BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014G15

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095569.1|  PREDICTED: serine/threonine-protein kinase D...    280   2e-86   Sesamum indicum [beniseed]
ref|XP_004244035.1|  PREDICTED: serine/threonine-protein kinase D...    280   3e-86   Solanum lycopersicum
ref|XP_006346118.1|  PREDICTED: protein kinase G11A-like isoform X1     279   8e-86   Solanum tuberosum [potatoes]
ref|XP_011097742.1|  PREDICTED: serine/threonine-protein kinase D...    276   7e-85   Sesamum indicum [beniseed]
ref|XP_009625904.1|  PREDICTED: serine/threonine-protein kinase D...    275   2e-84   Nicotiana tomentosiformis
ref|XP_009790589.1|  PREDICTED: serine/threonine-protein kinase D...    275   2e-84   Nicotiana sylvestris
ref|XP_009606402.1|  PREDICTED: serine/threonine-protein kinase D...    274   3e-84   Nicotiana tomentosiformis
ref|XP_009625903.1|  PREDICTED: serine/threonine-protein kinase D...    274   9e-84   Nicotiana tomentosiformis
ref|XP_009774023.1|  PREDICTED: serine/threonine-protein kinase D...    273   1e-83   Nicotiana sylvestris
ref|XP_004236648.1|  PREDICTED: serine/threonine-protein kinase D...    271   5e-83   Solanum lycopersicum
emb|CBI23515.3|  unnamed protein product                                263   6e-83   Vitis vinifera
ref|XP_006350249.1|  PREDICTED: protein kinase G11A-like                271   6e-83   Solanum tuberosum [potatoes]
ref|XP_006352558.1|  PREDICTED: protein kinase G11A-like isoform X1     271   7e-83   Solanum tuberosum [potatoes]
ref|XP_011095891.1|  PREDICTED: serine/threonine-protein kinase D6PK    271   1e-82   Sesamum indicum [beniseed]
emb|CDP13698.1|  unnamed protein product                                271   1e-82   Coffea canephora [robusta coffee]
ref|XP_009770032.1|  PREDICTED: serine/threonine-protein kinase D...    270   1e-82   Nicotiana sylvestris
ref|XP_004248326.1|  PREDICTED: serine/threonine-protein kinase D...    270   2e-82   Solanum lycopersicum
ref|XP_007026392.1|  D6 protein kinase like 2                           270   2e-82   Theobroma cacao [chocolate]
gb|EYU27452.1|  hypothetical protein MIMGU_mgv1a003783mg                269   3e-82   Erythranthe guttata [common monkey flower]
gb|KJB68519.1|  hypothetical protein B456_010G248100                    269   3e-82   Gossypium raimondii
ref|XP_003594321.1|  Protein kinase                                     270   3e-82   Medicago truncatula
ref|XP_002530422.1|  serine/threonine protein kinase, putative          270   3e-82   Ricinus communis
ref|XP_008464303.1|  PREDICTED: protein kinase G11A-like                269   5e-82   Cucumis melo [Oriental melon]
ref|XP_008224641.1|  PREDICTED: protein kinase G11A                     269   6e-82   Prunus mume [ume]
ref|XP_004486363.1|  PREDICTED: protein kinase G11A-like isoform X1     269   6e-82   Cicer arietinum [garbanzo]
ref|XP_007214796.1|  hypothetical protein PRUPE_ppa002965mg             269   7e-82   Prunus persica
ref|XP_010686610.1|  PREDICTED: serine/threonine-protein kinase D...    268   8e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006449950.1|  hypothetical protein CICLE_v10014638mg             268   8e-82   
ref|XP_006467259.1|  PREDICTED: protein kinase G11A-like                268   9e-82   Citrus sinensis [apfelsine]
ref|XP_002522785.1|  serine/threonine protein kinase, putative          266   1e-81   
ref|XP_004173166.1|  PREDICTED: protein kinase G11A-like                268   2e-81   
ref|XP_004139518.1|  PREDICTED: protein kinase G11A-like                268   2e-81   Cucumis sativus [cucumbers]
ref|XP_009630659.1|  PREDICTED: serine/threonine-protein kinase D...    268   2e-81   Nicotiana tomentosiformis
ref|XP_008802695.1|  PREDICTED: protein kinase G11A-like                268   2e-81   Phoenix dactylifera
gb|KDP35525.1|  hypothetical protein JCGZ_08963                         267   2e-81   Jatropha curcas
ref|XP_010252801.1|  PREDICTED: serine/threonine-protein kinase D...    267   3e-81   Nelumbo nucifera [Indian lotus]
ref|XP_008384194.1|  PREDICTED: protein kinase G11A                     267   3e-81   
ref|XP_008358790.1|  PREDICTED: protein kinase G11A-like                267   4e-81   
ref|XP_004293409.1|  PREDICTED: serine/threonine-protein kinase D...    267   4e-81   Fragaria vesca subsp. vesca
ref|XP_002307848.1|  CsPK1.1 family protein                             264   5e-81   
ref|XP_010942863.1|  PREDICTED: serine/threonine-protein kinase D6PK    267   5e-81   Elaeis guineensis
ref|XP_003577034.1|  PREDICTED: serine/threonine-protein kinase D...    265   5e-81   Brachypodium distachyon [annual false brome]
ref|XP_010450415.1|  PREDICTED: serine/threonine-protein kinase D6PK    263   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009374840.1|  PREDICTED: serine/threonine-protein kinase D...    266   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_011005724.1|  PREDICTED: serine/threonine-protein kinase D...    266   7e-81   Populus euphratica
ref|XP_010495823.1|  PREDICTED: serine/threonine-protein kinase D...    258   8e-81   
ref|NP_001062116.1|  Os08g0491200                                       265   8e-81   
ref|XP_009387487.1|  PREDICTED: serine/threonine-protein kinase D...    266   8e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676085.1|  PREDICTED: serine/threonine-protein kinase D...    266   9e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010928069.1|  PREDICTED: serine/threonine-protein kinase D...    266   9e-81   Elaeis guineensis
gb|KDP39299.1|  hypothetical protein JCGZ_01056                         266   9e-81   Jatropha curcas
gb|KJB63056.1|  hypothetical protein B456_009G451500                    263   1e-80   Gossypium raimondii
ref|XP_010039426.1|  PREDICTED: serine/threonine-protein kinase D...    266   1e-80   Eucalyptus grandis [rose gum]
ref|XP_003574687.1|  PREDICTED: serine/threonine-protein kinase D...    265   1e-80   Brachypodium distachyon [annual false brome]
ref|XP_006380864.1|  hypothetical protein POPTR_0006s00570g             265   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011040152.1|  PREDICTED: serine/threonine-protein kinase D...    265   1e-80   Populus euphratica
ref|XP_010545283.1|  PREDICTED: serine/threonine-protein kinase D...    263   1e-80   Tarenaya hassleriana [spider flower]
dbj|BAA01731.1|  protein kinase                                         262   1e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KJB63055.1|  hypothetical protein B456_009G451500                    264   1e-80   Gossypium raimondii
ref|NP_200402.1|  D6 protein kinase                                     262   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395513.1|  PREDICTED: serine/threonine-protein kinase D...    265   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002322497.2|  hypothetical protein POPTR_0016s00660g             265   2e-80   Populus trichocarpa [western balsam poplar]
gb|KHG10317.1|  hypothetical protein F383_15240                         264   2e-80   Gossypium arboreum [tree cotton]
ref|XP_010241157.1|  PREDICTED: serine/threonine-protein kinase D...    265   2e-80   Nelumbo nucifera [Indian lotus]
gb|KHN40778.1|  Protein kinase G11A                                     265   2e-80   Glycine soja [wild soybean]
ref|XP_009410301.1|  PREDICTED: serine/threonine-protein kinase D...    265   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY36769.1|  BnaA03g11170D                                          261   3e-80   Brassica napus [oilseed rape]
ref|XP_011461867.1|  PREDICTED: serine/threonine-protein kinase D...    264   3e-80   Fragaria vesca subsp. vesca
ref|XP_003534979.1|  PREDICTED: protein kinase G11A-like isoform X1     265   3e-80   Glycine max [soybeans]
emb|CDY11972.1|  BnaC03g13980D                                          261   3e-80   Brassica napus [oilseed rape]
ref|XP_009349143.1|  PREDICTED: serine/threonine-protein kinase D...    265   3e-80   Pyrus x bretschneideri [bai li]
gb|KHN14413.1|  Protein kinase G11A                                     265   3e-80   Glycine soja [wild soybean]
ref|XP_006401401.1|  hypothetical protein EUTSA_v10013345mg             261   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_003634855.1|  PREDICTED: serine/threonine-protein kinase D...    265   4e-80   Vitis vinifera
ref|XP_007147579.1|  hypothetical protein PHAVU_006G136500g             264   4e-80   Phaseolus vulgaris [French bean]
gb|KJB81597.1|  hypothetical protein B456_013G151400                    263   6e-80   Gossypium raimondii
ref|XP_009396293.1|  PREDICTED: serine/threonine-protein kinase D6PK    264   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002866117.1|  hypothetical protein ARALYDRAFT_495673             260   8e-80   
ref|XP_008797752.1|  PREDICTED: protein kinase G11A-like                263   9e-80   Phoenix dactylifera
gb|EMT19817.1|  Protein kinase G11A                                     262   1e-79   
dbj|BAK01767.1|  predicted protein                                      262   1e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008358895.1|  PREDICTED: protein kinase G11A-like                263   1e-79   
ref|XP_008218405.1|  PREDICTED: protein kinase G11A                     263   1e-79   Prunus mume [ume]
ref|XP_007208313.1|  hypothetical protein PRUPE_ppa003043mg             263   1e-79   Prunus persica
ref|XP_009379475.1|  PREDICTED: serine/threonine-protein kinase D...    263   1e-79   Pyrus x bretschneideri [bai li]
ref|NP_001289227.1|  serine/threonine-protein kinase D6PK-like          263   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_009367228.1|  PREDICTED: serine/threonine-protein kinase D...    263   2e-79   Pyrus x bretschneideri [bai li]
ref|XP_006280353.1|  hypothetical protein CARUB_v10026280mg             259   2e-79   Capsella rubella
ref|XP_010096481.1|  Protein kinase G11A                                262   2e-79   Morus notabilis
ref|XP_006280219.1|  hypothetical protein CARUB_v10026139mg             261   2e-79   Capsella rubella
ref|XP_007020448.1|  D6 protein kinase like 2 isoform 1                 262   3e-79   Theobroma cacao [chocolate]
ref|NP_001062700.1|  Os09g0258500                                       261   3e-79   
gb|EAZ08333.1|  hypothetical protein OsI_30587                          261   3e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_010092339.1|  Protein kinase G11A                                261   4e-79   Morus notabilis
ref|XP_010929042.1|  PREDICTED: serine/threonine-protein kinase D...    261   5e-79   Elaeis guineensis
gb|EMS45639.1|  Protein kinase G11A                                     263   5e-79   Triticum urartu
ref|XP_009396070.1|  PREDICTED: serine/threonine-protein kinase D...    261   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG21447.1|  Protein kinase G11A                                     261   5e-79   Gossypium arboreum [tree cotton]
ref|XP_010481275.1|  PREDICTED: serine/threonine-protein kinase D...    260   6e-79   Camelina sativa [gold-of-pleasure]
gb|KJB13926.1|  hypothetical protein B456_002G102000                    260   6e-79   Gossypium raimondii
ref|XP_004953750.1|  PREDICTED: protein kinase G11A-like                260   6e-79   Setaria italica
ref|XP_002445963.1|  hypothetical protein SORBIDRAFT_07g028750          260   9e-79   Sorghum bicolor [broomcorn]
ref|XP_006413161.1|  hypothetical protein EUTSA_v10024951mg             258   9e-79   Eutrema salsugineum [saltwater cress]
ref|NP_001047980.1|  Os02g0725000                                       260   1e-78   
gb|EAY87356.1|  hypothetical protein OsI_08759                          260   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_009132349.1|  PREDICTED: protein kinase G11A-like                257   1e-78   Brassica rapa
ref|NP_001063472.1|  Os09g0478500                                       259   1e-78   
ref|XP_004134809.1|  PREDICTED: protein kinase G11A-like                260   1e-78   
gb|EAZ45122.1|  hypothetical protein OsJ_29759                          259   1e-78   Oryza sativa Japonica Group [Japonica rice]
emb|CDX94306.1|  BnaC01g18780D                                          258   1e-78   
gb|EAZ09496.1|  hypothetical protein OsI_31769                          259   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_009399531.1|  PREDICTED: serine/threonine-protein kinase D...    260   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL32579.1|  protein kinase 5                                        259   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791995.1|  PREDICTED: protein kinase G11A-like                260   2e-78   Phoenix dactylifera
ref|NP_199586.1|  D6 protein kinase like 2                              259   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660743.1|  PREDICTED: protein kinase G11A-like isoform X1     259   2e-78   Oryza brachyantha
ref|XP_002266700.1|  PREDICTED: serine/threonine-protein kinase D...    259   3e-78   Vitis vinifera
ref|XP_009126979.1|  PREDICTED: protein kinase G11A-like                256   3e-78   Brassica rapa
emb|CDY20744.1|  BnaA02g08840D                                          256   3e-78   Brassica napus [oilseed rape]
ref|XP_009101388.1|  PREDICTED: protein kinase G11A                     258   3e-78   Brassica rapa
ref|XP_006398476.1|  hypothetical protein EUTSA_v10000825mg             258   4e-78   
ref|XP_004957124.1|  PREDICTED: protein kinase G11A-like isoform X1     258   4e-78   Setaria italica
emb|CDY28629.1|  BnaC09g32460D                                          256   5e-78   Brassica napus [oilseed rape]
gb|ACF78457.1|  unknown                                                 252   6e-78   Zea mays [maize]
dbj|BAK06792.1|  predicted protein                                      258   7e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011086278.1|  PREDICTED: serine/threonine-protein kinase D...    258   7e-78   Sesamum indicum [beniseed]
ref|XP_002863323.1|  hypothetical protein ARALYDRAFT_494187             258   8e-78   
ref|XP_006660470.1|  PREDICTED: protein kinase G11A-like                257   8e-78   Oryza brachyantha
ref|XP_003578294.1|  PREDICTED: serine/threonine-protein kinase D...    257   9e-78   Brachypodium distachyon [annual false brome]
emb|CDX77795.1|  BnaC07g20490D                                          257   1e-77   
ref|XP_006647820.1|  PREDICTED: protein kinase G11A-like                257   1e-77   Oryza brachyantha
gb|EMS53056.1|  Protein kinase G11A                                     257   1e-77   Triticum urartu
gb|EMS45607.1|  Protein kinase G11A                                     256   2e-77   Triticum urartu
ref|XP_010539330.1|  PREDICTED: serine/threonine-protein kinase D...    255   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_010536747.1|  PREDICTED: serine/threonine-protein kinase D...    255   2e-77   Tarenaya hassleriana [spider flower]
ref|XP_008783022.1|  PREDICTED: protein kinase G11A                     257   2e-77   Phoenix dactylifera
gb|EMT22325.1|  Protein kinase G11A                                     257   2e-77   
ref|XP_004979067.1|  PREDICTED: protein kinase G11A-like                256   2e-77   
ref|XP_006659528.1|  PREDICTED: protein kinase G11A-like isoform X1     256   3e-77   Oryza brachyantha
ref|NP_001183172.1|  uncharacterized LOC100501547                       256   3e-77   Zea mays [maize]
ref|XP_004973774.1|  PREDICTED: protein kinase G11A-like isoform X1     256   3e-77   
gb|EMT31913.1|  Protein kinase G11A                                     255   4e-77   
ref|XP_004956362.1|  PREDICTED: protein kinase G11A-like                255   4e-77   Setaria italica
dbj|BAK01764.1|  predicted protein                                      255   4e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001141985.1|  uncharacterized LOC100274135                       255   5e-77   Zea mays [maize]
emb|CDP04543.1|  unnamed protein product                                256   6e-77   Coffea canephora [robusta coffee]
gb|ACG25344.1|  protein kinase G11A                                     254   7e-77   Zea mays [maize]
ref|XP_009415445.1|  PREDICTED: serine/threonine-protein kinase D...    256   8e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538432.1|  PREDICTED: serine/threonine-protein kinase D...    254   8e-77   Tarenaya hassleriana [spider flower]
ref|XP_006474844.1|  PREDICTED: protein kinase G11A-like isoform X1     255   8e-77   Citrus sinensis [apfelsine]
ref|XP_008669972.1|  PREDICTED: protein kinase G11A                     254   8e-77   
