BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014J24

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB22565.1|  hypothetical protein B456_004G054500                  75.1    3e-12   Gossypium raimondii
gb|KJB22563.1|  hypothetical protein B456_004G054500                  75.1    5e-12   Gossypium raimondii
gb|KGN47886.1|  hypothetical protein Csa_6G409920                     73.9    5e-12   Cucumis sativus [cucumbers]
ref|XP_004158630.1|  PREDICTED: serine/threonine-protein phosphat...  73.2    6e-12   
gb|EYU38112.1|  hypothetical protein MIMGU_mgv1a0013162mg             70.1    8e-12   Erythranthe guttata [common monkey flower]
gb|EPS64063.1|  serine/threonine-protein phosphatase                  70.9    1e-11   Genlisea aurea
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...  72.8    3e-11   Nicotiana sylvestris
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...  72.8    3e-11   Nicotiana tomentosiformis
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...  72.4    4e-11   Eucalyptus grandis [rose gum]
ref|XP_006366382.1|  PREDICTED: serine/threonine-protein phosphat...  70.5    4e-11   
gb|KJB22562.1|  hypothetical protein B456_004G054500                  72.0    4e-11   Gossypium raimondii
gb|KJB22561.1|  hypothetical protein B456_004G054500                  72.0    5e-11   Gossypium raimondii
gb|KJB22560.1|  hypothetical protein B456_004G054500                  72.0    5e-11   Gossypium raimondii
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1             71.6    6e-11   Gossypium arboreum [tree cotton]
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1             71.6    6e-11   Gossypium arboreum [tree cotton]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                  71.6    7e-11   
ref|XP_008777710.1|  PREDICTED: serine/threonine-protein phosphat...  71.2    8e-11   
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...  71.2    9e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...  71.2    1e-10   Solanum tuberosum [potatoes]
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  70.9    1e-10   
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...  70.5    2e-10   Sesamum indicum [beniseed]
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...  70.1    2e-10   Cucumis melo [Oriental melon]
emb|CDP03570.1|  unnamed protein product                              70.1    2e-10   Coffea canephora [robusta coffee]
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...  69.7    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...  69.7    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...  68.9    5e-10   Nelumbo nucifera [Indian lotus]
gb|AEK86563.1|  serine/threonine-protein phosphatase                  68.2    1e-09   Camellia sinensis [black tea]
dbj|BAK04150.1|  predicted protein                                    67.0    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169882.1|  uncharacterized protein LOC100383776             63.5    3e-09   
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...  65.9    4e-09   Populus euphratica
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...  65.9    4e-09   Populus euphratica
gb|EEE62303.1|  hypothetical protein OsJ_17091                        65.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...  65.5    6e-09   
ref|NP_001054625.1|  Os05g0144400                                     65.1    7e-09   
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...  65.1    8e-09   Brachypodium distachyon [annual false brome]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...  65.1    8e-09   Brachypodium distachyon [annual false brome]
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein        65.1    8e-09   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...  65.1    9e-09   Triticum urartu
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...  65.1    9e-09   Brachypodium distachyon [annual false brome]
gb|AFN44702.1|  Ser/Thr phosphatase-containing Kelch repeat domai...  64.3    1e-08   Nicotiana benthamiana
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...  64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY17964.1|  BnaC03g30360D                                        63.5    3e-08   Brassica napus [oilseed rape]
emb|CDX90906.1|  BnaA03g25860D                                        63.5    3e-08   
emb|CDX97296.1|  BnaA02g20870D                                        63.5    3e-08   
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...  63.5    3e-08   Brassica rapa
gb|AFK45415.1|  unknown                                               60.8    3e-08   Lotus japonicus
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...  63.5    3e-08   Tarenaya hassleriana [spider flower]
emb|CDY62088.1|  BnaC02g46770D                                        63.5    3e-08   Brassica napus [oilseed rape]
emb|CAC11128.1|  protein phosphatase                                  62.0    3e-08   Fagus sylvatica
gb|AAM83219.1|  AT4g03080/T4I9_4                                      63.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...  63.2    3e-08   Brassica rapa
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...  63.2    3e-08   
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                  63.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1           63.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...  63.2    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg           63.2    3e-08   Capsella rubella
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...  63.2    3e-08   
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg           63.2    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...  63.2    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006826451.1|  hypothetical protein AMTR_s00004p00179740        62.4    6e-08   
gb|EYU41290.1|  hypothetical protein MIMGU_mgv1a0202662mg             62.4    6e-08   Erythranthe guttata [common monkey flower]
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3        61.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3           61.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...  61.2    2e-07   Zea mays [maize]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...  61.2    2e-07   Zea mays [maize]
gb|EYU25965.1|  hypothetical protein MIMGU_mgv1a0006241mg             60.8    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...  61.2    2e-07   Glycine max [soybeans]
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440        60.8    2e-07   Sorghum bicolor [broomcorn]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...  60.8    2e-07   Glycine max [soybeans]
ref|XP_010647448.1|  PREDICTED: serine/threonine-protein phosphat...  60.5    2e-07   Vitis vinifera
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...  60.8    2e-07   Cicer arietinum [garbanzo]
ref|XP_001769730.1|  predicted protein                                60.8    2e-07   
gb|KGN66603.1|  hypothetical protein Csa_1G638500                     59.3    3e-07   Cucumis sativus [cucumbers]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  60.1    3e-07   Prunus mume [ume]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg           60.1    4e-07   Prunus persica
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2             60.1    4e-07   Glycine soja [wild soybean]
ref|XP_001760494.1|  predicted protein                                60.1    4e-07   
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g           60.1    4e-07   Phaseolus vulgaris [French bean]
emb|CBI24435.3|  unnamed protein product                              60.1    4e-07   Vitis vinifera
gb|KDO87444.1|  hypothetical protein CISIN_1g002713mg                 59.3    5e-07   Citrus sinensis [apfelsine]
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...  59.7    5e-07   Medicago truncatula
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg           59.7    5e-07   Eutrema salsugineum [saltwater cress]
emb|CAN67845.1|  hypothetical protein VITISV_016668                   59.3    5e-07   Vitis vinifera
ref|XP_003596905.1|  Serine/threonine protein phosphatase             59.7    5e-07   Medicago truncatula
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...  59.7    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...  59.7    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg           59.7    6e-07   
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...  59.7    6e-07   Glycine max [soybeans]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...  59.3    6e-07   
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    6e-07   Vitis vinifera
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    6e-07   Glycine max [soybeans]
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    6e-07   Fragaria vesca subsp. vesca
gb|KDP42962.1|  hypothetical protein JCGZ_23904                       59.3    6e-07   Jatropha curcas
gb|KDO87443.1|  hypothetical protein CISIN_1g002713mg                 59.3    6e-07   Citrus sinensis [apfelsine]
gb|KJB55562.1|  hypothetical protein B456_009G082300                  59.3    6e-07   Gossypium raimondii
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   
gb|KDO87442.1|  hypothetical protein CISIN_1g002713mg                 59.3    7e-07   Citrus sinensis [apfelsine]
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Eucalyptus grandis [rose gum]
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Prunus mume [ume]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Sesamum indicum [beniseed]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Sesamum indicum [beniseed]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_004170230.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    7e-07   
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    7e-07   Prunus mume [ume]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg           59.3    7e-07   Prunus persica
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...  59.3    8e-07   Pyrus x bretschneideri [bai li]
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    8e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001266004.1|  Hop-interacting protein THI129                   58.9    9e-07   Solanum lycopersicum
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    9e-07   Cicer arietinum [garbanzo]
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    9e-07   Fragaria vesca subsp. vesca
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...  58.9    1e-06   
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...  58.5    1e-06   
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...  58.5    1e-06   
emb|CDY57791.1|  BnaCnng32470D                                        58.5    1e-06   Brassica napus [oilseed rape]
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...  58.5    1e-06   
ref|XP_002513730.1|  bsu-protein phosphatase, putative                58.5    1e-06   
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    1e-06   
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    1e-06   
emb|CDY57485.1|  BnaAnng14650D                                        58.2    2e-06   Brassica napus [oilseed rape]
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    2e-06   Brassica rapa
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...  58.2    2e-06   Tarenaya hassleriana [spider flower]
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...  58.2    2e-06   Morella rubra [Chinese arbutus]
