTI  K Y+LTF +GDA N+
Sbjct  237  WIIESLKPVKYIDKKHFSVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNA  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPY S+GKGGFK A  +F+AT+ RTRI F+S YYHT+  DF  
Sbjct  297  CHGSMMVEAFAGKETLKVPYTSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGH  356

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D+V +L V
Sbjct  357  MCGPVLDNVIVLPV  370



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+ HF+VP G+RA+ELVAGKESA+AQ+  T  G++Y LTF VGD+ N+
Sbjct  237  WIIESLKAVKYIDSTHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNA  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VEAFAG+ TLKVPYESKGKGGFK A+L F A    TR+MF ST+Y   +D   S
Sbjct  297  CEGSLVVEAFAGKDTLKVPYESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSGS  356

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  357  LCGPVIDDVKLLSVR  371



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF+VP GRRA+EL+AGKESA+AQ+  T  G+ Y LTF VGD +N 
Sbjct  194  WIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNG  253

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ +EAFAG+ T+KVPYESKGKGGFK A+L F A + RTR+MF ST Y   SD   S
Sbjct  254  CEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGS  313

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLS+R
Sbjct  314  LCGPVIDDVKLLSIR  328



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RTI  K Y++TF++GDA N 
Sbjct  251  WIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDARNG  310

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M+VEAFA + T+KVP+ S+GKG FK A L FKA   RTRI F+S+YYHTRSDDF S
Sbjct  311  CNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDFGS  370

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR+  +
Sbjct  371  LCGPVLDEVRVYPI  384



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VG+ASN+
Sbjct  198  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNT  257

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            C GS++VEA+AG+ + KVPYES G+GG  K A L F+AT++RTR++FFS++Y+TR+DD  
Sbjct  258  CRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMS  317

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  318  SLCGPVIDDVAVVSVR  333



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RTI  K Y++TF++GDA N 
Sbjct  251  WIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNG  310

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M+VEAFA + T+KVP+ S+GKG FK A L FKA   RTR+ F+S+YYHTRSDDF S
Sbjct  311  CNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGS  370

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR+  +
Sbjct  371  LCGPVLDEVRVYPI  384



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F+VGDA N 
Sbjct  160  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  219

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP+ES G GGFKPA  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  220  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  279

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V++  ++
Sbjct  280  LCGPVLDQVKVQPLK  294



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID +HF+VP G  AVELVAG+ESAIAQI RTI  K+Y LTF VGDA N 
Sbjct  231  WMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP+ESKGKG FK    +FKA   RTRI F+S+YYHTR DDF S
Sbjct  291  CHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGS  350

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  +
Sbjct  351  LCGPILDEVRVFPI  364



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HF+VP GRRA+EL+AGKESA+AQ+  T  G+ Y LTF VGD +N 
Sbjct  234  WIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNG  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ +EAFAG+ T+KVPYESKGKGGFK A+L F A + RTR+MF ST Y   SD   S
Sbjct  294  CEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGS  353

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLS+R
Sbjct  354  LCGPVIDDVKLLSIR  368



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP GRRA+ELVAGKESA+AQ+  T+ GK+Y LTF VGD++N+
Sbjct  236  WIIESLKAVKYIDSKHFSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNA  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS+ VEAFAG+ TLKV Y+SKG+GGFK A+  F A   RTR+MF+S +Y   +D   S
Sbjct  296  CEGSLAVEAFAGKDTLKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSGS  355

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  356  LCGPVIDDVKLLSVR  370



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+YID++HF+VP G+RAVELVAG+ES++AQ+ +T+ GK YDL F VGDA N 
Sbjct  232  WMVESLKAVRYIDSDHFAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNM  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM+VE  A  ST  VPYESKGKGG K A LRFKA   RTRI F S+YYH +SD   S
Sbjct  292  CEGSMLVEVNASNSTFYVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSGS  351

Query  416  LCGPVVDHVRLLSVRH  369
            LCGPVVD VRL+ V H
Sbjct  352  LCGPVVDGVRLVRVPH  367



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID +HF+VP G  AVELVAG+ESAIAQI RTI  K+Y LTF +GDA N 
Sbjct  231  WMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP+ESKGKG FK    +FKA   RTRI F+S+YYHTR DDF S
Sbjct  291  CHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGS  350

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  +
Sbjct  351  LCGPILDEVRVFPI  364



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RTI  K Y++TF++GDA N 
Sbjct  280  WIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNG  339

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M+VEAFA + T+KVP+ S+GKG FK A L FKA   RTR+ F+S+YYHTRSDDF S
Sbjct  340  CNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGS  399

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR+  +
Sbjct  400  LCGPVLDEVRVYPI  413