ref|XP_006452628.1|  hypothetical protein CICLE_v10007792mg             255   9e-77   
gb|KDO59169.1|  hypothetical protein CISIN_1g007433mg                   255   9e-77   Citrus sinensis [apfelsine]
ref|XP_009383196.1|  PREDICTED: serine/threonine-protein kinase D...    255   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB68520.1|  hypothetical protein B456_010G248100                    254   1e-76   Gossypium raimondii
ref|XP_009401494.1|  PREDICTED: serine/threonine-protein kinase D...    256   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU27648.1|  hypothetical protein MIMGU_mgv1a003809mg                253   2e-76   Erythranthe guttata [common monkey flower]
gb|AAA33509.1|  protein kinase                                          249   2e-76   Zea mays [maize]
ref|XP_006283574.1|  hypothetical protein CARUB_v10004626mg             251   2e-76   Capsella rubella
dbj|BAF02156.1|  putative protein kinase                                251   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194391.1|  D6 protein kinase like 1                              251   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057774.1|  PREDICTED: serine/threonine-protein kinase D...    254   3e-76   Eucalyptus grandis [rose gum]
gb|EYU33716.1|  hypothetical protein MIMGU_mgv1a004341mg                252   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_002869601.1|  hypothetical protein ARALYDRAFT_492147             251   3e-76   
ref|XP_010438725.1|  PREDICTED: serine/threonine-protein kinase D...    251   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010448241.1|  PREDICTED: serine/threonine-protein kinase D...    251   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010433468.1|  PREDICTED: serine/threonine-protein kinase D...    251   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009142543.1|  PREDICTED: protein kinase G11A                     251   6e-76   Brassica rapa
ref|NP_001057421.1|  Os06g0291600                                       253   6e-76   
emb|CDX89320.1|  BnaA01g15730D                                          251   6e-76   
sp|A2YBX5.1|G11A_ORYSI  RecName: Full=Protein kinase G11A               253   6e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_009120105.1|  PREDICTED: protein kinase G11A                     250   8e-76   Brassica rapa
emb|CDY17366.1|  BnaA10g10000D                                          250   8e-76   Brassica napus [oilseed rape]
gb|EEE65552.1|  hypothetical protein OsJ_21028                          251   9e-76   Oryza sativa Japonica Group [Japonica rice]
emb|CDY06552.1|  BnaC02g12760D                                          249   1e-75   
gb|EEC80426.1|  hypothetical protein OsI_22605                          251   1e-75   Oryza sativa Indica Group [Indian rice]
gb|AFW63631.1|  putative protein kinase superfamily protein             242   3e-75   
ref|XP_008440970.1|  PREDICTED: protein kinase G11A                     251   3e-75   Cucumis melo [Oriental melon]
ref|XP_002454363.1|  hypothetical protein SORBIDRAFT_04g029460          250   4e-75   Sorghum bicolor [broomcorn]
ref|XP_008353462.1|  PREDICTED: protein kinase PVPK-1-like              242   2e-74   
ref|XP_010251076.1|  PREDICTED: serine/threonine-protein kinase D...    251   2e-74   Nelumbo nucifera [Indian lotus]
emb|CBI34860.3|  unnamed protein product                                247   4e-74   Vitis vinifera
ref|XP_006604033.1|  PREDICTED: protein kinase PVPK-1-like isofor...    249   5e-74   Glycine max [soybeans]
ref|XP_010942581.1|  PREDICTED: serine/threonine-protein kinase D...    248   5e-74   Elaeis guineensis
gb|AFK49302.1|  unknown                                                 242   6e-74   Medicago truncatula
ref|XP_006470235.1|  PREDICTED: protein kinase PVPK-1-like              249   6e-74   Citrus sinensis [apfelsine]
ref|XP_007140939.1|  hypothetical protein PHAVU_008G154000g             248   6e-74   Phaseolus vulgaris [French bean]
gb|KEH24780.1|  Serine/Threonine kinase family protein                  248   7e-74   Medicago truncatula
ref|XP_010530081.1|  PREDICTED: serine/threonine-protein kinase D...    247   7e-74   Tarenaya hassleriana [spider flower]
gb|KDO55122.1|  hypothetical protein CISIN_1g005793mg                   249   7e-74   Citrus sinensis [apfelsine]
emb|CDP02058.1|  unnamed protein product                                249   8e-74   Coffea canephora [robusta coffee]
ref|XP_006446599.1|  hypothetical protein CICLE_v10014494mg             249   8e-74   Citrus clementina [clementine]
ref|XP_010108834.1|  Protein kinase PVPK-1                              249   9e-74   Morus notabilis
ref|XP_003563941.1|  PREDICTED: protein kinase G11A-like                246   9e-74   Brachypodium distachyon [annual false brome]
ref|XP_011097407.1|  PREDICTED: serine/threonine-protein kinase D...    248   1e-73   Sesamum indicum [beniseed]
ref|XP_003547714.1|  PREDICTED: protein kinase PVPK-1-like isofor...    248   1e-73   Glycine max [soybeans]
ref|XP_009761249.1|  PREDICTED: serine/threonine-protein kinase D...    248   1e-73   Nicotiana sylvestris
ref|XP_008353460.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    241   1e-73   
ref|XP_004304655.1|  PREDICTED: serine/threonine-protein kinase D...    248   2e-73   Fragaria vesca subsp. vesca
ref|XP_002272711.2|  PREDICTED: protein kinase PVPK-1                   248   2e-73   Vitis vinifera
ref|XP_008230533.1|  PREDICTED: protein kinase PVPK-1                   248   2e-73   Prunus mume [ume]
ref|XP_007217638.1|  hypothetical protein PRUPE_ppa002420mg             247   3e-73   Prunus persica
ref|XP_010538444.1|  PREDICTED: serine/threonine-protein kinase D...    245   5e-73   
ref|XP_010248634.1|  PREDICTED: serine/threonine-protein kinase D...    247   6e-73   Nelumbo nucifera [Indian lotus]
ref|XP_002521471.1|  serine/threonine protein kinase, putative          246   6e-73   Ricinus communis
ref|XP_008660772.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    244   6e-73   
gb|EYU44793.1|  hypothetical protein MIMGU_mgv1a004470mg                243   7e-73   Erythranthe guttata [common monkey flower]
ref|XP_009793786.1|  PREDICTED: serine/threonine-protein kinase D...    245   8e-73   Nicotiana sylvestris
ref|XP_009615256.1|  PREDICTED: protein kinase PVPK-1-like              246   9e-73   Nicotiana tomentosiformis
gb|KJB33848.1|  hypothetical protein B456_006G034200                    244   9e-73   Gossypium raimondii
ref|XP_008677207.1|  PREDICTED: LOC100281711 isoform X1                 244   1e-72   Zea mays [maize]
ref|NP_001148103.1|  LOC100281711                                       244   1e-72   
gb|KHG10864.1|  kinase PVPK-1                                           244   1e-72   Gossypium arboreum [tree cotton]
gb|KEH22141.1|  Serine/Threonine kinase family protein                  244   1e-72   Medicago truncatula
ref|XP_008341388.1|  PREDICTED: protein kinase PVPK-1 isoform X2        245   2e-72   
ref|XP_002298543.1|  kinase 1 family protein                            245   2e-72   
ref|XP_008341386.1|  PREDICTED: protein kinase PVPK-1 isoform X1        245   2e-72   
gb|KGN59708.1|  hypothetical protein Csa_3G840350                       245   2e-72   Cucumis sativus [cucumbers]
ref|XP_009377149.1|  PREDICTED: protein kinase PVPK-1-like              245   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_004965256.1|  PREDICTED: protein kinase G11A-like isoform X1     243   2e-72   Setaria italica
gb|EPS60863.1|  hypothetical protein M569_13937                         241   2e-72   Genlisea aurea
ref|XP_009370368.1|  PREDICTED: protein kinase PVPK-1-like              245   2e-72   Pyrus x bretschneideri [bai li]
sp|P15792.1|KPK1_PHAVU  RecName: Full=Protein kinase PVPK-1             244   2e-72   Phaseolus vulgaris [French bean]
ref|XP_008464921.1|  PREDICTED: protein kinase PVPK-1                   245   2e-72   Cucumis melo [Oriental melon]
ref|XP_004514004.1|  PREDICTED: protein kinase PVPK-1-like isofor...    244   2e-72   Cicer arietinum [garbanzo]
ref|XP_007150929.1|  hypothetical protein PHAVU_004G006600g             244   2e-72   Phaseolus vulgaris [French bean]
ref|XP_009603203.1|  PREDICTED: serine/threonine-protein kinase D...    245   2e-72   Nicotiana tomentosiformis
ref|XP_004233321.1|  PREDICTED: serine/threonine-protein kinase D...    245   2e-72   
ref|XP_003554867.1|  PREDICTED: protein kinase PVPK-1-like isofor...    244   3e-72   Glycine max [soybeans]
gb|AAA33905.1|  G11A protein                                            241   3e-72   Oryza sativa [red rice]
ref|XP_006357202.1|  PREDICTED: protein kinase PVPK-1-like              244   3e-72   
ref|XP_011015041.1|  PREDICTED: protein kinase PVPK-1-like              244   4e-72   Populus euphratica
ref|XP_011003131.1|  PREDICTED: protein kinase PVPK-1                   244   4e-72   Populus euphratica
gb|KHG08634.1|  kinase PVPK-1                                           244   4e-72   Gossypium arboreum [tree cotton]
ref|XP_006852313.1|  hypothetical protein AMTR_s00049p00198350          246   6e-72   Amborella trichopoda
ref|XP_006338619.1|  PREDICTED: protein kinase PVPK-1-like              243   7e-72   
gb|KHG01211.1|  kinase PVPK-1                                           242   8e-72   Gossypium arboreum [tree cotton]
gb|KJB75934.1|  hypothetical protein B456_012G064400                    243   8e-72   Gossypium raimondii
gb|KJB70894.1|  hypothetical protein B456_011G094600                    243   9e-72   Gossypium raimondii
ref|XP_011098415.1|  PREDICTED: protein kinase PVPK-1                   243   1e-71   Sesamum indicum [beniseed]
ref|XP_010033330.1|  PREDICTED: protein kinase PVPK-1                   243   2e-71   Eucalyptus grandis [rose gum]
gb|EEE68908.1|  hypothetical protein OsJ_27758                          250   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010681851.1|  PREDICTED: serine/threonine-protein kinase D...    241   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007031589.1|  D6 protein kinase like 2 isoform 1                 243   2e-71   
ref|XP_009334142.1|  PREDICTED: protein kinase PVPK-1-like              243   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_004231848.1|  PREDICTED: serine/threonine-protein kinase D6PK    241   2e-71   Solanum lycopersicum
ref|XP_004489234.1|  PREDICTED: protein kinase PVPK-1-like              241   2e-71   Cicer arietinum [garbanzo]
ref|XP_009366949.1|  PREDICTED: protein kinase PVPK-1-like              238   3e-71   
ref|XP_004158354.1|  PREDICTED: protein kinase PVPK-1-like              244   3e-71   
ref|XP_004141198.1|  PREDICTED: protein kinase PVPK-1-like              244   4e-71   
gb|KDP46414.1|  hypothetical protein JCGZ_10254                         240   1e-70   Jatropha curcas
emb|CDX83710.1|  BnaC07g24500D                                          237   2e-70   
gb|KJB40728.1|  hypothetical protein B456_007G075400                    241   2e-70   Gossypium raimondii
ref|XP_006395417.1|  hypothetical protein EUTSA_v10003895mg             238   3e-70   Eutrema salsugineum [saltwater cress]
ref|XP_006290795.1|  hypothetical protein CARUB_v10016900mg             238   4e-70   Capsella rubella
ref|XP_010528221.1|  PREDICTED: serine/threonine-protein kinase D...    237   6e-70   Tarenaya hassleriana [spider flower]
gb|KDO85509.1|  hypothetical protein CISIN_1g0047901mg                  229   7e-70   Citrus sinensis [apfelsine]
gb|EPS67825.1|  hypothetical protein M569_06947                         233   1e-69   Genlisea aurea
ref|XP_010502765.1|  PREDICTED: serine/threonine-protein kinase D...    236   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010425536.1|  PREDICTED: serine/threonine-protein kinase D...    236   1e-69   Camelina sativa [gold-of-pleasure]
gb|EYU34739.1|  hypothetical protein MIMGU_mgv1a004210mg                234   2e-69   Erythranthe guttata [common monkey flower]
emb|CDY13725.1|  BnaA06g31980D                                          235   2e-69   Brassica napus [oilseed rape]
ref|XP_009151942.1|  PREDICTED: serine/threonine-protein kinase D...    235   2e-69   Brassica rapa
gb|KHG22671.1|  kinase PVPK-1                                           239   2e-69   Gossypium arboreum [tree cotton]
ref|XP_010514472.1|  PREDICTED: serine/threonine-protein kinase D...    235   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002974209.1|  hypothetical protein SELMODRAFT_11420              230   3e-69   
ref|XP_002527210.1|  serine/threonine protein kinase, putative          234   3e-69   Ricinus communis
gb|KDP39835.1|  hypothetical protein JCGZ_04245                         234   4e-69   Jatropha curcas
ref|XP_006375136.1|  hypothetical protein POPTR_0014s04680g             237   6e-69   Populus trichocarpa [western balsam poplar]
ref|XP_002975063.1|  hypothetical protein SELMODRAFT_150418             229   7e-69   
gb|KCW71422.1|  hypothetical protein EUGRSUZ_F04483                     231   9e-69   Eucalyptus grandis [rose gum]
ref|XP_007213887.1|  hypothetical protein PRUPE_ppa005274mg             231   9e-69   
ref|XP_008778034.1|  PREDICTED: protein kinase G11A-like                234   1e-68   Phoenix dactylifera
ref|XP_011032069.1|  PREDICTED: serine/threonine-protein kinase D...    236   1e-68   Populus euphratica
ref|XP_011086319.1|  PREDICTED: serine/threonine-protein kinase A...    233   1e-68   Sesamum indicum [beniseed]
ref|XP_011086322.1|  PREDICTED: serine/threonine-protein kinase A...    233   1e-68   Sesamum indicum [beniseed]
ref|NP_189395.1|  serine/threonine-protein kinase AtPK7                 233   1e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09432.1|  unnamed protein product                                235   2e-68   Coffea canephora [robusta coffee]
ref|XP_003532893.2|  PREDICTED: protein kinase PVPK-1-like              229   3e-68   
ref|XP_002877061.1|  hypothetical protein ARALYDRAFT_905010             233   3e-68   
gb|KHN40552.1|  Protein kinase G11A                                     233   3e-68   
ref|XP_010092445.1|  Protein kinase G11A                                230   4e-68   
ref|XP_010258772.1|  PREDICTED: serine/threonine-protein kinase D...    234   5e-68   
ref|XP_004956409.1|  PREDICTED: protein kinase G11A-like                234   5e-68   
ref|XP_010275440.1|  PREDICTED: serine/threonine-protein kinase D...    234   5e-68   
emb|CBI24125.3|  unnamed protein product                                226   7e-68   
ref|XP_006652602.1|  PREDICTED: protein kinase G11A-like                233   9e-68   
gb|KHN40170.1|  Protein kinase G11A                                     228   1e-67   
ref|XP_010064106.1|  PREDICTED: serine/threonine-protein kinase D...    231   1e-67   
ref|NP_001053471.1|  Os04g0546300                                       233   1e-67   
emb|CAH67259.1|  OSIGBa0101C23.11                                       233   1e-67   
gb|KHG10280.1|  hypothetical protein F383_08647                         233   1e-67   
ref|XP_008783302.1|  PREDICTED: protein kinase G11A-like                227   1e-67   
gb|KJB24882.1|  hypothetical protein B456_004G166000                    233   2e-67   
ref|XP_006378619.1|  hypothetical protein POPTR_0010s18350g             228   2e-67   
ref|XP_008798795.1|  PREDICTED: protein kinase G11A-like                233   2e-67   
ref|XP_007134472.1|  hypothetical protein PHAVU_010G050000g             233   2e-67   
ref|XP_010933596.1|  PREDICTED: serine/threonine-protein kinase D...    233   2e-67   
ref|XP_010909306.1|  PREDICTED: serine/threonine-protein kinase D...    231   2e-67   
ref|XP_006445431.1|  hypothetical protein CICLE_v10019033mg             233   2e-67   
ref|XP_002511584.1|  serine/threonine protein kinase, putative          233   2e-67   
ref|XP_009591243.1|  PREDICTED: serine/threonine-protein kinase D...    227   2e-67   
ref|XP_009368604.1|  PREDICTED: serine/threonine-protein kinase D...    229   2e-67   
ref|XP_006583524.1|  PREDICTED: protein kinase G11A-like isoform X1     233   3e-67   
ref|XP_003551713.1|  PREDICTED: protein kinase G11A-like                233   3e-67   
ref|XP_004488602.1|  PREDICTED: protein kinase G11A-like                229   3e-67   
ref|XP_010669642.1|  PREDICTED: serine/threonine-protein kinase A...    229   3e-67   
ref|XP_010645075.1|  PREDICTED: serine/threonine-protein kinase A...    229   3e-67   
ref|XP_008225975.1|  PREDICTED: protein kinase G11A                     229   3e-67   
ref|XP_010645078.1|  PREDICTED: serine/threonine-protein kinase A...    228   3e-67   