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    2e-06   Cucumis sativus [cucumbers]
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    2e-06   Cucumis melo [Oriental melon]
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4        57.8    2e-06   
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1        57.8    2e-06   
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...  57.8    2e-06   Tarenaya hassleriana [spider flower]
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...  57.8    3e-06   Gossypium arboreum [tree cotton]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg              57.4    3e-06   Erythranthe guttata [common monkey flower]
gb|KJB35468.1|  hypothetical protein B456_006G116600                  57.4    3e-06   Gossypium raimondii
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g           57.4    3e-06   Phaseolus vulgaris [French bean]
gb|KJB55561.1|  hypothetical protein B456_009G082300                  57.4    3e-06   Gossypium raimondii
gb|KJB55556.1|  hypothetical protein B456_009G082300                  57.4    3e-06   Gossypium raimondii
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...  57.4    3e-06   Gossypium arboreum [tree cotton]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    3e-06   Populus euphratica
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2             57.4    3e-06   Glycine soja [wild soybean]
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    3e-06   Populus euphratica
gb|KDP21537.1|  hypothetical protein JCGZ_22008                       57.4    3e-06   Jatropha curcas
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...  57.4    3e-06   Vitis vinifera
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...  57.4    3e-06   Populus euphratica
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g           57.0    3e-06   
ref|XP_002520710.1|  bsu-protein phosphatase, putative                57.0    4e-06   Ricinus communis
ref|XP_003591594.1|  Serine/threonine protein phosphatase             56.6    4e-06   
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...  57.0    4e-06   Sesamum indicum [beniseed]
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                 56.6    4e-06   Citrus sinensis [apfelsine]
ref|XP_002301559.1|  phosphatase family protein                       56.6    5e-06   
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg           56.6    5e-06   Citrus clementina [clementine]
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg           56.6    5e-06   Citrus clementina [clementine]
ref|NP_001266022.1|  Hop-interacting protein THI140                   56.6    5e-06   Solanum lycopersicum
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    6e-06   Glycine max [soybeans]
ref|XP_009606096.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    6e-06   
ref|XP_006367582.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    6e-06   Solanum tuberosum [potatoes]
ref|XP_009606099.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    7e-06   Nicotiana tomentosiformis
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    7e-06   Nelumbo nucifera [Indian lotus]
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    7e-06   Populus euphratica
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    7e-06   Populus euphratica
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...  56.2    8e-06   Nelumbo nucifera [Indian lotus]
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like   55.8    9e-06   Solanum tuberosum [potatoes]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...  55.8    1e-05   Solanum lycopersicum
gb|KJB35473.1|  hypothetical protein B456_006G116600                  55.8    1e-05   Gossypium raimondii
gb|KJB35470.1|  hypothetical protein B456_006G116600                  55.8    1e-05   Gossypium raimondii
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...  55.8    1e-05   Elaeis guineensis
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...  55.8    1e-05   Elaeis guineensis
gb|KJB35474.1|  hypothetical protein B456_006G116600                  55.5    1e-05   Gossypium raimondii
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...  55.5    1e-05   Nicotiana sylvestris
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  55.1    2e-05   Nicotiana sylvestris
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    2e-05   Nicotiana sylvestris
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    2e-05   
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  55.1    2e-05   Elaeis guineensis
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...  55.1    2e-05   Phoenix dactylifera
gb|ACR38393.1|  unknown                                               53.9    2e-05   Zea mays [maize]
ref|XP_003605992.1|  Serine/threonine protein phosphatase             55.1    2e-05   
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-05   
gb|KDO46579.1|  hypothetical protein CISIN_1g001895mg                 54.7    2e-05   Citrus sinensis [apfelsine]
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1             54.7    2e-05   Glycine soja [wild soybean]
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...  54.7    2e-05   Medicago truncatula
gb|KJB42021.1|  hypothetical protein B456_007G132700                  54.7    2e-05   Gossypium raimondii
ref|XP_002321044.2|  phosphatase family protein                       54.7    2e-05   
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-05   Glycine max [soybeans]
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-05   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-05   Phoenix dactylifera
dbj|BAF02235.1|  putative protein serine/threonine phosphatase alpha  54.7    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...  54.7    2e-05   Phoenix dactylifera
gb|AAF22889.1|AC006932_6  T27G7.10                                    54.7    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EPS70499.1|  hypothetical protein M569_04238                       54.7    3e-05   Genlisea aurea
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg           54.7    3e-05   Eutrema salsugineum [saltwater cress]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...  54.3    3e-05   Gossypium arboreum [tree cotton]
ref|XP_001765008.1|  predicted protein                                54.3    3e-05   
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    3e-05   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    3e-05   
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg           54.3    4e-05   
dbj|BAH19666.1|  AT1G08420                                            54.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2        54.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2           54.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg           54.3    4e-05   Citrus clementina [clementine]
ref|XP_002889692.1|  kelch repeat-containing protein                  53.9    4e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    4e-05   Sesamum indicum [beniseed]
ref|XP_007201685.1|  hypothetical protein PRUPE_ppa022807mg           53.9    4e-05   
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg           53.9    4e-05   Capsella rubella
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...  53.9    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010914371.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    4e-05   
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    4e-05   Solanum lycopersicum
emb|CDP15567.1|  unnamed protein product                              53.9    4e-05   Coffea canephora [robusta coffee]
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...  53.9    5e-05   
ref|NP_001067290.1|  Os12g0617900                                     53.9    5e-05   
gb|KJB21740.1|  hypothetical protein B456_004G011600                  53.9    5e-05   Gossypium raimondii
gb|EEE65895.1|  hypothetical protein OsJ_21718                        53.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AES61845.2|  serine/threonine-protein phosphatase                  53.9    5e-05   Medicago truncatula
ref|XP_003591586.1|  Serine/threonine protein phosphatase             53.5    5e-05   
ref|XP_010914369.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    5e-05   
ref|NP_001131445.1|  uncharacterized LOC100192777                     53.1    5e-05   
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    5e-05   Setaria italica
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    5e-05   
ref|XP_010914370.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    5e-05   
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    5e-05   Cicer arietinum [garbanzo]
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    6e-05   Nicotiana tomentosiformis
dbj|BAK06303.1|  predicted protein                                    53.1    6e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...  53.5    6e-05   Zea mays [maize]
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850        53.5    6e-05   Sorghum bicolor [broomcorn]
emb|CAC09573.1|  protein phosphatase 1 (PP1)                          50.8    7e-05   Fagus sylvatica
ref|XP_002313501.2|  kelch repeat-containing family protein           53.1    9e-05   
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    1e-04   Nelumbo nucifera [Indian lotus]
gb|EEE59591.1|  hypothetical protein OsJ_11899                        52.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    1e-04   Nicotiana tomentosiformis
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...  52.4    1e-04   Oryza brachyantha
gb|EEC75832.1|  hypothetical protein OsI_12812                        52.4    1e-04   Oryza sativa Indica Group [Indian rice]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...  52.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...  52.4    1e-04   Solanum tuberosum [potatoes]
ref|XP_009775149.1|  PREDICTED: serine/threonine-protein phosphat...  51.6    2e-04   Nicotiana sylvestris
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...  52.0    2e-04   Zea mays [maize]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...  52.0    2e-04   
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...  52.0    2e-04   Glycine max [soybeans]
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...  52.0    2e-04   Triticum urartu
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g           51.6    2e-04   Phaseolus vulgaris [French bean]
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...  51.6    2e-04   Sesamum indicum [beniseed]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    3e-04   Solanum lycopersicum
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    3e-04   Solanum tuberosum [potatoes]
ref|NP_001167772.1|  uncharacterized protein LOC100381465             48.9    4e-04   
ref|XP_009606098.1|  PREDICTED: serine/threonine-protein phosphat...  51.2    4e-04   
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...  50.8    5e-04   
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    8e-04   Phoenix dactylifera
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    8e-04   Nicotiana tomentosiformis
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...  50.1    8e-04   Nicotiana sylvestris
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932           50.1    9e-04   
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371           50.1    9e-04   
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...  49.7    0.001   Brachypodium distachyon [annual false brome]