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID +HF+VP G  AVELVAG+ESAIAQI RTI  K+Y LTF +GDA N 
Sbjct  231  WMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP+ESKGKG FK    +FKA   RTRI F+S+YYHTR DDF S
Sbjct  291  CHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGS  350

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D VR+  +
Sbjct  351  LCGPILDEVRVFPI  364



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV+YIDA HFSVP G  AVELVAG+ESAIAQ+ RT+  + Y+++F VGDA N 
Sbjct  258  WIIESLKAVRYIDAAHFSVPSGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAKNG  317

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  TLKVP+ES GKGGFK A LRF A   RTR+ F+S+YYHT++ D VS
Sbjct  318  CHGSMLVEAFAGNVTLKVPFESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDGVS  377

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V++  ++
Sbjct  378  LCGPVLDQVKIQPLK  392



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID +HF+VP G  AVELVAG+ESAIAQ+ RT+  K Y+LTF VGDA N 
Sbjct  233  WIIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDARNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVP++S+GKG FK A L+FKA + RTR+ FFS++YHTR DDF S
Sbjct  293  CHGSMMVEAFAAKDTLKVPFQSQGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDFGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VR++ +
Sbjct  353  LCGPVLDEVRVVPL  366



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID+ HF+VP G+RA+ELVAGKESA+AQ+  T  G++Y LTF VGD+ NS
Sbjct  237  WIIESLKAVKYIDSNHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNS  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VEAFAG+ TLKVPYES GKGGFK A+L F A    TR+MF S++Y   +D   S
Sbjct  297  CEGSLVVEAFAGKDTLKVPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHSGS  356

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  357  LCGPVIDDVKLLSVR  371



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HF VP G  A+ELVAG+ESAIAQI RTI  K Y+LTF +GDA N+
Sbjct  248  WIIESLKPVKYIDKKHFQVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNA  307

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPY S+GKGGFK A  +F+AT+ RTRI F+S YYHT+  DF  
Sbjct  308  CHGSMMVEAFAGKETLKVPYMSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGH  367

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D+V +L V
Sbjct  368  MCGPVLDNVIVLPV  381



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W +DSLKAVKYID++HF VP G+RA+ELV GKES+IAQI RT  GK Y LTF VGDA NS
Sbjct  236  WIIDSLKAVKYIDSDHFHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNS  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS+ +EAFAG  T KV Y S G GGFK AKLRFKAT  RTR+MFFST+Y   SD+  +
Sbjct  296  CVGSLGIEAFAGNGTTKVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSGT  355

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGP +D V+L+SVR P
Sbjct  356  LCGPTLDDVKLISVRTP  372



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F+VGDA N 
Sbjct  228  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  287

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP+ES G GGFKPA  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  288  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  347

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V++  ++
Sbjct  348  LCGPVLDQVKVQPLK  362



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D+EHFSVP G+RAVEL+AG+ESAIAQI +TI G  YDL F VGDA N 
Sbjct  194  WIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAKNG  253

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGSM++EA AG+ TL+VPY+S GKG F  A  RF+A + RTR+ F S  YH RSD+  +
Sbjct  254  CEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNTGT  313

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VRL S+R
Sbjct  314  LCGPVIDDVRLYSLR  328



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID+ HF+VP G+ AVELVAG+ESAIAQI RT+  K+Y L+F VGDA N 
Sbjct  235  WIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVP+ SKGKGGFK A  RFKA + RTRI FFS+YYHT+  D+ +
Sbjct  295  CQGSMMVEAFAGKDTLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSYYHTK--DYGA  352

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D V++  V
Sbjct  353  LCGPILDEVKVSPV  366



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VGDASN 
Sbjct  158  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  217

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            CEGS++VEA+AG+ + +V +ES G+GG  K A L F+A A RTR++FFS++Y TRSDD  
Sbjct  218  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  277

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  278  SLCGPVIDDVAVVSVR  293



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+K+ID+EHFSVP G+RA+EL+AGKES + QI +T +G+ Y L+F+VGDA+N 
Sbjct  235  WIIESLKAIKHIDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M+VEAFAG++ + V Y SKGKGGFK A+L F+A + RTRI F+ST Y  +SD+  S
Sbjct  295  CEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNSGS  354

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  355  LCGPVLDDVKLLSVR  369



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  A+ELVAG+ESA+AQI RTI  K+Y L F VGDA N 
Sbjct  234  WIIESLKAVKFIDSKHFNVPDGEAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAKNG  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T+KVP++S+GKG +K A L+F AT+ RTRI FFS+YYHTR+DDF S
Sbjct  294  CHGSMMVEAFAAKETVKVPFQSEGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDFGS  353