ref|XP_008437762.1|  PREDICTED: protein kinase G11A                     232   3e-67   
ref|XP_009757571.1|  PREDICTED: serine/threonine-protein kinase D...    227   3e-67   
ref|XP_011012336.1|  PREDICTED: serine/threonine-protein kinase R...    229   3e-67   
ref|XP_003533562.1|  PREDICTED: protein kinase G11A-like                233   4e-67   
gb|KHN00203.1|  Protein kinase G11A                                     233   4e-67   
gb|KHN11564.1|  Protein kinase G11A                                     233   4e-67   
ref|XP_007139642.1|  hypothetical protein PHAVU_008G046900g             233   4e-67   
ref|XP_003521068.1|  PREDICTED: protein kinase G11A isoform X1          233   4e-67   
gb|EYU27604.1|  hypothetical protein MIMGU_mgv1a006055mg                226   4e-67   
emb|CBI16666.3|  unnamed protein product                                230   4e-67   
ref|XP_009353778.1|  PREDICTED: serine/threonine-protein kinase D...    232   5e-67   
ref|XP_002312217.1|  hypothetical protein POPTR_0008s08010g             226   5e-67   
gb|KEH17843.1|  Serine/Threonine kinase family protein                  232   6e-67   
ref|XP_004155204.1|  PREDICTED: protein kinase G11A-like                231   6e-67   
ref|XP_009353687.1|  PREDICTED: serine/threonine-protein kinase D...    232   6e-67   
ref|XP_008344471.1|  PREDICTED: protein kinase G11A-like isoform X2     232   6e-67   
ref|XP_008385304.1|  PREDICTED: protein kinase G11A-like                233   7e-67   
ref|XP_008786280.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    231   7e-67   
gb|EMT30895.1|  Protein kinase G11A                                     231   7e-67   
ref|XP_008344464.1|  PREDICTED: protein kinase G11A-like isoform X1     232   7e-67   
ref|XP_003545951.1|  PREDICTED: protein kinase G11A-like                228   7e-67   
ref|XP_009373217.1|  PREDICTED: serine/threonine-protein kinase D...    233   8e-67   
ref|NP_001151806.1|  LOC100285441                                       231   8e-67   
ref|XP_010669641.1|  PREDICTED: serine/threonine-protein kinase R...    228   8e-67   
ref|XP_002273241.1|  PREDICTED: serine/threonine-protein kinase D6PK    231   8e-67   
ref|XP_009373219.1|  PREDICTED: serine/threonine-protein kinase D...    233   8e-67   
ref|XP_004133761.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    231   8e-67   
gb|KDP28859.1|  hypothetical protein JCGZ_14630                         231   8e-67   
ref|XP_006347964.1|  PREDICTED: protein kinase G11A-like                231   8e-67   
gb|ABW75774.1|  viroid induced protein kinase                           220   8e-67   
ref|XP_003580270.1|  PREDICTED: serine/threonine-protein kinase D...    230   9e-67   
ref|XP_007149132.1|  hypothetical protein PHAVU_005G043800g             228   9e-67   
ref|XP_006842736.1|  hypothetical protein AMTR_s00133p00046270          226   9e-67   
ref|XP_011469219.1|  PREDICTED: serine/threonine-protein kinase D...    231   9e-67   
emb|CDP19349.1|  unnamed protein product                                228   1e-66   
emb|CAC39054.1|  putative protein kinase                                228   1e-66   
ref|XP_009796083.1|  PREDICTED: serine/threonine-protein kinase D...    230   1e-66   
ref|XP_004308500.1|  PREDICTED: serine/threonine-protein kinase D...    231   1e-66   
ref|XP_009624468.1|  PREDICTED: serine/threonine-protein kinase D...    230   1e-66   
ref|XP_006837381.1|  hypothetical protein AMTR_s00111p00126010          231   1e-66   
ref|XP_009407829.1|  PREDICTED: serine/threonine-protein kinase D...    230   2e-66   
ref|XP_001777627.1|  predicted protein                                  224   2e-66   
ref|XP_002446881.1|  hypothetical protein SORBIDRAFT_06g024300          229   2e-66   
gb|EEC83791.1|  hypothetical protein OsI_29700                          227   2e-66   
ref|XP_008349102.1|  PREDICTED: protein kinase PVPK-1-like              227   2e-66   
ref|XP_004492934.1|  PREDICTED: protein kinase G11A-like                230   2e-66   
ref|XP_011014454.1|  PREDICTED: serine/threonine-protein kinase A...    225   3e-66   
gb|EMS52003.1|  Protein kinase G11A                                     229   3e-66   
ref|XP_003570007.1|  PREDICTED: serine/threonine-protein kinase D...    229   3e-66   
ref|XP_007052314.1|  Kinase superfamily protein isoform 1               229   3e-66   
ref|XP_008232486.1|  PREDICTED: protein kinase G11A                     230   3e-66   
ref|XP_007220239.1|  hypothetical protein PRUPE_ppa001826mg             230   4e-66   
ref|XP_002983674.1|  hypothetical protein SELMODRAFT_234346             225   4e-66   
ref|XP_002990535.1|  hypothetical protein SELMODRAFT_185313             225   4e-66   
gb|EYU33809.1|  hypothetical protein MIMGU_mgv1a025268mg                223   4e-66   
ref|NP_001234611.1|  AvrPto-dependent Pto-interacting protein 3         229   5e-66   
gb|EAY86932.1|  hypothetical protein OsI_08316                          228   6e-66   
ref|XP_008371952.1|  PREDICTED: protein kinase G11A                     226   6e-66   
ref|XP_004515357.1|  PREDICTED: protein kinase G11A-like isoform X1     229   6e-66   
dbj|BAD25318.1|  putative protein kinase 5                              228   7e-66   
ref|NP_001047610.1|  Os02g0654300                                       228   7e-66   
ref|XP_006422318.1|  hypothetical protein CICLE_v10006731mg             223   7e-66   
emb|CAA66616.1|  protein kinase                                         223   8e-66   
ref|XP_010919725.1|  PREDICTED: serine/threonine-protein kinase D...    228   9e-66   
gb|KDO61508.1|  hypothetical protein CISIN_1g035713mg                   224   9e-66   
ref|XP_006647622.1|  PREDICTED: protein kinase G11A-like                228   1e-65   
ref|XP_009363307.1|  PREDICTED: serine/threonine-protein kinase D...    225   1e-65   
ref|XP_006344927.1|  PREDICTED: protein kinase G11A-like                223   1e-65   
ref|XP_009386043.1|  PREDICTED: serine/threonine-protein kinase D...    228   1e-65   
ref|XP_011089300.1|  PREDICTED: serine/threonine-protein kinase D...    228   1e-65   
ref|XP_010104280.1|  Protein kinase G11A                                228   1e-65   
emb|CDP20597.1|  unnamed protein product                                223   2e-65   
ref|XP_010915930.1|  PREDICTED: serine/threonine-protein kinase R...    224   2e-65   
gb|EPS64715.1|  hypothetical protein M569_10063                         226   2e-65   
gb|KEH23435.1|  Serine/Threonine kinase family protein                  228   2e-65   
gb|ABK94928.1|  unknown                                                 227   3e-65   
ref|XP_002302494.1|  kinase family protein                              227   3e-65   
ref|XP_011017345.1|  PREDICTED: serine/threonine-protein kinase D...    227   3e-65   
ref|XP_009799711.1|  PREDICTED: serine/threonine-protein kinase D...    224   3e-65   
ref|XP_004251960.1|  PREDICTED: serine/threonine-protein kinase D...    221   3e-65   
ref|XP_006493794.1|  PREDICTED: protein kinase G11A-like                224   4e-65   
gb|AES66130.2|  AGC family Serine/Threonine kinase family protein       224   4e-65   
ref|XP_004954788.1|  PREDICTED: protein kinase PVPK-1-like              223   4e-65   
ref|XP_003595879.1|  Protein kinase                                     224   4e-65   
ref|XP_010056393.1|  PREDICTED: serine/threonine-protein kinase D...    226   5e-65   
ref|XP_007022793.1|  AGC kinase 1.5                                     224   5e-65   
ref|XP_004163259.1|  PREDICTED: protein kinase G11A-like                221   5e-65   
ref|XP_010275917.1|  PREDICTED: serine/threonine-protein kinase D...    221   6e-65   
gb|KJB81467.1|  hypothetical protein B456_013G147000                    223   6e-65   
ref|XP_006859065.1|  hypothetical protein AMTR_s00068p00198560          222   7e-65   
gb|KHG27645.1|  hypothetical protein F383_06885                         222   7e-65   
ref|XP_009599293.1|  PREDICTED: serine/threonine-protein kinase D...    223   8e-65   
ref|XP_004509995.1|  PREDICTED: protein kinase PVPK-1-like              223   1e-64   
ref|XP_010692051.1|  PREDICTED: serine/threonine-protein kinase D...    225   1e-64   
ref|XP_011095839.1|  PREDICTED: serine/threonine-protein kinase A...    223   1e-64   
ref|XP_008442224.1|  PREDICTED: protein kinase PVPK-1-like isofor...    222   1e-64   
ref|XP_008442223.1|  PREDICTED: protein kinase PVPK-1-like isofor...    223   2e-64   
ref|XP_011093239.1|  PREDICTED: serine/threonine-protein kinase D...    224   2e-64   
ref|XP_004144670.1|  PREDICTED: protein kinase G11A-like                221   2e-64   
ref|XP_009779938.1|  PREDICTED: serine/threonine-protein kinase D...    224   2e-64   
gb|KEH19323.1|  AGC family Serine/Threonine kinase family protein       221   2e-64   
gb|AEW26786.1|  putative AGC kinase                                     221   2e-64   
ref|XP_009605750.1|  PREDICTED: serine/threonine-protein kinase D...    224   3e-64   
dbj|BAD21495.1|  putative viroid symptom modulation protein             219   4e-64   
ref|XP_006338494.1|  PREDICTED: protein kinase G11A-like                220   4e-64   
ref|XP_010260856.1|  PREDICTED: serine/threonine-protein kinase D6PK    221   5e-64   
ref|XP_009392541.1|  PREDICTED: serine/threonine-protein kinase D...    215   5e-64   
ref|XP_009399849.1|  PREDICTED: serine/threonine-protein kinase D...    220   7e-64   
ref|XP_009400226.1|  PREDICTED: serine/threonine-protein kinase D...    223   7e-64   
gb|KHN38169.1|  Serine/threonine-protein kinase AtPK7                   216   8e-64   
gb|KCW55957.1|  hypothetical protein EUGRSUZ_I01739                     219   8e-64   
ref|XP_004293805.1|  PREDICTED: serine/threonine-protein kinase A...    219   8e-64   
ref|XP_006301875.1|  hypothetical protein CARUB_v10022348mg             213   9e-64   
gb|EPS68752.1|  hypothetical protein M569_06017                         216   9e-64   
gb|ABR16313.1|  unknown                                                 219   1e-63   
ref|XP_002517439.1|  serine/threonine protein kinase, putative          218   1e-63   
ref|XP_010557367.1|  PREDICTED: serine/threonine-protein kinase D6PK    219   1e-63   
ref|XP_009389885.1|  PREDICTED: serine/threonine-protein kinase D...    222   2e-63   
dbj|BAJ86465.1|  predicted protein                                      221   2e-63   
ref|XP_010234145.1|  PREDICTED: serine/threonine-protein kinase D...    214   2e-63   
gb|EEE56748.1|  hypothetical protein OsJ_06277                          220   2e-63   
ref|XP_001781978.1|  predicted protein                                  216   2e-63   
gb|EPS68031.1|  viroid symptom modulation protein                       216   3e-63   
ref|XP_010029109.1|  PREDICTED: serine/threonine-protein kinase D...    219   3e-63   
ref|XP_007133463.1|  hypothetical protein PHAVU_011G1806000g            217   4e-63   
ref|XP_009387224.1|  PREDICTED: serine/threonine-protein kinase D...    218   5e-63   
ref|XP_009620635.1|  PREDICTED: serine/threonine-protein kinase D6PK    217   5e-63   
ref|XP_004233692.2|  PREDICTED: serine/threonine-protein kinase D...    217   6e-63   
ref|XP_006431047.1|  hypothetical protein CICLE_v10011523mg             216   6e-63   
ref|XP_003530389.2|  PREDICTED: protein kinase PVPK-1-like              218   7e-63   
gb|AFW70850.1|  putative protein kinase superfamily protein             216   7e-63   
ref|XP_008645458.1|  PREDICTED: protein kinase PVPK-1-like              217   8e-63   
gb|EYU42343.1|  hypothetical protein MIMGU_mgv1a002609mg                219   8e-63   
gb|EEC72927.1|  hypothetical protein OsI_06771                          218   1e-62   
gb|KDO72425.1|  hypothetical protein CISIN_1g010603mg                   216   1e-62   
gb|KDP45444.1|  hypothetical protein JCGZ_09693                         216   1e-62   
emb|CBI34999.3|  unnamed protein product                                216   1e-62   
ref|XP_010486995.1|  PREDICTED: serine/threonine-protein kinase D...    218   1e-62   
ref|XP_010499345.1|  PREDICTED: serine/threonine-protein kinase D...    217   1e-62   
ref|XP_004248529.1|  PREDICTED: serine/threonine-protein kinase D...    219   1e-62   
gb|EYU34122.1|  hypothetical protein MIMGU_mgv1a024729mg                216   1e-62   
ref|NP_178045.2|  AGC kinase 1.7                                        216   2e-62   
ref|XP_010465047.1|  PREDICTED: serine/threonine-protein kinase D...    217   2e-62   
ref|XP_009763893.1|  PREDICTED: serine/threonine-protein kinase D...    216   2e-62   
ref|XP_008793132.1|  PREDICTED: protein kinase G11A-like                214   2e-62   
ref|XP_006299067.1|  hypothetical protein CARUB_v10015207mg             217   2e-62   
ref|XP_002889239.1|  hypothetical protein ARALYDRAFT_316818             216   2e-62   
gb|AAC17041.1|  Strong similarity to ser/thr protein kinases, esp...    216   2e-62   
ref|XP_003565535.1|  PREDICTED: serine/threonine-protein kinase D...    217   2e-62   
emb|CDY71460.1|  BnaCnng72980D                                          207   3e-62   
ref|XP_010532023.1|  PREDICTED: serine/threonine-protein kinase D6PK    216   3e-62   
ref|XP_002276011.1|  PREDICTED: serine/threonine-protein kinase D6PK    216   3e-62   
ref|XP_010924538.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    216   3e-62   
ref|XP_002884920.1|  hypothetical protein ARALYDRAFT_478629             216   3e-62   
emb|CDM82518.1|  unnamed protein product                                216   3e-62   
ref|XP_006338894.1|  PREDICTED: protein kinase PVPK-1-like              218   4e-62   
ref|XP_011008366.1|  PREDICTED: serine/threonine-protein kinase D...    214   4e-62   
ref|XP_002451965.1|  hypothetical protein SORBIDRAFT_04g011120          214   5e-62   
ref|XP_006662606.1|  PREDICTED: protein kinase G11A-like                214   6e-62   
emb|CDY68493.1|  BnaA02g36230D                                          206   6e-62   
gb|AAD34696.1|AC006341_24  Similar to gb|J04556 G11A protein from...    213   7e-62   
ref|XP_002880141.1|  hypothetical protein ARALYDRAFT_483612             218   7e-62   
gb|EMT16209.1|  Protein kinase G11A                                     218   8e-62   
ref|XP_010497848.1|  PREDICTED: serine/threonine-protein kinase D...    213   8e-62   
gb|ABE65627.1|  protein kinase                                          211   9e-62   
ref|XP_010459184.1|  PREDICTED: serine/threonine-protein kinase D...    213   9e-62   
ref|NP_173094.4|  protein root hair specific 3                          213   1e-61   
gb|ABK28399.1|  unknown                                                 211   1e-61   
gb|KFK43853.1|  hypothetical protein AALP_AA1G182200                    213   1e-61   
ref|NP_187875.1|  putative serine/threonine kinase                      215   1e-61   
ref|XP_004983636.1|  PREDICTED: protein kinase G11A-like                216   1e-61   
ref|XP_006407305.1|  hypothetical protein EUTSA_v10020378mg             215   1e-61   
ref|XP_002890166.1|  hypothetical protein ARALYDRAFT_471840             211   1e-61   
ref|XP_002324027.2|  hypothetical protein POPTR_0017s11180g             214   1e-61   
ref|XP_006303623.1|  hypothetical protein CARUB_v10011491mg             213   2e-61   
gb|AAC31841.1|  putative protein kinase                                 217   2e-61   
ref|NP_001065394.1|  Os10g0562500                                       211   2e-61   
emb|CDX74691.1|  BnaA05g04370D                                          214   2e-61   
ref|XP_008658451.1|  PREDICTED: protein kinase G11A-like                216   2e-61   
ref|XP_006293727.1|  hypothetical protein CARUB_v10022689mg             217   2e-61   
ref|NP_850426.1|  protein kinase                                        217   2e-61   
ref|XP_006482514.1|  PREDICTED: protein kinase PVPK-1-like              213   2e-61   
gb|AAL84933.1|  At2g44830/T13E15.16                                     217   2e-61   
emb|CDY23458.1|  BnaC04g49860D                                          215   2e-61   
ref|XP_010508244.1|  PREDICTED: serine/threonine-protein kinase D...    217   2e-61   
ref|XP_010518088.1|  PREDICTED: serine/threonine-protein kinase D...    217   2e-61   
ref|XP_006397663.1|  hypothetical protein EUTSA_v10001322mg             217   2e-61   
ref|XP_010670354.1|  PREDICTED: serine/threonine-protein kinase D...    213   2e-61   
ref|XP_007032344.1|  Kinase superfamily protein                         213   2e-61   
ref|XP_006389906.1|  hypothetical protein EUTSA_v10019858mg             214   3e-61   