>gb|KJB22565.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=538

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  461  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  520

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  521  PTRGRPQPDHDRSSLAYI  538



>gb|KJB22563.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
 gb|KJB22564.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=670

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  593  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  652

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  653  PTRGRPQPDHDRSSLAYI  670



>gb|KGN47886.1| hypothetical protein Csa_6G409920 [Cucumis sativus]
Length=394

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP+T PER+ EDTWMQELNIQRP T
Sbjct  317  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRPPT  376

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  377  PTRGRPQPDLDRSSLAYI  394



>ref|XP_004158630.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Cucumis 
sativus]
Length=321

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP+T PER+ EDTWMQELNIQR  T
Sbjct  244  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRRPT  303

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  304  PTRGRPQPDLDRSSLAYI  321



>gb|EYU38112.1| hypothetical protein MIMGU_mgv1a0013162mg, partial [Erythranthe 
guttata]
Length=144

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGR LVIVPKLIHPLPP   SP+T PERV ++TWMQELNIQRP T
Sbjct  67   TNYCGTANNAGAILVVGRELVIVPKLIHPLPPPFQSPETSPERVTDETWMQELNIQRPPT  126

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP+ DR+SLAYI
Sbjct  127  PTRGRPQPELDRSSLAYI  144



>gb|EPS64063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=212

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PE   ++TWMQELNIQRP T
Sbjct  135  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPEHAADETWMQELNIQRPPT  194

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  195  PTRGRPQPDLDRNSLAYI  212



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PERV EDTWMQELNIQRP T
Sbjct  802  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQRPPT  861

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  862  PTRGRPQPDHDRSSLAYI  879



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PERV EDTWMQELNIQRP T
Sbjct  802  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQRPPT  861

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  862  PTRGRPQPDHDRSSLAYI  879



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PERV EDTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  870  PTRGRPQPDLDRSSLAYI  887



>ref|XP_006366382.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Solanum 
tuberosum]
Length=293

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP LLSP+T PERV +D WMQELNIQRP T
Sbjct  216  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQRPPT  275

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  276  PTRGRPQPDHDRSSLAYI  293



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  814  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  873

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  874  PTRGRPQPDHDRSSLAYI  891



>gb|KJB22561.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=777

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  700  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  759

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  760  PTRGRPQPDHDRSSLAYI  777



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  870  PTRGRPQPDHDRSSLAYI  887



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  750  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  809

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  810  PTRGRPQPDHDRSSLAYI  827



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  777  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQRPPT  836

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  837  PTRGRPQPDHDRSSLAYI  854



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVADDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  870  PTRGRPQPDLDRSSLAYI  887



>ref|XP_008777710.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=552

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRG V+VPKLIHPLPP L SPD+ P+ V EDTWMQELNIQRP T
Sbjct  475  TNYCGTANNAGAILVVGRGFVVVPKLIHPLPPPLRSPDSSPDHVLEDTWMQELNIQRPPT  534

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  535  PTRGRPQSANDRNSLAYI  552



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP+T PER  +DTWMQELNIQRP T
Sbjct  800  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERCLDDTWMQELNIQRPPT  859

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  860  PTRGRPQPDHDRNSLAYI  877



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP LLSP+T PERV +D WMQELNIQRP T
Sbjct  801  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQRPPT  860

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  861  PTRGRPQPDHDRSSLAYI  878



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 64/78 (82%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP+T PER+ EDTWMQELNIQRP T
Sbjct  828  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQRPPT  887

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  888  PTRGRPQPDLDRSSLAYI  905



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PER+ E+TWMQELNIQRP T
Sbjct  805  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEETWMQELNIQRPPT  864

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  865  PTRGRPQPDHDRSSLAYI  882



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP+T PER  EDTWMQELNIQRP T
Sbjct  806  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERTVEDTWMQELNIQRPPT  865

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  866  PTRGRPQPDLDRSSLAYI  883



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PER+ E+ WMQELNIQRP T
Sbjct  806  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEENWMQELNIQRPPT  865

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  866  PTRGRPQPDLDRNSLAYI  883



>ref|XP_010522673.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=837

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PER  +DTWMQELNIQRP T
Sbjct  760  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQRPPT  819

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  820  PTRGRPQPDLDRNSLAYI  837



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PER  +DTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  870  PTRGRPQPDLDRNSLAYI  887