Query  416  LCGPVVDHVRL  384
            LCGPV+D V +
Sbjct  354  LCGPVLDDVSV  364



>gb|AFK44456.1| unknown [Lotus japonicus]
Length=177

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RT   K+Y++TF VGDA N 
Sbjct  43   WIIESLKAVKFIDAKHFNVPFGLGAVELVAGRESAIAQIIRTEANKVYNITFSVGDAKNG  102

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S GKG F      FKA A RTR+ F+S+YYHTR+DDF S
Sbjct  103  CHGSMMVEAFAAKDTFKVPFKSVGKGKFVTVSFEFKAIAPRTRLTFYSSYYHTRTDDFGS  162

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  163  LCGPVLDRVIVFPV  176



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKA+KYID++ F+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VGDASN+
Sbjct  225  WMVESLKAIKYIDSDSFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNA  284

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEA+AG+ + KV YES GKGG K A L F+A + RTR++FFS++Y TRSDD  S
Sbjct  285  CRGSLMVEAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSS  344

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V ++SVR
Sbjct  345  LCGPVLDDVAVVSVR  359



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F+VGDA N 
Sbjct  258  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  317

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP+ES G GGFKPA  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  318  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  377

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V++  ++
Sbjct  378  LCGPVLDQVKVQPLK  392



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F VGDA N 
Sbjct  251  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNG  310

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP+ES GKGGFK A  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  311  CHGSMLVEAFAGNVTQKVPFESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDGVS  370

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+++ V+
Sbjct  371  LCGPVLDQVKVVPVK  385



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKY+D  HF+VP G RA+ELV GKES++AQI RT   K Y LTF VGDA NS
Sbjct  227  WIVESLKAVKYVDKAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGNS  286

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M VEAFAG+  + V Y S GKGG KPA+L FKA + RTR+ F ST+YHT+SD   S
Sbjct  287  CEGPMAVEAFAGRGRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHSGS  346

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VRL+ VR
Sbjct  347  LCGPVIDDVRLVPVR  361



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID+ HF+VP G+ AVELVAG+ESAIAQI RT+  K+Y L+F VGDA N 
Sbjct  235  WIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVP+ SKGKGGFK A  RFKA + RTRI FFS++YHT+  D+ +
Sbjct  295  CQGSMMVEAFAGKETLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSFYHTK--DYGA  352

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D V++  V
Sbjct  353  LCGPILDEVKVSPV  366



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID  HF+VP GR A+ELVAG+ESAIAQ+ RT+  K+Y+LTF +GDA NS
Sbjct  234  WVIESLKAVKYIDKRHFNVPFGRSAIELVAGRESAIAQVIRTVPNKVYNLTFTIGDAKNS  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLK P+ S+G G F+   ++FKA ++RTRI FFS+YYH+++D F  
Sbjct  294  CKGSMLVEAFAGRDTLKAPFLSQGLGKFQTVSMKFKAISDRTRITFFSSYYHSKADGFGI  353

Query  416  LCGPVVDHVRLL  381
            LCGPV+D VR+ 
Sbjct  354  LCGPVLDEVRVF  365



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VGDASN 
Sbjct  235  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            CEGS++VEA+AG+ + +V +ES G+GG  K A L F+A A RTR++FFS++Y TRSDD  
Sbjct  295  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  354

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  355  SLCGPVIDDVAVVSVR  370



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID +HF+VP G  AVEL+AG+ESAIAQ+ RT+  K+Y+LTF +GD  N 
Sbjct  232  WIIESLKAVKFIDKKHFNVPFGLAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGKNG  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G M++EAFA + + K P++S+GKG FK    +FKA A RTR+ FFS++YHTR DDF S
Sbjct  292  CHGDMMIEAFAAKDSFKAPFKSRGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDFGS  351

Query  416  LCGPVVDHVRLLSVRHP  366
            LCGPV+D VR+ S+R P
Sbjct  352  LCGPVLDQVRVFSIRKP  368



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV+YIDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+++VGDA N 
Sbjct  262  WIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNG  321

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA   T KVP+ES GKGGFK A LRF A   RTR+ F+S+YYHT+  D VS
Sbjct  322  CHGSMLVEAFAANVTQKVPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTDGVS  381

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+++ ++
Sbjct  382  LCGPVLDQVKIVPMK  396



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+K+IDA+HF+VP G+ AVELVAG+ESAIAQ+ RT+  K+Y L+F VGDA N 
Sbjct  235  WIIESLKAIKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTVGDARNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ SKGKGGFK A  RFKA + RTRI FFS++YHT+  D+ +
Sbjct  295  CHGSMMVEAFAGKETLKVPFTSKGKGGFKTASFRFKAVSIRTRITFFSSFYHTK--DYGA  352