>ref|XP_011095569.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095570.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095571.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
 ref|XP_011095573.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Sesamum indicum]
Length=587

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 157/168 (93%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  424  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  483

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  484  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAS  543

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPV+ ERIP PPP+ S +   VA  AIP+ PQNSDNYLEFDFF
Sbjct  544  PPEVPRPVDMERIPLPPPSTSLK---VAPAAIPA-PQNSDNYLEFDFF  587



>ref|XP_004244035.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324244.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
 ref|XP_010324245.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Solanum 
lycopersicum]
Length=604

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNR TLFNV
Sbjct  440  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRQTLFNV  499

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  500  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  559

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI  PP A +++K V  AG +P   +NSDNYLEFDFF
Sbjct  560  PPEIPRPVEFERISVPPAASTSEKGV--AGTVPY-QKNSDNYLEFDFF  604



>ref|XP_006346118.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006346119.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006346120.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006346121.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=604

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNR TLFNV
Sbjct  440  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRQTLFNV  499

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  500  VGQPLRFPETPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  559

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI  PP A +++K V  AG +P   +NSDNYLEFDFF
Sbjct  560  PPEIPRPVEFERISVPPAASTSEKGV--AGTVPY-QKNSDNYLEFDFF  604



>ref|XP_011097742.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097743.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097744.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097745.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097746.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097747.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
 ref|XP_011097749.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Sesamum 
indicum]
Length=600

 Score =   276 bits (706),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATL NV
Sbjct  436  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLLNV  495

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  496  VGQPLRFPESPVVSFAARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAS  555

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPVEFE++ APP + S +  V  A AIP+ PQNSDNYLEFDFF
Sbjct  556  PPEVPRPVEFEKLSAPPASSSLK--VAPAAAIPT-PQNSDNYLEFDFF  600



>ref|XP_009625904.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625905.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009625906.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Nicotiana tomentosiformis]
Length=589

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 152/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI APP + S +   V         QNSDNYLEFDFF
Sbjct  546  PPEIPRPVEFERISAPPTSTSEKPVAVPVRN----QQNSDNYLEFDFF  589



>ref|XP_009790589.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790590.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790591.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
 ref|XP_009790592.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=589

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 152/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI APP + S +   V         QNSDNYLEFDFF
Sbjct  546  PPEIPRPVEFERISAPPTSTSEKPVAVPVRN----QQNSDNYLEFDFF  589



>ref|XP_009606402.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606403.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606404.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606405.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606406.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606407.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606408.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606409.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606410.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
 ref|XP_009606411.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
Length=587

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 156/168 (93%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNR TLFNV
Sbjct  424  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRQTLFNV  483

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  484  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  543

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI   P A +++K+V  AG +P   +NSDNYLEFDFF
Sbjct  544  PPEIPRPVEFERISV-PAASTSEKAV--AGTVPQ-QKNSDNYLEFDFF  587



>ref|XP_009625903.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X1 [Nicotiana tomentosiformis]
Length=631

 Score =   274 bits (701),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 152/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  468  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  527

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  528  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  587

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI APP + S +   V         QNSDNYLEFDFF
Sbjct  588  PPEIPRPVEFERISAPPTSTSEKPVAVPVRN----QQNSDNYLEFDFF  631



>ref|XP_009774023.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=587

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 156/168 (93%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNR TLFNV
Sbjct  424  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRQTLFNV  483

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  484  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  543

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI   P A +++K+V  AG +P   +NSDNYLEFDFF
Sbjct  544  PPEIPRPVEFERISV-PVASTSEKAV--AGTVPH-QKNSDNYLEFDFF  587



>ref|XP_004236648.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010319220.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=607

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLIKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVEFER+  P PAPS  +  V A   PS  + SDNYLEFDFF
Sbjct  563  PPEVPKPVEFERL--PVPAPSTNQKTVPAAVAPS-QKGSDNYLEFDFF  607



>emb|CBI23515.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 141/170 (83%), Gaps = 18/170 (11%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  157  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  216

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCA+
Sbjct  217  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAT  276

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P P   + + A  A  S  ++SDNYLEFDFF
Sbjct  277  ---------------PPEIPKPVEIERIPAPTASTS-EKSSDNYLEFDFF  310



>ref|XP_006350249.1| PREDICTED: protein kinase G11A-like [Solanum tuberosum]
Length=607

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLIKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVEFER+  P PAPS  +  V A   PS  + SDNYLEFDFF
Sbjct  563  PPEVPKPVEFERL--PVPAPSTNQKTVPAAVAPS-QKGSDNYLEFDFF  607



>ref|XP_006352558.1| PREDICTED: protein kinase G11A-like isoform X1 [Solanum tuberosum]
 ref|XP_006352559.1| PREDICTED: protein kinase G11A-like isoform X2 [Solanum tuberosum]
 ref|XP_006352560.1| PREDICTED: protein kinase G11A-like isoform X3 [Solanum tuberosum]
 ref|XP_006352561.1| PREDICTED: protein kinase G11A-like isoform X4 [Solanum tuberosum]
Length=613

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 152/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  509  VGQPLRFPESPVVSFSARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAS  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFERI A  P+ +++K V          Q SDNYLEFDFF
Sbjct  569  PPEIPRPVEFERISAQQPSSTSEKPVAVTVQY---QQKSDNYLEFDFF  613



>ref|XP_011095891.1| PREDICTED: serine/threonine-protein kinase D6PK [Sesamum indicum]
 ref|XP_011095892.1| PREDICTED: serine/threonine-protein kinase D6PK [Sesamum indicum]
 ref|XP_011095894.1| PREDICTED: serine/threonine-protein kinase D6PK [Sesamum indicum]
Length=607

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  446  SNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  505

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  506  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  565

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPV+++R+P  P AP+N+K     GAI +  Q SD YLEFDFF
Sbjct  566  PPEIPRPVDYDRLPT-PAAPANEK-----GAIAATDQKSDKYLEFDFF  607



>emb|CDP13698.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 154/168 (92%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  444  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  503

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFS+RDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  504  VGQPLRFPESPVVSFSSRDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  563

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRP E E+IP  P A + +K   A GA+P   QNSDNYLEFDFF
Sbjct  564  PPEIPRPFEIEKIPV-PTASTGEKP--APGAMP-FQQNSDNYLEFDFF  607



>ref|XP_009770032.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
sylvestris]
Length=605

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  441  TAARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  500

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  501  VGQPLRFPESPVVSFAARDLIRGLLIKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAT  560

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VP+PVEFER+P  P A +NQK+ +A  A+P   + SDNYLEFDFF
Sbjct  561  PPDVPKPVEFERLPI-PAASTNQKTALA--AVPPSQKGSDNYLEFDFF  605



>ref|XP_004248326.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010327213.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=613

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  509  VGQPLRFPESPVVSFSARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAS  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEFER  A  P+ +++K V          Q SDNYLEFDFF
Sbjct  569  PPEIPRPVEFERFSAQQPSSTSEKPVAVTVQY---QQKSDNYLEFDFF  613



>ref|XP_007026392.1| D6 protein kinase like 2 [Theobroma cacao]
 gb|EOY29014.1| D6 protein kinase like 2 [Theobroma cacao]
Length=614

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKGSGNRATLFNV
Sbjct  449  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  509  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+PAPP + S + +   A A     + SDNYLEFDFF
Sbjct  569  PPEIPKPVELERVPAPPASTSEKVAANVAAAYDQ--KGSDNYLEFDFF  614



>gb|EYU27452.1| hypothetical protein MIMGU_mgv1a003783mg [Erythranthe guttata]
 gb|EYU27453.1| hypothetical protein MIMGU_mgv1a003783mg [Erythranthe guttata]
Length=564

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  395  TDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  454

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATE+KQHPFFEGVNWALIRCAS
Sbjct  455  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEVKQHPFFEGVNWALIRCAS  514

Query  411  ppevprpveferiPA--PPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VPRPV+FERI A   PPA +  K    A    + PQ SDNYLEFDFF
Sbjct  515  PPDVPRPVDFERIAAVVVPPAENGLKVAPPAPVAAATPQKSDNYLEFDFF  564



>gb|KJB68519.1| hypothetical protein B456_010G248100 [Gossypium raimondii]
 gb|KJB68521.1| hypothetical protein B456_010G248100 [Gossypium raimondii]
Length=573

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  409  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  468

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  469  VGQPLRFPESPIVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  528

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+PA P + S +   VA  A     + SDNYLEFDFF
Sbjct  529  PPEIPKPVELERVPASPASTSEK---VAVNAAAYNQKGSDNYLEFDFF  573



>ref|XP_003594321.1| Protein kinase [Medicago truncatula]
 gb|AES64572.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=604

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT+GIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  437  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFLYELLFGKTPFKGSGNRATLFNV  496

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  497  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  556

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ VEFE+IP+P  + + +K+VV   +     + SDNYLEFDFF
Sbjct  557  PPEIPKAVEFEKIPSPAASSAGEKAVVNHMSTAPNQKGSDNYLEFDFF  604



>ref|XP_002530422.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF31953.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=612

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  509  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PA +++K+  +A A+P   + SDNYLEFDFF
Sbjct  569  --PPEIPKPVEVERVPVPASTSEKA-TSAPAVPD-KKGSDNYLEFDFF  612



>ref|XP_008464303.1| PREDICTED: protein kinase G11A-like [Cucumis melo]
 ref|XP_008464304.1| PREDICTED: protein kinase G11A-like [Cucumis melo]
 ref|XP_008464305.1| PREDICTED: protein kinase G11A-like [Cucumis melo]
 ref|XP_008464307.1| PREDICTED: protein kinase G11A-like [Cucumis melo]
 ref|XP_008464308.1| PREDICTED: protein kinase G11A-like [Cucumis melo]
Length=607

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 155/168 (92%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ERIP+P P P + K+V+A     S  ++SDNYLEFDFF
Sbjct  563  PPEVPKPVEIERIPSPAP-PVSGKAVMARPGPDS--KSSDNYLEFDFF  607



>ref|XP_008224641.1| PREDICTED: protein kinase G11A [Prunus mume]
Length=616

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  510  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+PAP  + S ++      A P   + SDNYLEFDFF
Sbjct  570  PPEIPKPVEIERMPAPTASSSEKEKAPTPTAAPD-QKGSDNYLEFDFF  616



>ref|XP_004486363.1| PREDICTED: protein kinase G11A-like isoform X1 [Cicer arietinum]
 ref|XP_004486364.1| PREDICTED: protein kinase G11A-like isoform X2 [Cicer arietinum]
 ref|XP_004486365.1| PREDICTED: protein kinase G11A-like isoform X3 [Cicer arietinum]
 ref|XP_004486366.1| PREDICTED: protein kinase G11A-like isoform X4 [Cicer arietinum]
 ref|XP_004486367.1| PREDICTED: protein kinase G11A-like isoform X5 [Cicer arietinum]
 ref|XP_004486368.1| PREDICTED: protein kinase G11A-like isoform X6 [Cicer arietinum]
 ref|XP_004486369.1| PREDICTED: protein kinase G11A-like isoform X7 [Cicer arietinum]
Length=608

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT+GIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  440  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFLYELLFGKTPFKGSGNRATLFNV  499

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  500  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  559

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAG-AIPSCPQNSDNYLEFDFF  268
            PPE+P+PVEFE+IP+P P+ + +K+VV    +  S  + SDNYLEFDFF
Sbjct  560  PPEIPKPVEFEKIPSPAPSSAGEKAVVNNHMSTASNQKGSDNYLEFDFF  608



>ref|XP_007214796.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 ref|XP_007214797.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 gb|EMJ15995.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
 gb|EMJ15996.1| hypothetical protein PRUPE_ppa002965mg [Prunus persica]
Length=616

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  510  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERIPAP  + S ++      A P   + SDNYLEFDFF
Sbjct  570  PPEIPKPVEIERIPAPTASSSEKEKAPTPTAAPD-QKGSDNYLEFDFF  616



>ref|XP_010686610.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNRATLFNV
Sbjct  441  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRATLFNV  500

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF ARDLI+GLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  501  VGQPLRFPESPSVSFGARDLIKGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  560

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PV  E+  APP   SN+K+ VA G +P   + SDNYLEFDFF
Sbjct  561  PPEIPKPVVIEKTAAPP--TSNEKAAVAMG-VPD-HKGSDNYLEFDFF  604



>ref|XP_006449950.1| hypothetical protein CICLE_v10014638mg [Citrus clementina]
 ref|XP_006449951.1| hypothetical protein CICLE_v10014638mg [Citrus clementina]
 gb|ESR63190.1| hypothetical protein CICLE_v10014638mg [Citrus clementina]
 gb|ESR63191.1| hypothetical protein CICLE_v10014638mg [Citrus clementina]
Length=611

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  447  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  507  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  566