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PERV ++TWMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVLDETWMQELNIQRPPT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
              RGRPQPD DR+SLAYI
Sbjct  868  PIRGRPQPDLDRSSLAYI  885



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GA+LVVGRGLVIVPKLIHPLPP   SP+T PERV  D WMQELNIQRP T
Sbjct  811  TNYCGTANNAGALLVVGRGLVIVPKLIHPLPPPFQSPETSPERVVHDAWMQELNIQRPPT  870

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP+ DRNSLAYI
Sbjct  871  PTRGRPQPELDRNSLAYI  888



>dbj|BAK04150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  303  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  362

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  363  PTRGRPHSAGDRNSLAYI  380



>ref|NP_001169882.1| uncharacterized protein LOC100383776 [Zea mays]
 gb|ACN35157.1| unknown [Zea mays]
Length=187

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  111  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRPPT  169

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  170  PTRGRPQAAGDRNSLAYI  187



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV GRGLV+VPKLIHPLPP L SP+T PE V +DTWMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRPQT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  868  PTRGRPQPDHDRSSLAYI  885



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV GRGLV+VPKLIHPLPP L SP+T PE V +DTWMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRPQT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  869  PTRGRPQPDHDRSSLAYI  886



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  800  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  859

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  860  PTRGRPQSASDRNSLAYI  877



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  752  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  811

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  812  PTRGRPQSASDRNSLAYI  829



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  806  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  865

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  866  PTRGRPQSASDRNSLAYI  883



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  791  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRPPT  850

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  851  PTRGRPHSASDRNSLAYI  868



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  823  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRPPT  882

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  883  PTRGRPHSASDRNSLAYI  900



>gb|EMT11348.1| Serine/threonine phosphatase BSL1-like protein [Aegilops tauschii]
Length=840

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  763  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  822

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  823  PTRGRPHSAGDRNSLAYI  840



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  693  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQRPPT  752

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  753  PTRGRPHSAGDRNSLAYI  770



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  812  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQRPPT  871

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DRNSLAYI
Sbjct  872  PTRGRPHSASDRNSLAYI  889



>gb|AFN44702.1| Ser/Thr phosphatase-containing Kelch repeat domain protein, partial 
[Nicotiana benthamiana]
Length=490

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNI  522
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP L SP+T PERV EDTWMQELNI
Sbjct  425  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNI  479



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 60/78 (77%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GRGLV+VPKLIHPLPP L SP++ PE   EDTWMQELNIQRP T
Sbjct  816  TNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPESSPEHAVEDTWMQELNIQRPPT  875

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR+SLAYI
Sbjct  876  PTRGRPQSANDRSSLAYI  893



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  869  PTRGRPQPDFDRSSLAYI  886



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  869  PTRGRPQPDFDRSSLAYI  886



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  797  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  856

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  857  PTRGRPQPDFDRSSLAYI  874



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  803  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  862

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  863  PTRGRPQPDFDRSSLAYI  880



>gb|AFK45415.1| unknown [Lotus japonicus]
Length=178

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNI  522
            TNYCGTA N GAILV+GRGLV+VPKLIHP+PP L SP+T PERV ++TWMQELNI
Sbjct  19   TNYCGTANNAGAILVIGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNI  73



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGR LVIVPKLIHPLPP +LSP+  PER  +DTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRELVIVPKLIHPLPPPILSPENSPERSMDDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  870  PTRGRPQPDFDRSSLAYI  887



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  800  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  859

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  860  PTRGRPQPDFDRSSLAYI  877



>emb|CAC11128.1| protein phosphatase [Fagus sylvatica]
Length=262

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PER+ EDTWMQELNIQRP T
Sbjct  185  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNIQRPPT  244

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  245  PTRGRPQPDLDRSSLAYI  262



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  801  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  860

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  861  PTRGRPQPDFDRSSLAYI  878



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  817  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  876

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  877  PTRGRPQPDFDRSSLAYI  894



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  805  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  864

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  865  PTRGRPQPDFDRSSLAYI  882



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  864  PTRGRPQPDFDRSSLAYI  881



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP +LSP+  PE   +D WMQELNIQRP T
Sbjct  805  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQRPPT  864

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  865  PTRGRPQPDFDRSSLAYI  882



>ref|XP_006826451.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
 gb|ERM93688.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
Length=671

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGR LV+VPKLIHPLPP   SP++ P+   E+TWMQELNIQRP T
Sbjct  594  TNYCGTANNAGAILVVGRDLVVVPKLIHPLPPPFQSPESSPDHALEETWMQELNIQRPPT  653

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP  DRNSLA+I
Sbjct  654  PTRGRPQPAHDRNSLAFI  671



>gb|EYU41290.1| hypothetical protein MIMGU_mgv1a0202662mg, partial [Erythranthe 
guttata]
Length=554

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER+ EDTWMQELN  RP T
Sbjct  477  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNANRPPT  536

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  537  PTRGRPQVTNDRGSLAWI  554



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN+ RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVNRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  984   PTRGRPQNPNDRGSLAWI  1001



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN+ RP T
Sbjct  929   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVNRPPT  988

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  989   PTRGRPQNPNDRGSLAWI  1006



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  903  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRPPT  961

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  962  PTRGRPQAAGDRNSLAYI  979



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  911  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRPPT  969

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  970  PTRGRPQAAGDRNSLAYI  987



>gb|EYU25965.1| hypothetical protein MIMGU_mgv1a0006241mg, partial [Erythranthe 
guttata]
Length=701

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER+ EDTWMQELN  RP T
Sbjct  624  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNANRPPT  683

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  684  PTRGRPQVTNDRGSLAWI  701



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SPDT PER  EDTWMQELN  RP T
Sbjct  933   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNANRPPT  992

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  993   PTRGRPQVTNDRGSLAWI  1010



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLVIVPKLIHPLPP + SP++ PER  + TWMQELNIQRP T
Sbjct  819  TNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQRPPT  877

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  878  PTRGRPQAAGDRNSLAYI  895



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SPDT PER  EDTWMQELN  RP T
Sbjct  937   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNANRPPT  996

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  997   PTRGRPQVTNDRGSLAWI  1014



>ref|XP_010647448.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
 ref|XP_010647506.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
Length=660

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  583  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  642

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  643  PTRGRPQVTNDRGSLAWI  660



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  926   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  985

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  986   PTRGRPQVTNDRGSLAWI  1003



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP++ PER  EDTWMQ+LN+ RP T
Sbjct  885  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQDLNVARPPT  944

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP  DRNSLA+I
Sbjct  945  PTRGRPQPTSDRNSLAWI  962



>gb|KGN66603.1| hypothetical protein Csa_1G638500 [Cucumis sativus]
Length=288

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+T PER  EDTWMQELN  RP T
Sbjct  211  TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRPPT  270

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA++
Sbjct  271  PTRGRPQVANDRGSLAWM  288



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV EDTWMQELNIQRP T
Sbjct  796  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRPPT  855