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D V++  V
Sbjct  353  LCGPILDEVKVSPV  366



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV+YIDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+++VGDA N 
Sbjct  258  WIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNG  317

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA   T KVP+ES GKGGFK + LRF A   RTR+ F+S+YYHT+  D VS
Sbjct  318  CHGSMLVEAFAANVTQKVPFESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDGVS  377

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+++ ++
Sbjct  378  LCGPVLDQVKIVPLK  392



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VGDASN 
Sbjct  221  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  280

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            CEGS++VEA+AG+ + +V +ES G+GG  K A L F+A A RTR++FFS++Y TRSDD  
Sbjct  281  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  340

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  341  SLCGPVIDDVAVVSVR  356



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP G RA+ELV GKESA+AQ+  T+ GK+Y LTF VGD++N+
Sbjct  225  WIIESLKAVKYIDSKHFSVPEGWRAIELV-GKESALAQVVFTLPGKLYALTFTVGDSNNA  283

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEGS++VEAFAG+  LKVPY+SKG+GGFK  +  F A   RTRIMF+ST+Y   +D   S
Sbjct  284  CEGSLVVEAFAGKDILKVPYQSKGRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADHSGS  343

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LLSVR
Sbjct  344  LCGPVIDDVKLLSVR  358



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAVKYID++HF+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F VGDASN 
Sbjct  235  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGG-FKPAKLRFKATANRTRIMFFSTYYHTRSDDFV  420
            CEGS++VEA+AG+ + +V +ES G+GG  K A L F+A A RTR++FFS++Y TRSDD  
Sbjct  295  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  354

Query  419  SLCGPVVDHVRLLSVR  372
            SLCGPV+D V ++SVR
Sbjct  355  SLCGPVIDDVAVVSVR  370



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID +HFSVP GRRAVELVAGKESA+ Q+ +T V K Y L+F VGDA N 
Sbjct  233  WIIESLKAVKYIDLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G++ VEA+AG+  +KV Y SKGKGGFK A LRFKA + RTRIMF ST+Y+ +SD   S
Sbjct  293  CAGTLGVEAYAGRDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGS  352

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+LL  R
Sbjct  353  LCGPVIDDVKLLVAR  367



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID++HF VP G  A+E+VAG+ESAIAQI RTI  K Y+L+F +GDA N+
Sbjct  235  WIIESLKPVKYIDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAKNA  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPY S+GKGG+K A LRFKA ++RTRI F+S YYHT+  D+  
Sbjct  295  CHGSMMVEAFAGRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYHTKLHDYGH  354

Query  416  LCGPVVDHVRLL  381
            +CGPV+D VR+ 
Sbjct  355  MCGPVLDDVRVF  366



>gb|KJB36028.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36029.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36030.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
Length=371

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VK+ID +HFSVP G+ A+E+VAG+ESAIAQ+ RT+  K Y LTF VGDA N 
Sbjct  237  WIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTVPNKDYTLTFTVGDAKND  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPY S+GKGGFK +  RF+A + RTRI F+S YYHT+  DF  
Sbjct  297  CHGSMMVEAFAGKGTLKVPYVSQGKGGFKTSSFRFQAISARTRITFYSAYYHTKLHDFGH  356

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D V++L V
Sbjct  357  MCGPVLDDVKVLPV  370



>ref|NP_001144239.1| uncharacterized protein LOC100277106 precursor [Zea mays]
 gb|ACG38935.1| hypothetical protein [Zea mays]
Length=390

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F VGDA N 
Sbjct  255  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNG  314

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP++S GKGGFK A  RF A+  RTR+ F+S+YYHT+  D VS
Sbjct  315  CHGSMLVEAFAGNVTQKVPFDSTGKGGFKTAAFRFVASGVRTRLTFYSSYYHTKVTDGVS  374

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+++ V+
Sbjct  375  LCGPVLDQVKVVPVK  389



>gb|KHG07966.1| Imidazolonepropionase [Gossypium arboreum]
Length=371

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VK+ID +HFSVP G+ A+E+VAG+ESAIAQ+ RT   K Y LTF VGDA N 
Sbjct  237  WIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTAPNKDYTLTFTVGDAKND  296

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVPY S+GKGGFK A  RF+A + RTRI F+S YYHT+  DF  
Sbjct  297  CHGSMMVEAFAGKGTLKVPYVSQGKGGFKTASFRFQAISARTRITFYSAYYHTKLHDFGH  356

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D V++L V
Sbjct  357  MCGPVLDDVKVLPV  370



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F VGDA N 
Sbjct  252  WIIESLKAVRFIDAAHFSVPEGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNG  311

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP+ES GKG FK A  RF A+  RTR+ F+S+YYHT++ D VS
Sbjct  312  CHGSMLVEAFAGNVTQKVPFESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDGVS  371