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERIPAP  + S +    A   +P   + SDNYLEFDFF
Sbjct  567  PPEIPKPVEIERIPAPTSSTSEK---TAPTMVPPNQRGSDNYLEFDFF  611



>ref|XP_006467259.1| PREDICTED: protein kinase G11A-like [Citrus sinensis]
 gb|KDO78599.1| hypothetical protein CISIN_1g007260mg [Citrus sinensis]
 gb|KDO78600.1| hypothetical protein CISIN_1g007260mg [Citrus sinensis]
Length=611

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  447  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  507  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  566

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERIPAP  + S +    A   +P   + SDNYLEFDFF
Sbjct  567  PPEIPKPVEIERIPAPTSSTSEK---TAPTMVPPNQRGSDNYLEFDFF  611



>ref|XP_002522785.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF39636.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=532

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 145/168 (86%), Gaps = 8/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  373  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  432

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  433  VGQPLRFPESPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  492

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+  E E+I APP          +   +P+     +NYLEFDFF
Sbjct  493  PPEIPKLPEIEQIRAPP--------STSGKGVPTVLPEQNNYLEFDFF  532



>ref|XP_004173166.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
Length=607

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 155/168 (92%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ERIP+P P P + K+++A     S  ++SDNYLEFDFF
Sbjct  563  PPEVPKPVEIERIPSPAP-PVSGKAIMARPGPDS--KSSDNYLEFDFF  607



>ref|XP_004139518.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
 gb|KGN65005.1| hypothetical protein Csa_1G175730 [Cucumis sativus]
Length=607

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 155/168 (92%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ERIP+P P P + K+++A     S  ++SDNYLEFDFF
Sbjct  563  PPEVPKPVEIERIPSPAP-PVSGKAIMARPGPDS--KSSDNYLEFDFF  607



>ref|XP_009630659.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nicotiana 
tomentosiformis]
Length=605

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  441  TAARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  500

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  501  VGQPLRFPESPVVSFAARDLIRGLLIKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAT  560

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VP+PVEFER+P  P A +N K+ +A  A+P   + SDNYLEFDFF
Sbjct  561  PPDVPKPVEFERLPI-PAASTNHKTALA--AVPPSQKGSDNYLEFDFF  605



>ref|XP_008802695.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
 ref|XP_008802696.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
Length=623

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  462  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  521

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  522  VGQPLRFPESPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  581

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE +  P  PPA +++K   AA       + SDNYLEFDFF
Sbjct  582  PPEIPKPVEVDWSPR-PPASTSEKVASAANQ-----KGSDNYLEFDFF  623



>gb|KDP35525.1| hypothetical protein JCGZ_08963 [Jatropha curcas]
Length=610

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  446  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  505

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+A+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  506  VGQPLRFPEAPVVSFAAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  565

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+P PPP+ +N K+V    A     + SDNYLEFDFF
Sbjct  566  PPEIPKPVEVERVPVPPPS-ANVKTVGTVAAPDK--KGSDNYLEFDFF  610



>ref|XP_010252801.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nelumbo 
nucifera]
 ref|XP_010252802.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Nelumbo 
nucifera]
Length=608

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 149/168 (89%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  508  VGQPLRFPESPVVSFQARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERI AP  + S + + V         ++S NYLEFDFF
Sbjct  568  PPEIPKPVEIERISAPTASTSEKAATVNE-------KSSGNYLEFDFF  608



>ref|XP_008384194.1| PREDICTED: protein kinase G11A [Malus domestica]
 ref|XP_008384195.1| PREDICTED: protein kinase G11A [Malus domestica]
Length=607

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  439  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  498

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  499  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  558

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PP++P+PVE ERIPAP  + S ++       I S  Q  SDNYLEFDFF
Sbjct  559  PPDIPKPVEIERIPAPTASSSEKEKAPPTPTIASPVQKGSDNYLEFDFF  607



>ref|XP_008358790.1| PREDICTED: protein kinase G11A-like [Malus domestica]
 ref|XP_008358791.1| PREDICTED: protein kinase G11A-like [Malus domestica]
 ref|XP_008358793.1| PREDICTED: protein kinase G11A-like [Malus domestica]
Length=607

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  439  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  498

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  499  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  558

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PP++P+PVE ERIPAP  + S ++       I S  Q  SDNYLEFDFF
Sbjct  559  PPDIPKPVEIERIPAPTASSSEKEKAPPTPTIASPVQKGSDNYLEFDFF  607



>ref|XP_004293409.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATL+NV
Sbjct  445  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLYNV  504

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  505  VGQPLRFPESPVVSFAARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAT  564

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+PAP  +PS ++       +    + SDNYLEFDFF
Sbjct  565  PPEIPKPVEIERMPAPTVSPSAKEKAPTIMKVAPDQKGSDNYLEFDFF  612



>ref|XP_002307848.1| CsPK1.1 family protein [Populus trichocarpa]
 gb|EEE91371.1| CsPK1.1 family protein [Populus trichocarpa]
Length=501

 Score =   264 bits (674),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  338  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  397

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  398  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  457

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PA +++K+   A A     + S+NYLEFDFF
Sbjct  458  --PPEIPKPVEIERIPGPASTSEKAATVAAAPGQ--KGSENYLEFDFF  501



>ref|XP_010942863.1| PREDICTED: serine/threonine-protein kinase D6PK [Elaeis guineensis]
Length=623

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 148/168 (88%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  462  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  521

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  522  VGQPLRFPESPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  581

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE +  P PP + S + +  A        + SDNYLEFDFF
Sbjct  582  PPEIPKPVEVDWSPRPPASTSEKVASTANQ------KGSDNYLEFDFF  623



>ref|XP_003577034.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Brachypodium 
distachyon]
Length=567

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 139/173 (80%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVV F+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  470  VGQPLRFPESPVVGFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  529

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAA---GAIPSCPQNSDNYLEFDFF  268
                           PP  P P      VA+    A PS  + SDNYLEFDFF
Sbjct  530  ---------------PPDIPKPVEIPRPVASTSQKATPSADKGSDNYLEFDFF  567



>ref|XP_010450415.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010450424.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010450429.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010443228.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010443229.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010443231.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010483058.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
 ref|XP_010483059.1| PREDICTED: serine/threonine-protein kinase D6PK [Camelina sativa]
Length=498

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 140/171 (82%), Gaps = 14/171 (8%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  458

Query  411  ppevprpveferiPAPPPA---PSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+           P P    P N    V A A  S   +  NYLEFDFF
Sbjct  459  PPEI-----------PKPVDLEPVNPNPTVPAAASSSVRSDQSNYLEFDFF  498



>ref|XP_009374840.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
 ref|XP_009374841.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
 ref|XP_009374842.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Pyrus x bretschneideri]
Length=607

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  439  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  498

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  499  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  558

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PP++PRPVE ERIPAP  + S ++       I +  Q  SDNYLEFDFF
Sbjct  559  PPDIPRPVEIERIPAPTASSSEKEKAPPTPTIAAPDQKGSDNYLEFDFF  607



>ref|XP_011005724.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
 ref|XP_011005725.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
 ref|XP_011005726.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
 ref|XP_011005727.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
Length=611

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  508  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PA +++K V    A P   + SDNYLEFDFF
Sbjct  568  --PPEIPKPVEIERIPGPASASEK-VATVAAAPR-QKGSDNYLEFDFF  611



>ref|XP_010495823.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Camelina 
sativa]
Length=333

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  167  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  226

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  227  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  286

Query  411  ppevprpveferiPAP-PPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E+ PA    APS+QK+  AAG + +  + SDNYLEFDFF
Sbjct  287  PPEIPKPVELEKEPASVAEAPSSQKT--AAGLVLNAQKGSDNYLEFDFF  333



>ref|NP_001062116.1| Os08g0491200 [Oryza sativa Japonica Group]
 dbj|BAD09675.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD09997.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF24030.1| Os08g0491200 [Oryza sativa Japonica Group]
 dbj|BAG96192.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 141/168 (84%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  434  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  493

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVK+PQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  494  VGQPLRFPESPMVSFSARDLIRGLLVKDPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  553

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PAP+ +K   AA       + SDNYLEF+FF
Sbjct  554  --PPEIPKPVELERPPKPAPATEKVAPAANQ-----KGSDNYLEFEFF  594



>ref|XP_009387487.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387489.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387490.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
Length=605

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF+YELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFMYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  503  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PV  ER+  P  + S +K    A       + SDNYLEFDFF
Sbjct  563  PPEIPKPVNIERLSRPTVSTSEKKVAATANY-----EGSDNYLEFDFF  605



>ref|XP_010676085.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676086.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676087.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Beta vulgaris 
subsp. vulgaris]
Length=612

 Score =   266 bits (679),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VSF ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  508  VGQPLRFPETPAVSFQARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVEF+RI   PPA S++K+ +  G +P   + SDNYLEFDFF
Sbjct  568  PPEIPRPVEFDRIRV-PPASSSEKAAMPVG-MPD-QKGSDNYLEFDFF  612



>ref|XP_010928069.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
 ref|XP_010928070.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
 ref|XP_010928071.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
Length=622

 Score =   266 bits (680),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 141/169 (83%), Gaps = 8/169 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  461  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  520

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFS RDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  521  VGQPLRFPESPIVSFSVRDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  580

Query  411  ppevprpveferiPAP-PPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E   AP PPA +++K   A        Q SDNYLEFDFF
Sbjct  581  --PPEIPKLVEPERAPRPPASTSEKVAPATNE-----QGSDNYLEFDFF  622



>gb|KDP39299.1| hypothetical protein JCGZ_01056 [Jatropha curcas]
Length=605

 Score =   266 bits (679),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 147/168 (88%), Gaps = 8/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  446  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  505

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  506  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  565

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+P E E IPAPP       S    GA    P+  +NYLEFDFF
Sbjct  566  PPEIPKPPEIEHIPAPP-------STSGKGAPAVLPEQ-NNYLEFDFF  605



>gb|KJB63056.1| hypothetical protein B456_009G451500 [Gossypium raimondii]
Length=496

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 141/176 (80%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  336  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  395

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  396  VGQPLRFPESPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  455

Query  411  ppevprpveferiPAPP--PAPSNQKSV----VAAGAIPSCPQNSD--NYLEFDFF  268
                           PP  P P + + +     +AG  PS P   D  NYLEFDFF
Sbjct  456  ---------------PPEIPKPVDIERIRTPTSSAGDKPSVPAAKDQSNYLEFDFF  496



>ref|XP_010039426.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 ref|XP_010039427.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 ref|XP_010039429.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 gb|KCW45970.1| hypothetical protein EUGRSUZ_L00145 [Eucalyptus grandis]
Length=614

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSF+ARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  510  VGQPLRFPESPMVSFAARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGVNWALIRCAT  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PV+ ERIP P  +PS + +V  A  IP   + SDNYLEFDFF
Sbjct  570  PPEVPKPVDIERIPVPLTSPSEKAAV--ATTIPD-KKGSDNYLEFDFF  614



>ref|XP_003574687.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Brachypodium 
distachyon]
 ref|XP_010235248.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Brachypodium 
distachyon]
Length=599

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 142/168 (85%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  439  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  498

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFS RDLIRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  499  VGQPLRFPESPIVSFSGRDLIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAT  558

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E   A  PAPS++K+V  AG      + SDNYLEF+FF
Sbjct  559  --PPDVPKPVELERATKPAPSSEKAVPPAGQ-----KGSDNYLEFEFF  599



>ref|XP_006380864.1| hypothetical protein POPTR_0006s00570g [Populus trichocarpa]
 gb|ERP58661.1| hypothetical protein POPTR_0006s00570g [Populus trichocarpa]
Length=611

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  508  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PA +++K+   A A     + S+NYLEFDFF
Sbjct  568  --PPEIPKPVEIERIPGPASTSEKAATVAAAPGQ--KGSENYLEFDFF  611



>ref|XP_011040152.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
 ref|XP_011040153.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Populus 
euphratica]
Length=612

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLA KRGATEIKQHPFFEGVNWALIRCA+
Sbjct  509  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLASKRGATEIKQHPFFEGVNWALIRCAT  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERI  P PA +++K+   A A     + SDNYLEFDFF
Sbjct  569  PPEIPKPVEIERI--PAPASTSEKATTVAAAPGQ--KGSDNYLEFDFF  612



>ref|XP_010545283.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Tarenaya 
hassleriana]
 ref|XP_010545284.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Tarenaya 
hassleriana]
Length=512

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 139/172 (81%), Gaps = 19/172 (11%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  356  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  415

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQ LRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  416  VGQSLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  475

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAAGAIPSC--PQNSDNYLEFDFF  268
                           PP  P P   ++V A  A  +   P  S+NYLEFDFF
Sbjct  476  ---------------PPEIPKPVELENVPAPAATSTSVRPDQSNNYLEFDFF  512



>dbj|BAA01731.1| protein kinase [Arabidopsis thaliana]
Length=498

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 136/175 (78%), Gaps = 22/175 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  458

Query  411  ppevprpveferiPAPPPAPS-------NQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P        N    V A A  S   +  NYLEFDFF
Sbjct  459  ---------------PPEIPKPVILKLLNPTPTVPAAASSSVRSDQSNYLEFDFF  498



>gb|KJB63055.1| hypothetical protein B456_009G451500 [Gossypium raimondii]
 gb|KJB63057.1| hypothetical protein B456_009G451500 [Gossypium raimondii]
 gb|KJB63058.1| hypothetical protein B456_009G451500 [Gossypium raimondii]
 gb|KJB63059.1| hypothetical protein B456_009G451500 [Gossypium raimondii]
Length=560

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 141/176 (80%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  400  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  459

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  460  VGQPLRFPESPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  519

Query  411  ppevprpveferiPAPP--PAPSNQKSV----VAAGAIPSCPQNSD--NYLEFDFF  268
                           PP  P P + + +     +AG  PS P   D  NYLEFDFF
Sbjct  520  ---------------PPEIPKPVDIERIRTPTSSAGDKPSVPAAKDQSNYLEFDFF  560



>ref|NP_200402.1| D6 protein kinase [Arabidopsis thaliana]
 sp|Q9FG74.1|D6PK_ARATH RecName: Full=Serine/threonine-protein kinase D6PK; AltName: 
Full=D6 protein kinase; AltName: Full=Serine/threonine-protein 
kinase AGC1-1; AltName: Full=Serine/threonine-protein kinase 
AtPK64 [Arabidopsis thaliana]
 dbj|BAB08656.1| serine/threonine-specific protein kinase ATPK64 [Arabidopsis 
thaliana]
 gb|AED96698.1| D6 protein kinase [Arabidopsis thaliana]
Length=498

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 136/175 (78%), Gaps = 22/175 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  458

Query  411  ppevprpveferiPAPPPAPS-------NQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P        N    V A A  S   +  NYLEFDFF
Sbjct  459  ---------------PPEIPKPVDLEALNPTPTVPAAASSSVRSDQSNYLEFDFF  498



>ref|XP_009395513.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395514.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=616

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 137/176 (78%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  456  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  515

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  516  IGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  575

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN--------SDNYLEFDFF  268
                           PP  P    +    G + S  Q         SDNYLEFDFF
Sbjct  576  ---------------PPEVPKPIVTEQTMGPVASTSQKAKTSFKKGSDNYLEFDFF  616



>ref|XP_002322497.2| hypothetical protein POPTR_0016s00660g [Populus trichocarpa]
 gb|EEF04258.2| hypothetical protein POPTR_0016s00660g [Populus trichocarpa]
Length=612

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLA KRGATEIKQHPFFEGVNWALIRCA+
Sbjct  509  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLASKRGATEIKQHPFFEGVNWALIRCAT  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERI  P PA +++K+   A A     + SDNYLEFDFF
Sbjct  569  PPEIPKPVEIERI--PAPASTSEKATTVAAA--PGQKGSDNYLEFDFF  612



>gb|KHG10317.1| hypothetical protein F383_15240 [Gossypium arboreum]
Length=563

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 140/176 (80%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  403  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  462

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  463  VGQPLRFPESPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  522