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  856  PTRGRPQPDLDRNSLAYI  873



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 67/78 (86%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV EDTWMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  870  PTRGRPQPDLDRNSLAYI  887



>gb|KHN36505.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=861

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  784  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  843

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  844  PTRGRPPVTNDRGSLAWI  861



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP++ PER  EDTWMQELN+QRP T
Sbjct  877  TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAITSPESSPERHLEDTWMQELNVQRPPT  936

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  937  PTRGRPQAGNDRGSLAWI  954



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  919  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  978

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  979  PTRGRPPVTNDRGSLAWI  996



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  972   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNANRPPT  1031

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  1032  PTRGRPQVTNDRGSLAWI  1049



>gb|KDO87444.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=475

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  398  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  457

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  458  PTRGRPQPDLDRNSLAYI  475



>gb|KEH38997.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=882

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  805  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  864

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  865  PTRGRPPVTNDRGSLAWI  882



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  928   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRPPT  987

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  988   PTRGRPQTPNDRGSLAWI  1005



>emb|CAN67845.1| hypothetical protein VITISV_016668 [Vitis vinifera]
Length=641

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PER  +DTWMQELNIQRP T
Sbjct  564  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERTVDDTWMQELNIQRPPT  623

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  624  PTRGRPQPDLDRNSLAYI  641



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  918  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  977

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  978  PTRGRPPVTNDRGSLAWI  995



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  905  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAINSPEASPERHTEDTWMQELNANRPPT  964

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  965  PTRGRPQTSNDRGSLAWI  982



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  968   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRPPT  1027

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  1028  PTRGRPQNPNDRGSLAWI  1045



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  922  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRPPT  981

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  982  PTRGRPQNPNDRGSLAWI  999



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  984   PTRGRPQVTNDRGSLAWI  1001



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRPPT  984

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  985   PTRGRPQNPNDRGSLAWI  1002



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  929   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNANRPPT  988

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  989   PTRGRPQVTNDRGSLAWI  1006



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  908  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNANRPPT  967

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  968  PTRGRPQVANDRGSLAWI  985



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  909  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNANRPPT  968

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  969  PTRGRPQVANDRGSLAWI  986



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  911  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  970

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  971  PTRGRPPVTNDRGSLAWI  988



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  921  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  980

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  981  PTRGRPQVANDRGSLAWI  998



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  931   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  990

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  991   PTRGRPQVANDRGSLAWI  1008



>gb|KDO87443.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=646

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  569  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  628

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  629  PTRGRPQPDLDRNSLAYI  646



>gb|KJB55562.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=528

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  451  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  510

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  511  PTRGRPQVANDRGSLAWI  528



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  984   PTRGRPQGANDRGSLAWI  1001



>gb|KDO87442.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=679

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  602  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  661

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  662  PTRGRPQPDLDRNSLAYI  679



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  984

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  985   PTRGRPQVANDRGSLAWI  1002



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  922  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  981

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  982  PTRGRPQVATDRGSLAWI  999



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  984   PTRGRPQGANDRGSLAWI  1001



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  927   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  986

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  987   PTRGRPQVANDRGSLAWI  1004



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  929   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  988

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  989   PTRGRPQVPNDRGSLAWI  1006



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  930   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  989

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  990   PTRGRPQVPNDRGSLAWI  1007



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  984   PTRGRPQGANDRGSLAWI  1001



>ref|XP_004170230.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=654

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  577  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRPPT  636

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  637  PTRGRPQVTNDRGSLAWI  654



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  928   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  987

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  988   PTRGRPQVANDRGSLAWI  1005



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  928   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  987

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  988   PTRGRPQVANDRGSLAWI  1005



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  927   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  986

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  987   PTRGRPQVANDRGSLAWI  1004



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SPD  PE   EDTWMQELN  RP T
Sbjct  904  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDASPEHHTEDTWMQELNANRPPT  963

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  964  PTRGRPQSSNDRGSLAWI  981



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  942   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  1001

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  1002  PTRGRPQVANDRGSLAWI  1019



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP LLSP+T PERV +DTWMQELNIQRP T
Sbjct  801  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVMDDTWMQELNIQRPPT  860

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  861  PTRGRPQPDHDRSSLAYI  878



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  926   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPPT  985

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRP    DR SLA+I
Sbjct  986   PTRGRPPVANDRGSLAWI  1003



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP + SP+T PERV +DTWMQELNIQRP T
Sbjct  806  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIQSPETSPERVIDDTWMQELNIQRPPT  865

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  866  PTRGRPQPDLDRNSLAYI  883



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +DTWMQELNIQRP T
Sbjct  807  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRPPT  866

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  867  PTRGRPQPDLDRNSLAYI  884



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +DTWMQELNIQRP T
Sbjct  805  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRPPT  864

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  865  PTRGRPQPDLDRNSLAYI  882



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +DTWMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQRPPT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  869  PTRGRPQPDLDRNSLAYI  886



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  +DTWMQELN  RP T
Sbjct  920  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHVDDTWMQELNANRPPT  979

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  980  PTRGRPQTPDDRGSLAWI  997



>ref|XP_004164757.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial 
[Cucumis sativus]
Length=864

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+T PER  EDTWMQELN  RP T
Sbjct  787  TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRPPT  846

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA++
Sbjct  847  PTRGRPQVANDRGSLAWM  864



>ref|XP_002513730.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF48677.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=874

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + S +  PER  EDTWMQELN  RP T
Sbjct  797  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSAEASPERHIEDTWMQELNANRPPT  856

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  857  PTRGRPQVTNDRGSLAWI  874



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+T PER  EDTWMQELN  RP T
Sbjct  904  TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRPPT  963

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA++
Sbjct  964  PTRGRPQVANDRGSLAWM  981



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+T PER  EDTWMQELN  RP T
Sbjct  931   TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNANRPPT  990

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA++
Sbjct  991   PTRGRPQVANDRGSLAWM  1008



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  +DTWMQELN  RP T
Sbjct  921  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNANRPPT  980

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  981  PTRGRPQTPDDRGSLAWI  998



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  +DTWMQELN  RP T
Sbjct  921  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNANRPPT  980

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  981  PTRGRPQTPDDRGSLAWI  998



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  936   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNANRPPT  995

Query  506   xtrgrpqPDXDRNSLA  459
              TRGRPQ   DR SLA
Sbjct  996   PTRGRPQNPNDRGSLA  1011



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  914  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  973

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  974  PTRGRPQSPNDRGSLAWI  991



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  938   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  997

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  998   PTRGRPQSPNDRGSLAWI  1015



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP LLSP+T PERV +D WMQELNIQRP T
Sbjct  810  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVIDDAWMQELNIQRPPT  869

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  870  PTRGRPQPDLDRNSLAYI  887



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRPPT  984

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  985   PTRGRPQVTNDRGSLAWI  1002



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNANRPPT  984

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  985   PTRGRPQVTNDRGSLAWI  1002