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V+++ +
Sbjct  372  LCGPVLDQVKVVPL  385



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D  HF+VP G RA+ELVAGKESAI+QI RT + + Y LTF VGDA ++
Sbjct  231  WIIESLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDT  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG MIVEAFAG+S + V Y SKGKGGF   KL FKA + RTR+ F ST+YH +SD   S
Sbjct  291  CEGPMIVEAFAGRSKIMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSGS  350

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VRL+++R
Sbjct  351  LCGPVIDDVRLVAIR  365



>gb|KJB19256.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=307

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HFSVP G  AVELVAG+ESAIAQI RT+  K Y LTF VGDA N 
Sbjct  173  WIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKNG  232

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+V+AFAG+ TL+VPY S+GKGG K A  RF+A + RTRI FFS YYHT+ DD+  
Sbjct  233  CHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYGH  292

Query  416  LCGPVVDHV  390
            +CGPV+D V
Sbjct  293  ICGPVLDDV  301



>gb|AGV54808.1| hypothetical protein [Phaseolus vulgaris]
Length=367

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQ+ RT   K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDSKHFNVPFGLGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S+GKG F+    +FKA A RTR+ F+S++YHTRSDD+ S
Sbjct  293  CNGSMMVEAFAAKDTFKVPFKSEGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVFPV  366



>ref|XP_007148907.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
 gb|ESW20901.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
Length=367

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQ+ RT   K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDSKHFNVPFGLGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S+GKG F+    +FKA A RTR+ F+S++YHTRSDD+ S
Sbjct  293  CNGSMMVEAFAAKDTFKVPFKSEGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVFPV  366



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLKAV+Y+D   F+VP GRRAVEL+AG+E A+AQ+ RT+ G+ Y L+F VGDA N+
Sbjct  236  WMVESLKAVRYVDGGSFAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNA  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GS++VEA+AG+ ++KV YES+GKGG + A L F+A A RTRI+FFS++Y TRSDD  S
Sbjct  296  CRGSLVVEAYAGRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSS  355

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V ++SVR
Sbjct  356  LCGPVLDDVAVVSVR  370



>tpg|DAA52069.1| TPA: hypothetical protein ZEAMMB73_133538 [Zea mays]
Length=390

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAV++IDA HFSVP G+ AVELVAG+ESAIAQ+ RT+  + Y+L+F VGDA N 
Sbjct  255  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNG  314

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG  T KVP++S GKGGFK A  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  315  CHGSMLVEAFAGNVTQKVPFDSAGKGGFKTAAFRFVAGGVRTRLTFYSSYYHTKVTDGVS  374

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D V+++ V+
Sbjct  375  LCGPVLDQVKVVPVK  389



>ref|XP_010241208.1| PREDICTED: uncharacterized protein LOC104585885 [Nelumbo nucifera]
Length=366

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID++HFSVP G  A+ELVAG+ESAIAQ+ RT+ GK+Y+LTF VGDA N 
Sbjct  232  WIIESLKAVKYIDSKHFSVPSGFAAIELVAGRESAIAQVLRTVPGKLYELTFTVGDAKNG  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA   TLKVP++S     FK A L+FKA   RTRI F+S +YHT+  D+ +
Sbjct  292  CYGSMMVEAFAANETLKVPFQSHASSRFKTASLKFKALEPRTRITFYSGFYHTKLHDYGT  351

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+DHVR+  V
Sbjct  352  LCGPVLDHVRVFPV  365



>ref|NP_001239749.1| uncharacterized protein LOC100804119 precursor [Glycine max]
 gb|ACU23170.1| unknown [Glycine max]
 gb|KHM99195.1| hypothetical protein glysoja_035460 [Glycine soja]
Length=367

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQI RT+  K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDSKHFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T K P++S+GKG FK    +FKA A RTR+ F+S++YHTR DD+ S
Sbjct  293  CHGSMMVEAFAAKDTFKAPFKSEGKGTFKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPVVD V +  V
Sbjct  353  LCGPVVDQVIVFPV  366



>gb|KJB19257.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=341

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HFSVP G  AVELVAG+ESAIAQI RT+  K Y LTF VGDA N 
Sbjct  207  WIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKNG  266

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+V+AFAG+ TL+VPY S+GKGG K A  RF+A + RTRI FFS YYHT+ DD+  
Sbjct  267  CHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYGH  326