Query  411  ppevprpveferiPAPP--PAPSNQKSV----VAAGAIPSCPQNSD--NYLEFDFF  268
                           PP  P P   + +     +AG  PS P   D  NYLEFDFF
Sbjct  523  ---------------PPEIPKPVEIERIRIPTSSAGDKPSVPATKDQSNYLEFDFF  563



>ref|XP_010241157.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
 ref|XP_010241158.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
Length=614

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  452  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  511

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF ARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  512  VGQPLRFPESPVVSFQARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAS  571

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERI    PA +   S  AA A     ++SDNYLEFDFF
Sbjct  572  PPEIPKPVEIERI----PASTASTSEKAATATLD-QKSSDNYLEFDFF  614



>gb|KHN40778.1| Protein kinase G11A [Glycine soja]
Length=608

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  503  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPE+P+ VEFE+IP+P  +   +K   AA  I    Q  SDNYLEFDFF
Sbjct  563  PPEIPKAVEFEKIPSPASSSGGEK---AANHISIANQKGSDNYLEFDFF  608



>ref|XP_009410301.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=618

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 149/168 (89%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  457  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  516

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFP+SP+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  517  IGQPLRFPDSPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  576

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVE +R     P P    S ++A AI    + SDNYLEFDFF
Sbjct  577  PPEIPRPVEIDRS----PQPMASTSQISAPAINQ--KRSDNYLEFDFF  618



>emb|CDY36769.1| BnaA03g11170D [Brassica napus]
Length=492

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 145/168 (86%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  332  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  391

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  392  VGQPLRFPDSPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  451

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E +   PPA       V A A  S   +  NYLEFDFF
Sbjct  452  PPEIPKPVEIEPVNCTPPA-------VPAAASTSVRSDQSNYLEFDFF  492



>ref|XP_011461867.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461868.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 152/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  486  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFER+ AP  + S++    AA + P    + +NYLEFDFF
Sbjct  546  PPDIPKPVEFERLSAPVMSSSDK--ATAAASHP----DQNNYLEFDFF  587



>ref|XP_003534979.1| PREDICTED: protein kinase G11A-like isoform X1 [Glycine max]
 ref|XP_006586786.1| PREDICTED: protein kinase G11A-like isoform X2 [Glycine max]
 ref|XP_006586787.1| PREDICTED: protein kinase G11A-like isoform X3 [Glycine max]
Length=608

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  503  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPE+P+ VEFE+IP+P  +   +K   AA  I    Q  SDNYLEFDFF
Sbjct  563  PPEIPKAVEFEKIPSPASSSGGEK---AANHISIANQKGSDNYLEFDFF  608



>emb|CDY11972.1| BnaC03g13980D [Brassica napus]
Length=492

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 145/168 (86%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  332  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  391

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  392  VGQPLRFPDSPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  451

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E +   PPA       V A A  S   +  NYLEFDFF
Sbjct  452  PPEIPKPVEIEPVNCTPPA-------VPAAASTSVRSDQSNYLEFDFF  492



>ref|XP_009349143.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Pyrus 
x bretschneideri]
 ref|XP_009349144.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Pyrus 
x bretschneideri]
 ref|XP_009349145.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Pyrus 
x bretschneideri]
Length=611

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 149/168 (89%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  510  VGQPLRFPETPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFERI A  PA S      AA   P    + +NYLEFDFF
Sbjct  570  PPDIPKPVEFERISA--PAASTGDKATAAATHP----DQNNYLEFDFF  611



>gb|KHN14413.1| Protein kinase G11A [Glycine soja]
Length=608

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  503  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ VEFE+IP+P  +   +K+V       +  + SDNYLEFDFF
Sbjct  563  PPEIPKAVEFEKIPSPASSSGGEKAVNHMSI--ANQKGSDNYLEFDFF  608



>ref|XP_006401401.1| hypothetical protein EUTSA_v10013345mg [Eutrema salsugineum]
 gb|ESQ42854.1| hypothetical protein EUTSA_v10013345mg [Eutrema salsugineum]
Length=497

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 135/171 (79%), Gaps = 14/171 (8%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  338  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  397

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  398  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  457

Query  411  ppevprpveferiPAPPPA---PSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           P P    P N    V A A  S   +  NYLEFDFF
Sbjct  458  -----------PPEIPKPVDLEPVNYTPTVPAAASTSVRSDQSNYLEFDFF  497



>ref|XP_003634855.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Vitis 
vinifera]
Length=620

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 156/175 (89%), Gaps = 8/175 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  447  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCA+
Sbjct  507  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAT  566

Query  411  ppevprpveferiPAPPPAPSNQ-------KSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERIPAP  + S +        + +AA  +P   ++SDNYLEFDFF
Sbjct  567  PPEIPKPVEIERIPAPTASTSEKVPPAAKATAPIAAAVVPD-QKSSDNYLEFDFF  620



>ref|XP_007147579.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 ref|XP_007147580.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 gb|ESW19573.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
 gb|ESW19574.1| hypothetical protein PHAVU_006G136500g [Phaseolus vulgaris]
Length=612

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  447  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  507  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  566

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ VEFE+IP+P  + + +K+V       +  + SDNYLEFDFF
Sbjct  567  PPEIPKTVEFEKIPSPASSGAGEKAVNHMSI--ANQKGSDNYLEFDFF  612



>gb|KJB81597.1| hypothetical protein B456_013G151400 [Gossypium raimondii]
 gb|KJB81598.1| hypothetical protein B456_013G151400 [Gossypium raimondii]
Length=587

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 150/168 (89%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  427  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  486

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  487  VGQPLRFPESPVVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  546

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ERIPAP  +  N+ +V A        ++ +NYLEFDFF
Sbjct  547  PPEVPKPVEVERIPAPTSSAGNKPAVPAT-------KDQNNYLEFDFF  587



>ref|XP_009396293.1| PREDICTED: serine/threonine-protein kinase D6PK [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396294.1| PREDICTED: serine/threonine-protein kinase D6PK [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396295.1| PREDICTED: serine/threonine-protein kinase D6PK [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396296.1| PREDICTED: serine/threonine-protein kinase D6PK [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396297.1| PREDICTED: serine/threonine-protein kinase D6PK [Musa acuminata 
subsp. malaccensis]
Length=636

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 137/176 (78%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  476  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  535

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  536  IGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  595

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN--------SDNYLEFDFF  268
                           PP  P +       G + S  Q         SDNYLEFDFF
Sbjct  596  ---------------PPEVPKHVSIERFMGTVASTSQKSNATSGKGSDNYLEFDFF  636



>ref|XP_002866117.1| hypothetical protein ARALYDRAFT_495673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42376.1| hypothetical protein ARALYDRAFT_495673 [Arabidopsis lyrata subsp. 
lyrata]
Length=498

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 140/175 (80%), Gaps = 22/175 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TGARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  458

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAAGAIPSCPQNS-----DNYLEFDFF  268
                           PP  P P + + +    A+PS   +S      NYLEFDFF
Sbjct  459  ---------------PPEIPKPVDLEPLNPTPAMPSAASSSVRSDQSNYLEFDFF  498



>ref|XP_008797752.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
 ref|XP_008797754.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
Length=617

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 146/168 (87%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  457  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  516

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPESPVVSFSARDLIRGLLVKEPQHRLAYKRGA EIKQHPFFEG+NWALIRCAS
Sbjct  517  VGQPLQFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGAGEIKQHPFFEGMNWALIRCAS  576

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER    P  P+   S     AI  C   SDNYLEFDFF
Sbjct  577  PPEIPKPVEIER----PSGPAASTSQKVKSAIEKC---SDNYLEFDFF  617



>gb|EMT19817.1| Protein kinase G11A [Aegilops tauschii]
Length=573

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 10/168 (6%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVV F+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  476  VGQPLRFPESPVVGFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  535

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE  R    P A ++QK      A PS  +  DNYLEFDFF
Sbjct  536  PPDIPKPVEIPR----PGASTSQK------ATPSAEKGPDNYLEFDFF  573



>dbj|BAK01767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 10/168 (6%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  417  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  476

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVV F+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  477  VGQPLRFPESPVVGFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  536

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE  R    P A ++QK      A PS  +  DNYLEFDFF
Sbjct  537  PPDIPKPVEIPR----PGASTSQK------ATPSAEKGPDNYLEFDFF  574



>ref|XP_008358895.1| PREDICTED: protein kinase G11A-like [Malus domestica]
Length=611

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+PVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFE VNWALIRCAS
Sbjct  510  VGQPLKFPEAPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEDVNWALIRCAS  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFERI APP + S++    AA   P    + +NYLEFDFF
Sbjct  570  PPDIPKPVEFERISAPPVSTSDK--ATAAATYP----DQNNYLEFDFF  611



>ref|XP_008218405.1| PREDICTED: protein kinase G11A [Prunus mume]
 ref|XP_008218413.1| PREDICTED: protein kinase G11A [Prunus mume]
Length=609

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSFSA+DLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  508  VGQPLRFPETPVVSFSAKDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEF+RI AP  + S++ +V A+        + +NYLEFDFF
Sbjct  568  PPDIPKPVEFDRISAPTVSTSDKATVAASHP------DQNNYLEFDFF  609



>ref|XP_007208313.1| hypothetical protein PRUPE_ppa003043mg [Prunus persica]
 gb|EMJ09512.1| hypothetical protein PRUPE_ppa003043mg [Prunus persica]
Length=609

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  448  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  507

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSFSA+DLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  508  VGQPLRFPETPVVSFSAKDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  567

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEF+RI AP  + S++ +V A+        + +NYLEFDFF
Sbjct  568  PPDIPKPVEFDRISAPTVSTSDKATVAASHP------DQNNYLEFDFF  609



>ref|XP_009379475.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Pyrus x 
bretschneideri]
Length=611

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+PVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFE VNWALIRCAS
Sbjct  510  VGQPLKFPEAPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEDVNWALIRCAS  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFERI APP + S++    AA   P    + +NYLEFDFF
Sbjct  570  PPDIPKPVEFERISAPPVSASDK--ATAAATHP----DQNNYLEFDFF  611



>ref|NP_001289227.1| serine/threonine-protein kinase D6PK-like [Pyrus x bretschneideri]
 gb|AEK94320.1| serine/threonine protein kinase-like protein [Pyrus x bretschneideri]
Length=611

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+PVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFE VNWALIRCAS
Sbjct  510  VGQPLKFPEAPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEDVNWALIRCAS  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFERI APP + S++    AA   P    + +NYLEFDFF
Sbjct  570  PPDIPKPVEFERISAPPVSASDK--ATAAATHP----DQNNYLEFDFF  611



>ref|XP_009367228.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009367229.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X2 [Pyrus x bretschneideri]
Length=611

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  450  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  509

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+PVVSFSA+DLIRGLLVKEPQHRLAYKRGATEIKQHPFFE VNWALIRCAS
Sbjct  510  VGQPLKFPEAPVVSFSAKDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEDVNWALIRCAS  569

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVEFERI APP + S++    AA   P    + +NYLEFDFF
Sbjct  570  PPDIPKPVEFERISAPPVSASDK--ATAAATHP----DQNNYLEFDFF  611



>ref|XP_006280353.1| hypothetical protein CARUB_v10026280mg [Capsella rubella]
 gb|EOA13251.1| hypothetical protein CARUB_v10026280mg [Capsella rubella]
Length=498

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 8/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  458

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PV+ E +   P AP        A A  S   +   YLEFDFF
Sbjct  459  PPEIPKPVDLEPVNPTPTAP--------AAASSSVRSDQSTYLEFDFF  498



>ref|XP_010096481.1| Protein kinase G11A [Morus notabilis]
 gb|EXB64601.1| Protein kinase G11A [Morus notabilis]
Length=610

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 141/168 (84%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  446  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  505

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQ+RLAYKRGATE+KQHPFFEGVNWALIRCA+
Sbjct  506  VGQPLRFPESPVVSFAARDLIRGLLVKEPQNRLAYKRGATEVKQHPFFEGVNWALIRCAT  565

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P             PP A S++K+    GA     + S+NYLEFDFF
Sbjct  566  -PPEIPKPIEIERIPPPTASSSEKAPTIIGAPDQ--KGSNNYLEFDFF  610



>ref|XP_006280219.1| hypothetical protein CARUB_v10026139mg [Capsella rubella]
 gb|EOA13117.1| hypothetical protein CARUB_v10026139mg [Capsella rubella]
Length=586

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  420  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  479

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  480  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  539

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P         +   +   APSNQK+  AAG + +  + SDNYLEFDFF
Sbjct  540  PPEIPRPVELEKEPVSVAEAPSNQKT--AAGLVLNAQKGSDNYLEFDFF  586



>ref|XP_007020448.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 ref|XP_007020449.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 ref|XP_007020450.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11973.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11974.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY11975.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
Length=604

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKGSGNRATLFNV
Sbjct  444  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGSGNRATLFNV  503

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQH FFEGVNWALIRCAS
Sbjct  504  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHLFFEGVNWALIRCAS  563

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ERIPAP  +  ++ +V AA        + +NYLEFDFF
Sbjct  564  PPEIPKPVEIERIPAPTSSAGDKAAVPAAN-------DQNNYLEFDFF  604



>ref|NP_001062700.1| Os09g0258500 [Oryza sativa Japonica Group]
 dbj|BAD23437.1| putative protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAD23751.1| putative protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAF24614.1| Os09g0258500 [Oryza sativa Japonica Group]
Length=567

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 138/173 (80%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQ LRFPESPVVSF+A+DLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  470  VGQSLRFPESPVVSFAAKDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  529

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAA---GAIPSCPQNSDNYLEFDFF  268
                           PP  P P      VA+    A  +  + SDNYLEFDFF
Sbjct  530  ---------------PPDIPKPVEIPRSVASTSQKATTTAEKGSDNYLEFDFF  567



>gb|EAZ08333.1| hypothetical protein OsI_30587 [Oryza sativa Indica Group]
Length=567

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 138/173 (80%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQ LRFPESPVVSF+A+DLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  470  VGQSLRFPESPVVSFAAKDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  529

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAA---GAIPSCPQNSDNYLEFDFF  268
                           PP  P P      VA+    A  +  + SDNYLEFDFF
Sbjct  530  ---------------PPDIPKPVEIPRSVASTSQKATTTAEKGSDNYLEFDFF  567



>ref|XP_010092339.1| Protein kinase G11A [Morus notabilis]
 gb|EXB51015.1| Protein kinase G11A [Morus notabilis]
Length=597

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  434  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  493

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSFSARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEG+NWALIRCAS
Sbjct  494  VGQPLRFPEAPVVSFSARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGINWALIRCAS  553

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE+ERI    P  S  +   AAG++    QN  N+LEFDFF
Sbjct  554  PPEVPKPVEYERIST--PMVSMSEKATAAGSVAHSDQN--NFLEFDFF  597



>ref|XP_010929042.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Elaeis 
guineensis]
Length=619

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 148/168 (88%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKGSGNRATLFNV
Sbjct  459  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGSGNRATLFNV  518

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQ LRFPESPVVSFSARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  519  VGQSLRFPESPVVSFSARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAS  578

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+P+E ER+  P P  S  + V  A A     + SDNYLEFDFF
Sbjct  579  PPEIPKPIEIERL--PGPVASTSQKVTPATA-----KCSDNYLEFDFF  619



>gb|EMS45639.1| Protein kinase G11A [Triticum urartu]
Length=661

 Score =   263 bits (671),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 10/168 (6%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  504  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  563

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVV F+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  564  VGQPLRFPESPVVGFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  623

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE  R    P A ++QK      A PS  +  DNYLEFDFF
Sbjct  624  PPDIPKPVEIPR----PGASTSQK------ATPSAEKGPDNYLEFDFF  661



>ref|XP_009396070.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396080.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
Length=611

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 136/176 (77%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  451  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  510

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE PVVSF ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  511  VGQPLRFPEFPVVSFGARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  570

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQ--------NSDNYLEFDFF  268
                           PP  P   +     G + S  Q        +SDNYLEFDFF
Sbjct  571  ---------------PPEIPKPYEIFQPPGVVSSAIQKDTTASEKSSDNYLEFDFF  611



>gb|KHG21447.1| Protein kinase G11A [Gossypium arboreum]
Length=584

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 140/176 (80%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKG+GHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  424  TNARSMSFVGTHEYLAPEIIKGQGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  483