>ref|XP_007015660.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
 gb|EOY33279.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
Length=822

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  745  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  804

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  805  PTRGRPQVTNDRGSLAWI  822



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  942   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  1001

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  1002  PTRGRPQVTNDRGSLAWI  1019



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  931   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  990

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  991   PTRGRPQAPNDRGSLAWI  1008



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  938   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  997

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  998   PTRGRPQVANDRGSLAWI  1015



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  +DTWMQELN  RP T
Sbjct  928   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIDDTWMQELNANRPPT  987

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  988   PTRGRPQVANDRGSLAWI  1005



>gb|KJB35468.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35469.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=682

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  605  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  664

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA I
Sbjct  665  PTRGRPQVANDRGSLACI  682



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  930   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  989

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   +R SLA+I
Sbjct  990   PTRGRPQVTNERGSLAWI  1007



>gb|KJB55561.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=700

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  623  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  682

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  683  PTRGRPQVANDRGSLAWI  700



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  939   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  998

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  999   PTRGRPQVANDRGSLAWI  1016



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  939   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  998

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  999   PTRGRPQVANDRGSLAWI  1016



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  934   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRPPT  993

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  994   PTRGRPQVTNDRGSLAWI  1011



>gb|KHN17986.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=929

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  RP T
Sbjct  852  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNANRPPT  911

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  912  PTRGRPPVTNDRGSLAWI  929



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  934   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRPPT  993

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  994   PTRGRPQVTNDRGSLAWI  1011



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +DTWMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQRPPT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  869  PTRGRPQPDLDRSSLAYI  886



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PER  +DTWMQELNIQRP T
Sbjct  811  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERTVDDTWMQELNIQRPPT  870

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  871  PTRGRPQPDLDRNSLAYI  888



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+ P+ IHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  934   TNYCGTANNAGAILVLGRDLVVGPQHIHPLPPAISSPEASPERHIEDTWMQELNANRPPT  993

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  994   PTRGRPQVTNDRGSLAWI  1011



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  923  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRPPT  982

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  983  PTRGRPQVTNDRGSLAWI  1000



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +DTWMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQRPPT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  868  PTRGRPQPDLDRSSLAYI  885



>ref|XP_003591594.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=425

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP++ PERV ++TWMQELNIQRP T
Sbjct  348  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRPPT  407

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  408  PTRGRPQPDLDRGSLAYI  425



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  RP T
Sbjct  938   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELNANRPPT  997

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  998   PTRGRPQVANDRGSLAWI  1015



>gb|KDO87440.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87441.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=810

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  733  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  792

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  793  PTRGRPQPDLDRNSLAYI  810



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  813  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQRPPT  872

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  873  PTRGRPQPDLDRNSLAYI  890



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQRPPT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  868  PTRGRPQPDLDRNSLAYI  885



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  812  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  871

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  872  PTRGRPQPDLDRNSLAYI  889



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV +D WMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  868  PTRGRPQPDLDRNSLAYI  885



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+  PER+ EDTWMQELN  RP T
Sbjct  906  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNANRPPT  964

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  965  PTRGRPQTANDRGSLAWI  982



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  RP T
Sbjct  926   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNANRPPT  985

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRP    DR SLA+I
Sbjct  986   PTRGRPPVTNDRGSLAWI  1003



>ref|XP_009606096.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana tomentosiformis]
Length=678

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  602  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  660

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  661  PTRGRPQVANDRGSLAWI  678



>ref|XP_006367582.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=744

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+  PER+ EDTWMQELN  RP T
Sbjct  668  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNANRPPT  726

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  727  PTRGRPQTANDRGSLAWI  744



>ref|XP_009606099.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana tomentosiformis]
Length=643

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  567  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  625

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  626  PTRGRPQVANDRGSLAWI  643



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + +P T PE   EDTWMQELN  RP T
Sbjct  944   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAIATPQTSPEHHIEDTWMQELNANRPPT  1003

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  1004  PTRGRPQVASDRGSLAWI  1021



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV  D WMQELNIQRP T
Sbjct  808  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQRPPT  867

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  868  PTRGRPQPDLDRNSLAYI  885



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV  D WMQELNIQRP T
Sbjct  809  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQRPPT  868

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DRNSLAYI
Sbjct  869  PTRGRPQPDLDRNSLAYI  886



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP T PE   EDTWMQELN  RP T
Sbjct  938   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVASPQTSPEHHIEDTWMQELNANRPPT  997

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA+I
Sbjct  998   PTRGRPQVANDRGSLAWI  1015



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  922  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  981

Query  506  xtrgrpqPDXDRNSLAY  456
             TRGRPQ   DR S+A+
Sbjct  982  PTRGRPQVANDRGSVAW  998



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN  RP T
Sbjct  919  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNANRPPT  978

Query  506  xtrgrpqPDXDRNSLAY  456
             TRGRPQ   DR S+A+
Sbjct  979  PTRGRPQVANDRGSVAW  995



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  924   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  983

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA I
Sbjct  984   PTRGRPQVANDRGSLACI  1001



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  938   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  997

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA I
Sbjct  998   PTRGRPQVANDRGSLACI  1015



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PE + EDTWMQELN  RP T
Sbjct  953   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNANRPPT  1011

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGR Q   DR+SLA+I
Sbjct  1012  PTRGRSQAANDRSSLAWI  1029



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PE + EDTWMQELN  RP T
Sbjct  952   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNANRPPT  1010

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGR Q   DR+SLA+I
Sbjct  1011  PTRGRSQAANDRSSLAWI  1028



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  RP T
Sbjct  905  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNANRPPT  964

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA I
Sbjct  965  PTRGRPQVANDRGSLACI  982



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  873  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  931

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  932  PTRGRPQVANDRGSLAWI  949



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+  PE   EDTWMQELN  RP T
Sbjct  909  TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAVSSPEASPEHHIEDTWMQELNANRPPT  968

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  969  PTRGRPQVASDRGSLAWI  986



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  913  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  971

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  972  PTRGRPQVANDRGSLAWI  989



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  908  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  966

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  967  PTRGRPQVANDRGSLAWI  984



>ref|XP_008787776.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Phoenix dactylifera]
Length=826

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PE   EDTWMQELN  RP T
Sbjct  749  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRPPT  808

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  809  PTRGRPQVANDRGSLAWI  826



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP   SP++ PE V EDTWMQELNIQRP T
Sbjct  811  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPQQSPESSPEHVLEDTWMQELNIQRPPT  870

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DRNSLAYI
Sbjct  871  PTRGRPQSANDRNSLAYI  888



>ref|XP_008787777.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Phoenix dactylifera]
Length=825

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PE   EDTWMQELN  RP T
Sbjct  748  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRPPT  807

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  808  PTRGRPQVANDRGSLAWI  825



>gb|ACR38393.1| unknown [Zea mays]
Length=213

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  RP T
Sbjct  135  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  194