Query  416  LCGPVVDHV  390
            +CGPV+D V
Sbjct  327  ICGPVLDDV  335



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID+ HF+VP G+ AVELVAG+ESAIAQI RT+  K+Y L+F VGDA N 
Sbjct  235  WIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C+GSM+VEAFAG+ TLKVP+ SKGK GFK A  RFKA + RTRI FFS++YHT+  D+ +
Sbjct  295  CQGSMMVEAFAGKDTLKVPFASKGKCGFKKASFRFKAVSIRTRITFFSSFYHTK--DYGA  352

Query  416  LCGPVVDHVRLLSV  375
            LCGP++D V++  V
Sbjct  353  LCGPILDEVKVSPV  366



>gb|AFK39148.1| unknown [Lotus japonicus]
Length=367

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RT   K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDAKHFNVPFGLGAVELVAGRESAIAQIIRTETNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S GKG F     +FKA A RTR+ F+S+YYHTR+DDF S
Sbjct  293  CHGSMMVEAFAAKDTFKVPFKSVGKGKFVTVSFKFKAIAPRTRLTFYSSYYHTRTDDFGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVLDRVIVFPV  366



>gb|AFK34548.1| unknown [Lotus japonicus]
Length=367

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G  AVELVAG+ESAIAQI RT   K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDAKHFNVPFGLGAVELVAGRESAIAQIIRTETNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S GKG F     +FKA A RTR+ F+S+YYHTR+DDF S
Sbjct  293  CHGSMMVEAFAAKDTFKVPFKSVGKGKFVTVSFKFKAIAPRTRLTFYSSYYHTRTDDFGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVLDRVIVFPV  366



>ref|XP_008392232.1| PREDICTED: uncharacterized protein LOC103454416 [Malus domestica]
Length=366

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HF+VP G  A+ELVAG+ESAIAQI RT+  K Y+L F +GDA N 
Sbjct  232  WIIESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNG  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S GKGGFK A L+F+AT+ RTR+ F+S YYHT+ DD+  
Sbjct  292  CHGSMMVEAFAGKETLKVPFVSAGKGGFKTAILKFQATSFRTRLTFYSAYYHTKLDDYGH  351

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D+V +  V
Sbjct  352  MCGPVLDNVIVFPV  365



>ref|XP_010057181.1| PREDICTED: uncharacterized protein LOC104445070 [Eucalyptus grandis]
 gb|KCW90190.1| hypothetical protein EUGRSUZ_A02362 [Eucalyptus grandis]
Length=370

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++S+K VKY+D +HF VP G  AVELVAG+ESA+AQI RT+  K Y+LTF VGDA N 
Sbjct  236  WIIESMKPVKYVDRKHFFVPSGLAAVELVAGRESAMAQIIRTVPNKFYNLTFTVGDAKNG  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVPYES  KGG K A L+F+AT+ RTRI FFS YYHT+  D+  
Sbjct  296  CHGSMMVEAFAAKDTLKVPYESTSKGGSKTANLKFQATSTRTRITFFSAYYHTKLHDYGH  355

Query  416  LCGPVVDHVRLLSVR  372
            +CGPV+D V+++ V+
Sbjct  356  MCGPVLDDVKVVPVK  370



>gb|EYU43005.1| hypothetical protein MIMGU_mgv1a011073mg [Erythranthe guttata]
Length=293

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G+ AVELVAG+ESAIAQI RT+  K+Y+L+F+VGDA N 
Sbjct  157  WIIESLKAVKFIDSKHFNVPFGKSAVELVAGRESAIAQIIRTVPNKVYNLSFVVGDAKNG  216

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA ++T K  ++S+GKG F     +F A ++RTR+ FFS++YHTR DDF S
Sbjct  217  CHGSMLVEAFAAKTTSKAQFKSEGKGKFSTYNFQFTAVSDRTRLTFFSSFYHTRIDDFGS  276

Query  416  LCGPVVDHVRLL  381
            LCGPV+D VR+ 
Sbjct  277  LCGPVLDEVRVF  288



>ref|XP_003605795.1| hypothetical protein MTR_4g039740 [Medicago truncatula]
 gb|AES87992.1| DUF642 family protein [Medicago truncatula]
Length=367

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKA+K+ID+ HF VP G+ AVELVAG+ESAIAQI RT+  K+Y+L F VGD  N 
Sbjct  233  WIIESLKAIKFIDSNHFQVPFGKGAVELVAGRESAIAQILRTVTNKVYNLKFTVGDGRNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVP++S GKG FK A   FKA +NRTRI F+S++YHT+ DD+ S
Sbjct  293  CHGSMMVEAFAARETLKVPFKSVGKGIFKTANFNFKAVSNRTRITFYSSFYHTKIDDYGS  352

Query  416  LCGPVVDHV  390
            +CGPV+D V
Sbjct  353  MCGPVLDQV  361



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++S+KAV+Y+D+ HF+VP G  AVELVAG+ESAIAQ+ RT+  K+Y L+F+VGDA N 
Sbjct  236  WIIESIKAVRYLDSHHFTVPLGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAKNG  295