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  484  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  543

Query  411  ppevprpveferiPAPP--PAPSNQKSV----VAAGAIPSCPQNSD--NYLEFDFF  268
                           PP  P P   + +     +AG  P+ P   D  NYLEFDFF
Sbjct  544  ---------------PPEIPKPVEIERIPVPTSSAGDKPAVPVTKDQKNYLEFDFF  584



>ref|XP_010481275.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Camelina sativa]
Length=576

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  470  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  529

Query  411  ppevprpveferiPAP-PPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E+ PA    APS+QK+  AAG + +  + SDNYLEFDFF
Sbjct  530  PPEIPKPVELEKEPASVAEAPSSQKT--AAGLVLNAQKGSDNYLEFDFF  576



>gb|KJB13926.1| hypothetical protein B456_002G102000 [Gossypium raimondii]
 gb|KJB13927.1| hypothetical protein B456_002G102000 [Gossypium raimondii]
 gb|KJB13928.1| hypothetical protein B456_002G102000 [Gossypium raimondii]
Length=583

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 140/176 (80%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KG+GHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  423  TNARSMSFVGTHEYLAPEIVKGQGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  482

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  483  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  542

Query  411  ppevprpveferiPAPP--PAPSNQKSV----VAAGAIPSCPQNSD--NYLEFDFF  268
                           PP  P P   + +     +AG  P+ P   D  NYLEFDFF
Sbjct  543  ---------------PPEIPKPVEIERIPVPTSSAGDKPAVPVTKDQKNYLEFDFF  583



>ref|XP_004953750.1| PREDICTED: protein kinase G11A-like [Setaria italica]
Length=562

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 146/169 (86%), Gaps = 6/169 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  399  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  458

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  459  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  518

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPEVP+PVE ER    PP+PS      AA      PQ  SD YLEFDFF
Sbjct  519  PPEVPKPVEIERPSKLPPSPSG-----AADGSSGAPQKGSDGYLEFDFF  562



>ref|XP_002445963.1| hypothetical protein SORBIDRAFT_07g028750 [Sorghum bicolor]
 gb|EES15458.1| hypothetical protein SORBIDRAFT_07g028750 [Sorghum bicolor]
Length=603

 Score =   260 bits (665),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 138/168 (82%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVK+PQHRL YKRG TEIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPIVSFSARDLIRGLLVKDPQHRLGYKRGTTEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PAP+N K   AA       +  DN+LEF+FF
Sbjct  563  --PPDVPKPVELDRPPKPAPANDKVAPAANQ-----KGPDNFLEFEFF  603



>ref|XP_006413161.1| hypothetical protein EUTSA_v10024951mg [Eutrema salsugineum]
 gb|ESQ54614.1| hypothetical protein EUTSA_v10024951mg [Eutrema salsugineum]
Length=512

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 137/174 (79%), Gaps = 21/174 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  354  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  413

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  414  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  473

Query  411  ppevprpveferiPAPPPAP------SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      S+  +  AA +       S+NYL+FDFF
Sbjct  474  ---------------PPEIPKPVDLESSPATPAAATSTSVKSDQSNNYLDFDFF  512



>ref|NP_001047980.1| Os02g0725000 [Oryza sativa Japonica Group]
 dbj|BAD12918.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAD13043.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAF09894.1| Os02g0725000 [Oryza sativa Japonica Group]
 gb|EAZ24457.1| hypothetical protein OsJ_08206 [Oryza sativa Japonica Group]
 dbj|BAG89724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=588

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 150/169 (89%), Gaps = 6/169 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  425  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  484

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE P+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  485  IGQPLRFPEYPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  544

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPEVP+PVE ER P  PP+ S     V++GA    PQ  SD YLEFDFF
Sbjct  545  PPEVPKPVEIERPPKLPPSTSGTTD-VSSGA----PQKGSDGYLEFDFF  588



>gb|EAY87356.1| hypothetical protein OsI_08759 [Oryza sativa Indica Group]
Length=588

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 150/169 (89%), Gaps = 6/169 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  425  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  484

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE P+VSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  485  IGQPLRFPEYPIVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  544

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPEVP+PVE ER P  PP+ S     V++GA    PQ  SD YLEFDFF
Sbjct  545  PPEVPKPVEIERPPKLPPSTSGTTD-VSSGA----PQKGSDGYLEFDFF  588



>ref|XP_009132349.1| PREDICTED: protein kinase G11A-like [Brassica rapa]
 ref|XP_009132350.1| PREDICTED: protein kinase G11A-like [Brassica rapa]
Length=492

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  332  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  391

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SPVVSF+ARDLI  LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  392  VGQPLRFPDSPVVSFAARDLIGRLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  451

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E +   PPA       V A A  S   +  NYLEFDFF
Sbjct  452  PPEIPKPVEIEPVNCTPPA-------VPAAASTSVRSDQSNYLEFDFF  492



>ref|NP_001063472.1| Os09g0478500 [Oryza sativa Japonica Group]
 dbj|BAD46322.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAD46396.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAF25386.1| Os09g0478500 [Oryza sativa Japonica Group]
 dbj|BAG94646.1| unnamed protein product [Oryza sativa Japonica Group]
Length=583

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  422  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  481

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  482  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  541

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P   PS    V  A    S  + SDNYLEF+FF
Sbjct  542  PPDIPKPVELDCR--PKQVPSTNGKVAPA----SNQKGSDNYLEFEFF  583



>ref|XP_004134809.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
 ref|XP_004167101.1| PREDICTED: protein kinase G11A-like [Cucumis sativus]
 gb|KGN49028.1| hypothetical protein Csa_6G510950 [Cucumis sativus]
Length=612

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFN+
Sbjct  447  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNI  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP++PVVSF+A+DLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  507  VGQPLRFPDAPVVSFAAKDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAT  566

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVE ERI  P    S  +  VA  AI    + SDNYLEFDFF
Sbjct  567  PPEIPRPVEIERI--PHAVASTSEKAVAIAAIAPDKKASDNYLEFDFF  612



>gb|EAZ45122.1| hypothetical protein OsJ_29759 [Oryza sativa Japonica Group]
Length=574

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  413  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  472

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  473  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  532

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P   PS    V  A    S  + SDNYLEF+FF
Sbjct  533  PPDIPKPVELDCR--PKQVPSTNGKVAPA----SNQKGSDNYLEFEFF  574



>emb|CDX94306.1| BnaC01g18780D [Brassica napus]
Length=513

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 10/168 (6%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  356  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  415

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  416  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  475

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ VEFE  PA  PAP+   SV        C Q+S  YL+FDFF
Sbjct  476  PPEIPKQVEFENAPA-TPAPATSTSV-------KCDQSS--YLDFDFF  513



>gb|EAZ09496.1| hypothetical protein OsI_31769 [Oryza sativa Indica Group]
Length=574

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  413  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  472

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  473  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  532

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P   PS    V  A    S  + SDNYLEF+FF
Sbjct  533  PPDIPKPVELDCH--PKQVPSTNGKVAPA----SNQKGSDNYLEFEFF  574



>ref|XP_009399531.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399532.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399533.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399534.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF+YELLFGKTPFKGSGNRATLFNV
Sbjct  443  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFMYELLFGKTPFKGSGNRATLFNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+AR+LIRGLLVKEPQHR AYKRGA+EIKQHPFFEGVNWALIRCAS
Sbjct  503  VGQPLRFPESPTVSFAARELIRGLLVKEPQHRFAYKRGASEIKQHPFFEGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ ++ ER+  P  +   +   VAA A   C   SDNYLEFDFF
Sbjct  563  PPEIPKSIDIERLSKPTVSTGEK---VAATANQKC---SDNYLEFDFF  604



>gb|AAL32579.1| protein kinase 5 [Arabidopsis thaliana]
 gb|AAM13302.1| protein kinase 5 [Arabidopsis thaliana]
Length=586

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  420  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  479

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  480  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  539

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P         +   +   APS+QK+  AAG + +  + SDNYLEFDFF
Sbjct  540  PPEIPKPVELEKGAVSVAEAPSSQKT--AAGLVLNAQKGSDNYLEFDFF  586



>ref|XP_008791995.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
 ref|XP_008791996.1| PREDICTED: protein kinase G11A-like [Phoenix dactylifera]
Length=618

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 147/169 (87%), Gaps = 8/169 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  457  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  516

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFS RDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  517  VGQPLRFPESPIVSFSVRDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  576

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPE+P+PVE ER P PP + S +        +P+  Q  SD YLEFD F
Sbjct  577  PPEIPKPVELERPPRPPASTSEK-------VVPTTNQKGSDIYLEFDIF  618



>ref|NP_199586.1| D6 protein kinase like 2 [Arabidopsis thaliana]
 sp|Q39183.1|D6KL2_ARATH RecName: Full=Serine/threonine-protein kinase D6PKL2; AltName: 
Full=D6 protein kinase-like 2; AltName: Full=Serine/threonine-protein 
kinase AtPK5 [Arabidopsis thaliana]
 dbj|BAA01715.1| serine/threonine protein kinase [Arabidopsis thaliana]
 dbj|BAB11322.1| protein kinase (EC 2.7.1.37) 5 [Arabidopsis thaliana]
 gb|AAL06887.1| AT5g47750/MCA23_7 [Arabidopsis thaliana]
 gb|AAM47480.1| AT5g47750/MCA23_7 [Arabidopsis thaliana]
 gb|AED95568.1| D6 protein kinase like 2 [Arabidopsis thaliana]
Length=586

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  420  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  479

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  480  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  539

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P         +   +   APS+QK+  AAG + +  + SDNYLEFDFF
Sbjct  540  PPEIPKPVELEKGAVSVAEAPSSQKT--AAGLVLNAQKGSDNYLEFDFF  586



>ref|XP_006660743.1| PREDICTED: protein kinase G11A-like isoform X1 [Oryza brachyantha]
 ref|XP_006660744.1| PREDICTED: protein kinase G11A-like isoform X2 [Oryza brachyantha]
Length=585

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  424  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  483

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  484  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  543

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P   PS    V  A    S  + SDNYLEF+FF
Sbjct  544  PPDIPKPVELDCR--PKQVPSANGKVAPA----SNQKGSDNYLEFEFF  585



>ref|XP_002266700.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644600.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644601.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
 ref|XP_010644602.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Vitis vinifera]
Length=611

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 152/168 (90%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  447  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  506

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  507  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  566

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER+PAP  + S + +   AG      ++ DNYLEFDFF
Sbjct  567  PPEIPKPVEIERVPAPAASSSEKAAAAMAGPD---QKSCDNYLEFDFF  611



>ref|XP_009126979.1| PREDICTED: protein kinase G11A-like [Brassica rapa]
Length=494

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 134/169 (79%), Gaps = 11/169 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  336  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  395

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQH FFEGVNWAL+RCAS
Sbjct  396  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHAFFEGVNWALVRCAS  455

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P             APPP          A A  S   +  NYLEFDFF
Sbjct  456  PPEIPKPVEIEPVNYAPPP----------AAASTSVRSDQSNYLEFDFF  494



>emb|CDY20744.1| BnaA02g08840D [Brassica napus]
Length=482

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 134/169 (79%), Gaps = 11/169 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  324  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  383

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQH FFEGVNWAL+RCAS
Sbjct  384  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHAFFEGVNWALVRCAS  443

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P             APPP          A A  S   +  NYLEFDFF
Sbjct  444  PPEIPKPVEIEPVNYAPPP----------AAASTSVRSDQSNYLEFDFF  482



>ref|XP_009101388.1| PREDICTED: protein kinase G11A [Brassica rapa]
 emb|CDY17708.1| BnaA06g35270D [Brassica napus]
Length=554

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  387  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  446

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  447  VGQPLRFPESPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  506

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE ER P    A S      AAG + +  + SDNYLEFDFF
Sbjct  507  PPEIPKPVELERGPVSSVAESPTSQKTAAGLVLNAQKGSDNYLEFDFF  554



>ref|XP_006398476.1| hypothetical protein EUTSA_v10000825mg [Eutrema salsugineum]
 ref|XP_006398477.1| hypothetical protein EUTSA_v10000825mg [Eutrema salsugineum]
 gb|ESQ39929.1| hypothetical protein EUTSA_v10000825mg [Eutrema salsugineum]
 gb|ESQ39930.1| hypothetical protein EUTSA_v10000825mg [Eutrema salsugineum]
Length=587

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  421  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  480

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  481  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  540

Query  411  ppevprpveferiPAP-PPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE E+ P     APS+QK+  AAG I +  + SDNYLEFDFF
Sbjct  541  PPEIPKPVELEKGPVNVAEAPSSQKT--AAGLILNAQKGSDNYLEFDFF  587



>ref|XP_004957124.1| PREDICTED: protein kinase G11A-like isoform X1 [Setaria italica]
 ref|XP_004957125.1| PREDICTED: protein kinase G11A-like isoform X2 [Setaria italica]
 ref|XP_004957126.1| PREDICTED: protein kinase G11A-like isoform X3 [Setaria italica]
 ref|XP_004957127.1| PREDICTED: protein kinase G11A-like isoform X4 [Setaria italica]
Length=571

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 136/177 (77%), Gaps = 24/177 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  470  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  529

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSC---------PQNSDNYLEFDFF  268
                           PP  P   +       +PS          P+  DNYLEF+FF
Sbjct  530  ---------------PPDIPKPVELDCRPKQVPSTNGKVAPVANPKGPDNYLEFEFF  571



>emb|CDY28629.1| BnaC09g32460D [Brassica napus]
Length=500

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCA+
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAT  458

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PV+ E      P   +  +  A+ A  S   +  NYLEFDFF
Sbjct  459  PPEVPKPVDLE------PVKQHTPATPASAASTSVRSDQSNYLEFDFF  500



>gb|ACF78457.1| unknown [Zea mays]
Length=371

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 137/177 (77%), Gaps = 24/177 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  210  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  269

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  270  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  329

Query  411  ppevprpveferiPAPPPAP------SNQKSVVAA-GAIPSCPQNS--DNYLEFDFF  268
                           PP  P         K V +A G +   P     DNYLEF+FF
Sbjct  330  ---------------PPDIPKPVELECRPKQVPSANGKVAPAPNQKGPDNYLEFEFF  371



>dbj|BAK06792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  476  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  535

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PV+ ER     P  +++ S    GA     + SDNYLEFDFF
Sbjct  536  PPEVPKPVDIERQTTKLPVSTSEASAAPTGA---SQKGSDNYLEFDFF  580



>ref|XP_011086278.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Sesamum 
indicum]
 ref|XP_011086279.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Sesamum 
indicum]
 ref|XP_011086280.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Sesamum 
indicum]
 ref|XP_011086281.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Sesamum 
indicum]
Length=607

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGS VDWWTFG+FLYELLFGKTPFKGSGNRATLFNV
Sbjct  445  TNARSMSFVGTHEYLAPEIIKGEGHGSPVDWWTFGVFLYELLFGKTPFKGSGNRATLFNV  504

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  505  VGQPLRFPETPVVSFAARDLIRGLLVKEPQRRLAYKRGATEIKQHPFFEGVNWALIRCAT  564

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PV+FER+P P   P+N+KS           Q SD YLEFDFF
Sbjct  565  PPEIPKPVDFERLPLP---PANEKSANIVSVTDH--QKSDKYLEFDFF  607



>ref|XP_002863323.1| hypothetical protein ARALYDRAFT_494187 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39582.1| hypothetical protein ARALYDRAFT_494187 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  421  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  480

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  481  VGQPLRFPETPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  540

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P         +   +   APS+QK+  +AG + +  + SDNYLEFDFF
Sbjct  541  PPEIPKPVELEKGPVSVAEAPSSQKT--SAGLVLNAQKGSDNYLEFDFF  587



>ref|XP_006660470.1| PREDICTED: protein kinase G11A-like [Oryza brachyantha]
Length=566

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 138/179 (77%), Gaps = 32/179 (18%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  409  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  468

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQ LRFPESP VSF+A+DLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  469  VGQSLRFPESPFVSFAAKDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  528