Query  506  xtr-grpqPDXDRNSLAYI  453
             TR     P+ DR S+A+I
Sbjct  195  PTRGRPQAPNNDRGSVAWI  213



>ref|XP_003605992.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=875

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P  LSP+T PER  EDTWMQELN  RP T
Sbjct  799  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNANRPPT  857

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  858  PTRGRPPVANDRGSLAWI  875



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PE   EDTWMQELN  RP T
Sbjct  901  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNANRPPT  960

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  961  PTRGRPQVANDRGSLAWI  978



>gb|KDO46579.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=744

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  671  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  724



>gb|KHN46606.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=818

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP+T PERV ++TWMQELNIQRP T
Sbjct  741  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQRPPT  800

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  801  PTRGRPQPDLDRGSLAYI  818



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P  LSP+T PER  EDTWMQELN  RP T
Sbjct  923  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNANRPPT  981

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRP    DR SLA+I
Sbjct  982  PTRGRPPVANDRGSLAWI  999



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP + SP+  PERV +D WMQELNIQRP T
Sbjct  801  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQRPPT  860

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP+ DRNSLAYI
Sbjct  861  PTRGRPQPEVDRNSLAYI  878



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PE V +DTWMQELNIQRP T
Sbjct  815  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQRPQT  874

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  875  PTRGRPQPDHDRSSLAYI  892



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP+T PERV ++TWMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  864  PTRGRPQPDLDRGSLAYI  881



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  P+   EDTWMQELN  RP T
Sbjct  917  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRPPT  976

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGR Q   DR+SLA+I
Sbjct  977  PTRGRSQAANDRSSLAWI  994



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  P+   EDTWMQELN  RP T
Sbjct  918  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRPPT  977

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGR Q   DR+SLA+I
Sbjct  978  PTRGRSQAANDRSSLAWI  995



>dbj|BAF02235.1| putative protein serine/threonine phosphatase alpha [Arabidopsis 
thaliana]
Length=737

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  659  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  718

Query  506  xtrgrpqPDXDR-NSLAYI  453
             TRGRPQ   DR  SLA++
Sbjct  719  PTRGRPQNSNDRGGSLAWM  737



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  P+   EDTWMQELN  RP T
Sbjct  918  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNANRPPT  977

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGR Q   DR+SLA+I
Sbjct  978  PTRGRSQAANDRSSLAWI  995



>gb|AAF22889.1|AC006932_6 T27G7.10 [Arabidopsis thaliana]
Length=1088

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  1010  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  1069

Query  506   xtrgrpqPDXDR-NSLAYI  453
              TRGRPQ   DR  SLA++
Sbjct  1070  PTRGRPQNSNDRGGSLAWM  1088



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVN-EDTWMQELNIqrpx  510
             TNYCGTA N GAILV+GR LV+VPKLIHP+PP + SP+T PE  + EDTWMQELN  RP 
Sbjct  933   TNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPEHHHIEDTWMQELNANRPP  992

Query  509   txtrgrpqPDXDRNSLAYI  453
             T TRGRPQ   DR SLA++
Sbjct  993   TPTRGRPQVTNDRGSLAWM  1011



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + S +T PER  EDTWMQELN
Sbjct  934  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSTETSPERHIEDTWMQELN  987



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP + SP+  PERV +D WMQELNIQRP T
Sbjct  761  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQRPPT  820

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQP+ DRNSLAYI
Sbjct  821  PTRGRPQPEVDRNSLAYI  838



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 5/83 (6%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQ-----ELNI  522
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP++ PER  EDTWMQ     +LN+
Sbjct  904  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQARNSKDLNV  963

Query  521  qrpxtxtrgrpqPDXDRNSLAYI  453
             RP T TRGRPQP  DRNSLA+I
Sbjct  964  ARPPTPTRGRPQPTSDRNSLAWI  986



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN
Sbjct  939  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  924  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN
Sbjct  944  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  997



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN
Sbjct  945  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  998



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  925  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  940   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  999

Query  506   xtrgrpqPDXDR-NSLAYI  453
              TRGRPQ   DR  SLA++
Sbjct  1000  PTRGRPQNSNDRGGSLAWM  1018



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  935   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  994

Query  506   xtrgrpqPDXDR-NSLAYI  453
              TRGRPQ   DR  SLA++
Sbjct  995   PTRGRPQNSNDRGGSLAWM  1013



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  940   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  999

Query  506   xtrgrpqPDXDR-NSLAYI  453
              TRGRPQ   DR  SLA++
Sbjct  1000  PTRGRPQNSNDRGGSLAWM  1018



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  925  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN  RP T
Sbjct  939   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPAT  998

Query  506   xtrgrpqPDXDR-NSLAYI  453
              TRGRPQ   DR  SLA++
Sbjct  999   PTRGRPQNSNDRGGSLAWM  1017



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  930  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983



>ref|XP_007201685.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
 gb|EMJ02884.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
Length=729

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 64/76 (84%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PERV ED WMQELNIQRP T
Sbjct  545  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDMWMQELNIQRPPT  604

Query  506  xtrgrpqPDXDRNSLA  459
             TRGRPQPD DRNSLA
Sbjct  605  PTRGRPQPDLDRNSLA  620



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN
Sbjct  940  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP L SP+T PER  EDTWMQELN
Sbjct  940  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|XP_010914371.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Elaeis guineensis]
Length=611

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP++ P+ V EDTWMQELNIQRP T
Sbjct  534  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRPPT  593

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR+SLAYI
Sbjct  594  PTRGRPQSANDRHSLAYI  611



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  919  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  EDTWMQELN
Sbjct  937  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  990



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  863  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRPPT  922

Query  509  txtrgrpqPDXDRNSLAYI  453
                     + DR SLA+I
Sbjct  923  PTRGRPQVANNDRGSLAWI  941



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  931   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRPPT  990

Query  509   txtrgrpqPDXDRNSLAYI  453
                      + DR SLA+I
Sbjct  991   PTRGRPQAANNDRGSLAWI  1009



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+   ER  EDTWMQELN  RP T
Sbjct  936   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASSERHIEDTWMQELNANRPPT  995

Query  506   xtrgrpqPDXDRNSLAYI  453
              TRGRPQ   DR SLA++
Sbjct  996   PTRGRPQVTNDRGSLAWV  1013



>gb|EEE65895.1| hypothetical protein OsJ_21718 [Oryza sativa Japonica Group]
Length=944

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  866  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNANRPPT  925

Query  509  txtrgrpqPDXDRNSLAYI  453
                     + DR SLA+I
Sbjct  926  PTRGRPQAANNDRGSLAWI  944



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP++ PERV ++TWMQELNIQRP T
Sbjct  802  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRPPT  861

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  862  PTRGRPQPDLDRGSLAYI  879



>ref|XP_003591586.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=771

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP++ PERV ++TWMQELNIQRP T
Sbjct  694  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRPPT  753