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ T+KVP+ES+G+GG+K  K+RF A   RTRI FFS++YHT+ DD  +
Sbjct  296  CHGSMLVEAFAGKDTVKVPFESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDPGT  355

Query  416  LCGPVVDHVRL  384
            +CGP+VD V++
Sbjct  356  MCGPIVDEVKV  366



>gb|KDP26060.1| hypothetical protein JCGZ_21093 [Jatropha curcas]
Length=370

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HFSVP G  A+ELVAG+ESA+AQ+ RT+  K Y+LTF +GDA N 
Sbjct  235  WIIESLKPVKYIDNKHFSVPSGFAAIELVAGRESALAQVIRTVANKFYNLTFTIGDAKNG  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVP+ES+ KG FK A  +F+A +NRTRI F+S  YHT+  DF  
Sbjct  295  CHGSMVVEAFAAKETLKVPFESQSKGEFKTASFKFQAISNRTRITFYSANYHTKLHDFGH  354

Query  416  LCGPVVDHVRLLSVRH  369
            +CGP++D+V +  +R+
Sbjct  355  MCGPILDNVSVFPIRY  370



>ref|XP_010257158.1| PREDICTED: uncharacterized protein LOC104597378 [Nelumbo nucifera]
Length=367

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            WTV SLKAVKYID++HFSVP G  A+ELVAG+ESAI+Q+ RT+ GK Y+LTF VGDA N 
Sbjct  233  WTVVSLKAVKYIDSKHFSVPSGFAAIELVAGRESAISQVLRTVPGKSYNLTFTVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVP+++ G   FK   L+FKA   RTRI F+S +YHT+  D+ +
Sbjct  293  CHGSMMVEAFAAKETLKVPFQAHGGSKFKTVSLKFKAVEPRTRITFYSGFYHTKLHDYGT  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+DHVR+  V
Sbjct  353  LCGPVLDHVRVFPV  366



>gb|KHN45084.1| hypothetical protein glysoja_040000 [Glycine soja]
Length=367

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQI RT+  K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDSKHFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S+GKG  K    +FKA A RTR+ F+S++YHTR DD+ S
Sbjct  293  CHGSMMVEAFAAKDTFKVPFKSEGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVFPV  366



>ref|NP_001241275.1| uncharacterized protein LOC100796094 precursor [Glycine max]
 ref|XP_006597038.1| PREDICTED: uncharacterized protein LOC100796094 isoform X1 [Glycine 
max]
 gb|ACU18215.1| unknown [Glycine max]
Length=367

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID++HF+VP G  AVELVAG+ESAIAQI RT+  K+Y++TF VGDA N 
Sbjct  233  WIIESLKAVKFIDSKHFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + T KVP++S+GKG  K    +FKA A RTR+ F+S++YHTR DD+ S
Sbjct  293  CHGSMMVEAFAAKDTFKVPFKSEGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVFPV  366



>ref|XP_009355525.1| PREDICTED: uncharacterized protein LOC103946533 [Pyrus x bretschneideri]
Length=367

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W V+SLK VKYID +HF+VP G  A+ELVAG+ESAIAQI RT+  K Y+L F +GDA N 
Sbjct  233  WIVESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLK P+ S GKGGFK A L+F+AT+ RTR+ F+S YYHT+ DD+  
Sbjct  293  CHGSMMVEAFAGKETLKAPFVSAGKGGFKTAILKFQATSIRTRLTFYSAYYHTKLDDYGH  352

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D+V +  V
Sbjct  353  MCGPVLDNVIVFPV  366



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D  HF+VP G RA+ELV GKESAI+QI RT + K Y LTF VGDA + 
Sbjct  233  WMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG M VEAFAGQ  + V Y SKGKGGF+  +L FKA + RTR+ F ST+YH +SD   S
Sbjct  293  CEGPMTVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGS  352

Query  416  LCGPVVDHVRLLSVR  372
            LCGPV+D VRL++VR
Sbjct  353  LCGPVIDDVRLVAVR  367



>ref|XP_002313314.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
 gb|EEE87269.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
Length=365

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+ID  HF+VP G  AVELVAG+ESAIAQI RT   K+Y L F +GDA N 
Sbjct  231  WIIESLKAVKFIDKRHFNVPFGLAAVELVAGRESAIAQILRTTPNKVYSLAFTIGDARNG  290

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA   T KVP+ESKGKG  K A  +FKA + RTRI F+S+YYHTR DD+ S
Sbjct  291  CHGSMMVEAFAAGDTFKVPFESKGKGESKSASFKFKAISARTRITFYSSYYHTRIDDYGS  350