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  754  PTRGRPQPDLDRGSLAYI  771



>ref|XP_010914369.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Elaeis guineensis]
Length=669

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP++ P+ V EDTWMQELNIQRP T
Sbjct  592  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRPPT  651

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR+SLAYI
Sbjct  652  PTRGRPQSANDRHSLAYI  669



>ref|NP_001131445.1| uncharacterized LOC100192777 [Zea mays]
 gb|ACF79850.1| unknown [Zea mays]
Length=290

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN
Sbjct  212  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  265



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  919  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  978

Query  509  txtrgrpqPDXDRNSLAYI  453
                    P+ DR SLA+I
Sbjct  979  PTRGRPQAPNNDRGSLAWI  997



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  880  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  938

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SL +I
Sbjct  939  PTRGRPQVANDRGSLTWI  956



>ref|XP_010914370.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Elaeis guineensis]
Length=619

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP++ P+ V EDTWMQELNIQRP T
Sbjct  542  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQRPPT  601

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR+SLAYI
Sbjct  602  PTRGRPQSANDRHSLAYI  619



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP++ PERV ++TWMQELNIQRP T
Sbjct  799  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQRPPT  858

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  859  PTRGRPQPDLDRGSLAYI  876



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P   SP+T PER  EDTWMQELN  RP T
Sbjct  915  TNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNANRPPT  973

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SL +I
Sbjct  974  PTRGRPQVANDRGSLTWI  991



>dbj|BAK06303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN
Sbjct  319  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPTITSPETSPEHHIEDTWMQELN  372



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  920  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  979

Query  509  txtrgrpqPDXDRNSLAYI  453
                    P+ DR SLA+I
Sbjct  980  PTRGRPQAPNNDRGSLAWI  998



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  930   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  989

Query  509   txtrgrpqPDXDRNSLAYI  453
                     P+ DR SLA+I
Sbjct  990   PTRGRPQAPNNDRGSLAWI  1008



>emb|CAC09573.1| protein phosphatase 1 (PP1) [Fagus sylvatica]
Length=139

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNI  522
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PER+ EDTWMQELNI
Sbjct  71   TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNI  125



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  PER  EDTWMQELN  R P 
Sbjct  915  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNANRPPT  974

Query  509  txtrgrpqPDXDRNSLAYI  453
                       DR SLA+I
Sbjct  975  PTRGRPQVITNDRGSLAWI  993



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PE V ++TWMQELNIQRP T
Sbjct  820  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQRPPT  879

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  880  PTRGRPQPDLDRSSLAYI  897



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PE V ++TWMQELNIQRP T
Sbjct  811  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQRPPT  870

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR+SLAYI
Sbjct  871  PTRGRPQPDLDRSSLAYI  888



>gb|EEE59591.1| hypothetical protein OsJ_11899 [Oryza sativa Japonica Group]
Length=936

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  858  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  917

Query  509  txtrgrpqPDXDRNSLAYI  453
                       DR SLA+I
Sbjct  918  PTRGRPQVAANDRGSLAWI  936



>ref|XP_009587594.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
tomentosiformis]
Length=978

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR   +V       P    SP+  PER+ EDTWMQELN  RP T
Sbjct  904  TNYCGTANNAGAILVLGR--DLVVVPKLIHPLPPASPENSPERM-EDTWMQELNANRPPT  960

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  961  PTRGRPQTANDRGSLAWI  978



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  862  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  921

Query  509  txtrgrpqPDXDRNSLAYI  453
                       DR SLA+I
Sbjct  922  PTRGRPQVAANDRGSLAWI  940



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  984

Query  509   txtrgrpqPDXDRNSLAYI  453
                        DR SLA+I
Sbjct  985   PTRGRPQVAANDRGSLAWI  1003



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  686   TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
             TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  925   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  984

Query  509   txtrgrpqPDXDRNSLAYI  453
                        DR SLA+I
Sbjct  985   PTRGRPQVAANDRGSLAWI  1003



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PER  ED WMQELN
Sbjct  922  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHMEDIWMQELN  975



>ref|XP_009775149.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=286

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR   +V       P    SP+  PER+ EDTWMQELN  RP T
Sbjct  212  TNYCGTANNAGAILVLGR--DLVVVPKLIHPLPPASPENSPERM-EDTWMQELNANRPPT  268

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQ   DR SLA+I
Sbjct  269  PTRGRPQTANDRGSLAWI  286



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  917  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  976

Query  509  txtrgrpqPDXDRNSLAYI  453
                    P+ DR S+A+I
Sbjct  977  PTRGRPQAPNNDRGSVAWI  995



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqr-px  510
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN  R P 
Sbjct  918  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNANRPPT  977

Query  509  txtrgrpqPDXDRNSLAYI  453
                    P+ DR S+A+I
Sbjct  978  PTRGRPQAPNNDRGSVAWI  996



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHP+PP L SP+T PER  ++TWMQELNIQRP T
Sbjct  804  TNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGMDETWMQELNIQRPPT  863

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  864  PTRGRPQPDLDRGSLAYI  881



>gb|EMS59471.1| Serine/threonine-protein phosphatase BSL2-like protein [Triticum 
urartu]
Length=864

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN
Sbjct  785  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  838



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILVVGRGLV+VPKLIHPLPP L SP+T PER  ++TWMQELNIQRP T
Sbjct  801  TNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERGMDETWMQELNIQRPPT  860

Query  506  xtrgrpqPDXDRNSLAYI  453
             TRGRPQPD DR SLAYI
Sbjct  861  PTRGRPQPDLDRGSLAYI  878



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+T PE   EDTWMQELN
Sbjct  938  TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELN  991



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P + SP+  PER  EDTWMQELN  RP T
Sbjct  921  TNYCGTANNAGAILVLGR-DLVVVPKLIHPIPPVSSPENSPERHIEDTWMQELNANRPPT  979

Query  506  xtrgrpqPDXDRNSLAY  456
             TRGRPQ   DR S A+
Sbjct  980  PTRGRPQVANDRGSFAW  996



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELNIqrpxt  507
            TNYCGTA N GAILV+GR  ++V   +    P + SP+  PER  EDTWMQELN  RP T
Sbjct  920  TNYCGTANNAGAILVLGR-DLVVVPKLIHPIPPVSSPENSPERHIEDTWMQELNANRPPT  978

Query  506  xtrgrpqPDXDRNSLAY  456
             TRGRPQ   DR S A+
Sbjct  979  PTRGRPQVANDRGSFAW  995



>ref|NP_001167772.1| uncharacterized protein LOC100381465 [Zea mays]
 gb|ACN26023.1| unknown [Zea mays]
Length=157

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -3

Query  686  TNYCGTAKNXGAILVVGRGlvivpklihplppxllsPDTXPERVNEDTWMQELN  525
            TNYCGTA N GAILV+GR LV+VPKLIHPLPP + SP+  P+ + EDTWMQELN
Sbjct  80   TNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700