Query  416  LCGPVVDHVRL  384
            LCGP++D VR+
Sbjct  351  LCGPILDEVRV  361



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKY+D  HF+VP G RA+ELV GKESAI+QI RT + K Y LTF VGDA + 
Sbjct  232  WMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARDG  291

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            CEG MIVEAFAGQ  + V Y SKGKGGF+  +L FKA + RTR+ F ST+YH +SD   S
Sbjct  292  CEGPMIVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGS  351

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D VRL++V
Sbjct  352  LCGPVIDDVRLVAV  365



>ref|XP_003534397.1| PREDICTED: uncharacterized protein LOC100812299 [Glycine max]
Length=367

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G+ AVEL+AG+ES IAQI RT+  KIY++ F +GDA N 
Sbjct  233  WMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM++EAFA + TLKVP++S+GKG FK    +F+A  NRTRI F+S++YHTR  D+ S
Sbjct  293  CHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVYPV  366



>gb|KHN11697.1| hypothetical protein glysoja_006150 [Glycine soja]
Length=367

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVK+IDA+HF+VP G+ AVEL+AG+ES IAQI RT+  KIY++ F +GDA N 
Sbjct  233  WMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM++EAFA + TLKVP++S+GKG FK    +F+A  NRTRI F+S++YHTR  D+ S
Sbjct  293  CHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYGS  352

Query  416  LCGPVVDHVRLLSV  375
            LCGPV+D V +  V
Sbjct  353  LCGPVIDQVIVYPV  366



>ref|XP_002308027.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
 gb|EEE91550.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
Length=369

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HF VP G  A+E+VAG+ESAIAQ+ RTI  K Y+LTF +GDA N+
Sbjct  235  WIIESLKPVKYIDNKHFFVPTGFAAIEMVAGRESAIAQVIRTIPDKFYNLTFTIGDAKNA  294

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFA + TLKVPY S+GKGG+K A LRF+A + RTRI F+S YYHT+  D+  
Sbjct  295  CHGSMMVEAFAARETLKVPYVSQGKGGYKTATLRFRAISARTRITFYSAYYHTKLHDYGH  354

Query  416  LCGPVVDHVRLL  381
            +CGPV+D VR+ 
Sbjct  355  MCGPVLDDVRVF  366



>gb|ACL52831.1| unknown [Zea mays]
Length=138

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  770  VDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNSCE  591
            V+SLKA+KYID E F+VP GRRAVEL+AG+ESAIAQ+ RT+ G+ Y L+F +GDASN+C 
Sbjct  2    VESLKAIKYIDGESFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYVLSFTIGDASNACR  61

Query  590  GSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVSLC  411
            GS++VEA+AG+ + KV YES GKGG K A L F+A + RTR++FFS++Y TRSDD  SLC
Sbjct  62   GSLMVEAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLC  121

Query  410  GP  405
            GP
Sbjct  122  GP  123



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLKAVKYID +HF VP GRRA+ELVAGKESA+ Q+ +T V K Y L+F VGDA N 
Sbjct  233  WIIESLKAVKYIDLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGNG  292

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C G++ VEA+AG+  +KV Y SKGKGGFK A LRFKA + RTRIMF ST+Y+ +SD   S
Sbjct  293  CAGTLGVEAYAGRENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGS  352

Query  416  LCGPVVDHVRLL  381
            LCGPV+D V+LL
Sbjct  353  LCGPVIDDVKLL  364



>ref|XP_007028767.1| F17A17.37 protein [Theobroma cacao]
 gb|EOY09269.1| F17A17.37 protein [Theobroma cacao]
Length=368

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -3

Query  776  WTVDSLKAVKYIDAEHFSVPHGRRAVELVAGKESAIAQITRTIVGKIYDLTFLVGDASNS  597
            W ++SLK VKYID +HFSVP G  A+ELVAG+ESA+AQ+ RT+  K Y L F VGDA N 
Sbjct  234  WIIESLKPVKYIDKKHFSVPSGLYAIELVAGRESAMAQVIRTVPNKFYTLAFTVGDAKNG  293

Query  596  CEGSMIVEAFAGQSTLKVPYESKGKGGFKPAKLRFKATANRTRIMFFSTYYHTRSDDFVS  417
            C GSM+VEAFAG+ TLKVP+ S+GKG FK A  +F+A + RTRI F+S YYHT+  DF  
Sbjct  294  CHGSMMVEAFAGKETLKVPFVSQGKGVFKTASFKFQAISARTRITFYSAYYHTKLHDFGH  353

Query  416  LCGPVVDHVRLLSV  375
            +CGPV+D VR+L V
Sbjct  354  MCGPVLDDVRVLPV  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730