Query  411  ppevprpveferiPAPPPAP-----------SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P           ++QK+  AA       + SDNYLEFDFF
Sbjct  529  ---------------PPDIPKPVEIPRSVASTSQKAPTAAD------KGSDNYLEFDFF  566



>ref|XP_003578294.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Brachypodium 
distachyon]
 ref|XP_010238267.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Brachypodium 
distachyon]
 ref|XP_010238268.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Brachypodium 
distachyon]
Length=587

 Score =   257 bits (657),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  TDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL +KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  VGQPLRFPESPLVSFSARDMIRGLLVKDPQHRLGHKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P   PS    VV A       + SDNYLEF+FF
Sbjct  546  PPDIPKPVELDCR--PKQVPSTNGKVVPAAN----QKGSDNYLEFEFF  587



>emb|CDX77795.1| BnaC07g20490D [Brassica napus]
Length=571

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  405  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNV  464

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQ RL +KRGATE+KQHPFFEGVNWALIRCA+
Sbjct  465  VGQPLRFPESPVVSFAARDLIRGLLMKEPQQRLGFKRGATEVKQHPFFEGVNWALIRCAT  524

Query  411  -ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
             P             +   +P++QK+  AAG + +  + SDNYLEFDFF
Sbjct  525  PPEIPKPVELERGPVSVAESPTSQKT--AAGLVLNAQKGSDNYLEFDFF  571



>ref|XP_006647820.1| PREDICTED: protein kinase G11A-like [Oryza brachyantha]
Length=586

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  423  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  482

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE PVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  483  IGQSLRFPEYPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  542

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER P  PP+ S    V  +  +P   + SD YLEFDFF
Sbjct  543  PPEVPKPVEIERPPKVPPSTSGTTDV--SSGVPQ--KGSDGYLEFDFF  586



>gb|EMS53056.1| Protein kinase G11A [Triticum urartu]
Length=587

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  423  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  482

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  483  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  542

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER     P  +++ S    GA     + SDNYLEFDFF
Sbjct  543  PPEVPKPVEIERQTTKLPVSTSEASAAPTGA---SQKGSDNYLEFDFF  587



>gb|EMS45607.1| Protein kinase G11A [Triticum urartu]
Length=558

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  397  TDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  456

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL +KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  457  VGQPLRFPESPLVSFSARDMIRGLLVKDPQHRLGHKRGATEIKQHPFFEGVNWALIRCAS  516

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P  APS    V  A    S  + SDNYLEF+FF
Sbjct  517  PPDIPKPVELDCR--PKQAPSANGKVAPA----SNQKGSDNYLEFEFF  558



>ref|XP_010539330.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Tarenaya 
hassleriana]
 ref|XP_010539331.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Tarenaya 
hassleriana]
Length=513

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 138/173 (80%), Gaps = 21/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  357  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  416

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEP HRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  417  VGQPLRFPESPVVSFAARDLIRSLLVKEPHHRLAYKRGATEIKQHPFFEGVNWALVRCAS  476

Query  411  ppevprpveferiPAPP--PAPSNQKSVVA---AGAIPSCPQNSDNYLEFDFF  268
                           PP  P P   +SV A   + +  S P N  NYLEFDFF
Sbjct  477  ---------------PPEIPKPVELESVPALTTSTSGRSDPSNK-NYLEFDFF  513



>ref|XP_010536747.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010536748.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010536749.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010536750.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like isoform 
X1 [Tarenaya hassleriana]
Length=513

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 145/168 (86%), Gaps = 11/168 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  357  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  416

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  417  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  476

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+PVE + +PAP  +    +S             ++NYLEFDFF
Sbjct  477  PPEIPKPVELDNVPAPATSMGGGRS-----------DQNNNYLEFDFF  513



>ref|XP_008783022.1| PREDICTED: protein kinase G11A [Phoenix dactylifera]
Length=617

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 9/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKG+GHGSAVDWWTFGIFLYELLFGKTPFKG GNRATLFNV
Sbjct  459  TDARSMSFVGTHEYLAPEIIKGDGHGSAVDWWTFGIFLYELLFGKTPFKGLGNRATLFNV  518

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VSFSARDL+RGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRC S
Sbjct  519  VGQPLRFPETPFVSFSARDLVRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCTS  578

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+P+E ER   P P  S  + V AA       + SDNYLEFDFF
Sbjct  579  PPEIPKPIEIERH--PGPVASTSQKVTAA-------KGSDNYLEFDFF  617



>gb|EMT22325.1| Protein kinase G11A [Aegilops tauschii]
Length=615

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  451  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  510

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  511  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  570

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER     P  +++ S    GA     + SDNYLEFDFF
Sbjct  571  PPEVPKPVEIERQTTKLPVSTSEASAAPTGA---SQKGSDNYLEFDFF  615



>ref|XP_004979067.1| PREDICTED: protein kinase G11A-like [Setaria italica]
Length=571

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 135/177 (76%), Gaps = 24/177 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTF IFLYELLFGKTPFKGSGNRATLFNV
Sbjct  410  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFAIFLYELLFGKTPFKGSGNRATLFNV  469

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  470  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  529

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSC---------PQNSDNYLEFDFF  268
                           PP  P   +       +PS          P+  DNYLEF+FF
Sbjct  530  ---------------PPDIPKPVELDCRPKQVPSTNGKVAPVANPKGPDNYLEFEFF  571



>ref|XP_006659528.1| PREDICTED: protein kinase G11A-like isoform X1 [Oryza brachyantha]
 ref|XP_006659529.1| PREDICTED: protein kinase G11A-like isoform X2 [Oryza brachyantha]
Length=594

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 137/176 (78%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  434  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  493

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVK+PQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  494  VGQPLRFPESPLVSFSARDLIRGLLVKDPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  553

Query  411  ppevprpveferiPAPPPAPS-------NQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
                           PP  P         + +       P+  Q  SDNYLEF+FF
Sbjct  554  ---------------PPEIPKPVELERPPRPAPAPEKVAPAANQKGSDNYLEFEFF  594



>ref|NP_001183172.1| uncharacterized LOC100501547 [Zea mays]
 ref|XP_008651800.1| PREDICTED: uncharacterized LOC100501547 isoform X1 [Zea mays]
 ref|XP_008651801.1| PREDICTED: uncharacterized LOC100501547 isoform X1 [Zea mays]
 gb|ACR35949.1| unknown [Zea mays]
 tpg|DAA61952.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=577

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  476  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  535

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+P+E E  P   P+ + + + VA    P      DNYLEF+FF
Sbjct  536  PPDIPKPLELECRPKQVPSANGKVAPVANQKGP------DNYLEFEFF  577



>ref|XP_004973774.1| PREDICTED: protein kinase G11A-like isoform X1 [Setaria italica]
 ref|XP_004973775.1| PREDICTED: protein kinase G11A-like isoform X2 [Setaria italica]
 ref|XP_004973776.1| PREDICTED: protein kinase G11A-like isoform X3 [Setaria italica]
 ref|XP_004973777.1| PREDICTED: protein kinase G11A-like isoform X4 [Setaria italica]
 ref|XP_004973778.1| PREDICTED: protein kinase G11A-like isoform X5 [Setaria italica]
 ref|XP_004973779.1| PREDICTED: protein kinase G11A-like isoform X6 [Setaria italica]
Length=598

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 139/168 (83%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  437  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  496

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARDLIRGLLVK+PQHRL YKRG TEIKQHPFFEGVNWALIRCAS
Sbjct  497  VGQPLRFPESPIVSFSARDLIRGLLVKDPQHRLGYKRGTTEIKQHPFFEGVNWALIRCAS  556

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P P P+N K+  +A       + +DN+LEF+FF
Sbjct  557  --PPDVPKPVELDRPPKPVPANDKAAASAAN----QKGTDNFLEFEFF  598



>gb|EMT31913.1| Protein kinase G11A [Aegilops tauschii]
Length=558

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  397  TDARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  456

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL +KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  457  VGQPLRFPESPLVSFSARDMIRGLLVKDPQHRLGHKRGATEIKQHPFFEGVNWALIRCAS  516

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P  AP+    V  A    S  + SDNYLEF+FF
Sbjct  517  PPDIPKPVELDCR--PKQAPAANGKVAPA----SNQKGSDNYLEFEFF  558



>ref|XP_004956362.1| PREDICTED: protein kinase G11A-like [Setaria italica]
Length=573

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 137/179 (77%), Gaps = 33/179 (18%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  417  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  476

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  477  VGQPLRFPESPVVSFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  536

Query  411  ppevprpveferiPAPPPAP-----------SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P           S+QK+  AA       +   +YLE +FF
Sbjct  537  ---------------PPDIPKPVEIPRSVASSSQKATSAA-------EKGSDYLELEFF  573



>dbj|BAK01764.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMS VGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSLVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL +KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  476  VGQPLRFPESPLVSFSARDMIRGLLVKDPQHRLGHKRGATEIKQHPFFEGVNWALIRCAS  535

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE +    P  APS    V  A    S  + SDNYLEF+FF
Sbjct  536  PPDIPKPVELDCR--PKQAPSANGKVAPA----SNQKGSDNYLEFEFF  577



>ref|NP_001141985.1| uncharacterized LOC100274135 [Zea mays]
 ref|XP_008667585.1| PREDICTED: uncharacterized LOC100274135 isoform X1 [Zea mays]
 ref|XP_008667586.1| PREDICTED: uncharacterized LOC100274135 isoform X1 [Zea mays]
 ref|XP_008667587.1| PREDICTED: uncharacterized LOC100274135 isoform X1 [Zea mays]
 ref|XP_008667588.1| PREDICTED: uncharacterized LOC100274135 isoform X1 [Zea mays]
 ref|XP_008667589.1| PREDICTED: uncharacterized LOC100274135 isoform X1 [Zea mays]
 gb|ACF87423.1| unknown [Zea mays]
 tpg|DAA40338.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=577

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 137/177 (77%), Gaps = 24/177 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSFSARD+IRGLLVK+PQHRL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  476  VGQPLRFPESPIVSFSARDMIRGLLVKDPQHRLGYKRGATEIKQHPFFEGVNWALIRCAS  535

Query  411  ppevprpveferiPAPPPAPS------NQKSVVAA-GAIPSCPQNS--DNYLEFDFF  268
                           PP  P         K V +A G +   P     DNYLEF+FF
Sbjct  536  ---------------PPDIPKPVELECRPKQVPSANGKVAPAPNQKGPDNYLEFEFF  577



>emb|CDP04543.1| unnamed protein product [Coffea canephora]
Length=613

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 138/168 (82%), Gaps = 3/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  449  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  508

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SP+VSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  509  VGQPLRFPDSPIVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  568

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P PA S  +    A A     +  DNYLEFDFF
Sbjct  569  --PPEIPKPVEFERIPVPAASTSEKAAKAAAAAD-KKGFDNYLEFDFF  613



>gb|ACG25344.1| protein kinase G11A [Zea mays]
Length=572

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 137/179 (77%), Gaps = 33/179 (18%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  476  VGQPLRFPESPVVSFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  535

Query  411  ppevprpveferiPAPPPAP-----------SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P           S+QK+  AA       +   +YLE +FF
Sbjct  536  ---------------PPDIPKPVEIPRSVASSSQKATSAA-------EKGSDYLELEFF  572



>ref|XP_009415445.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   256 bits (653),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 134/176 (76%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  461  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  520

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRF E PVVSF+ARDLIRGLLVK+PQHRLAYKRGATEIKQHPFFEG+NWALIRCAS
Sbjct  521  VGQPLRFSEFPVVSFAARDLIRGLLVKDPQHRLAYKRGATEIKQHPFFEGINWALIRCAS  580

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN--------SDNYLEFDFF  268
                           PP  P   +     G   S  Q         SDNYLEFDFF
Sbjct  581  ---------------PPEIPKPFEIARPLGTAASASQKASLTSEKGSDNYLEFDFF  621



>ref|XP_010538432.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Tarenaya 
hassleriana]
Length=567

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 143/169 (85%), Gaps = 8/169 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT+GIFLYELLFG+TPFKGSGNR TLFNV
Sbjct  406  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFLYELLFGRTPFKGSGNRQTLFNV  465

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLA KRGATEIKQHPFFEGVNWALIRCA+
Sbjct  466  VGQPLRFPEAPVVSFAARDLIRGLLVKEPQHRLAVKRGATEIKQHPFFEGVNWALIRCAT  525

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNS-DNYLEFDFF  268
            PPE+P     E   +  PA + +KSV++       PQ   D YLEFDFF
Sbjct  526  PPEIPAAKALEVEES-LPAATGEKSVLSQ------PQKGLDKYLEFDFF  567



>ref|XP_006474844.1| PREDICTED: protein kinase G11A-like isoform X1 [Citrus sinensis]
 ref|XP_006474845.1| PREDICTED: protein kinase G11A-like isoform X2 [Citrus sinensis]
 ref|XP_006474846.1| PREDICTED: protein kinase G11A-like isoform X3 [Citrus sinensis]
 ref|XP_006474847.1| PREDICTED: protein kinase G11A-like isoform X4 [Citrus sinensis]
Length=604

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS NRATL+NV
Sbjct  444  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSENRATLYNV  503

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLI+GLLVKEPQ+RLA +RGATEIKQHPFF+GVNWALIRCAS
Sbjct  504  VGQPLRFPESPVVSFSARDLIKGLLVKEPQNRLACRRGATEIKQHPFFQGVNWALIRCAS  563

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E + +P PA S +   VAAG       + +NYLEFDFF
Sbjct  564  --PPEIPKPVEIVHSPAPALSTKAKAVAAGNA-----DHNNYLEFDFF  604



>ref|XP_008669972.1| PREDICTED: protein kinase G11A [Zea mays]
 gb|ACF86375.1| unknown [Zea mays]
 tpg|DAA39388.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=572

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 137/179 (77%), Gaps = 33/179 (18%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  416  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  475

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  476  VGQPLRFPESPVVSFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  535

Query  411  ppevprpveferiPAPPPAP-----------SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P           S+QK+  AA       +   +YLE +FF
Sbjct  536  ---------------PPDIPKPVEIPRSVASSSQKATSAA-------EKGSDYLELEFF  572



>ref|XP_006452628.1| hypothetical protein CICLE_v10007792mg [Citrus clementina]
 ref|XP_006452629.1| hypothetical protein CICLE_v10007792mg [Citrus clementina]
 gb|ESR65868.1| hypothetical protein CICLE_v10007792mg [Citrus clementina]
 gb|ESR65869.1| hypothetical protein CICLE_v10007792mg [Citrus clementina]
Length=603

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS NRATL+NV
Sbjct  443  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSENRATLYNV  502

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLI+GLLVKEPQ+RLA +RGATEIKQHPFF+GVNWALIRCAS
Sbjct  503  VGQPLRFPESPVVSFSARDLIKGLLVKEPQNRLACRRGATEIKQHPFFQGVNWALIRCAS  562

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E + +P PA S +   VAAG       + +NYLEFDFF
Sbjct  563  --PPEIPKPVEIVHSPAPALSTKAKAVAAGNA-----DHNNYLEFDFF  603



>gb|KDO59169.1| hypothetical protein CISIN_1g007433mg [Citrus sinensis]
Length=604

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS NRATL+NV
Sbjct  444  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSENRATLYNV  503

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSFSARDLI+GLLVKEPQ+RLA +RGATEIKQHPFF+GVNWALIRCAS
Sbjct  504  VGQPLRFPESPVVSFSARDLIKGLLVKEPQNRLACRRGATEIKQHPFFQGVNWALIRCAS  563

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E + +P PA S +   VAAG       + +NYLEFDFF
Sbjct  564  --PPEIPKPVEIVHSPAPALSTKAKAVAAGNA-----DHNNYLEFDFF  604



>ref|XP_009383196.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383197.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383198.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIF+YELLFGKTPFKGSGNRATLFNV
Sbjct  429  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFMYELLFGKTPFKGSGNRATLFNV  488

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL FPESP VSF+ARDLIRGLLVKEPQ RLAYKRGA+EIKQHPFFEGVNWALIRCAS
Sbjct  489  VGQPLHFPESPTVSFAARDLIRGLLVKEPQQRLAYKRGASEIKQHPFFEGVNWALIRCAS  548

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+P+ V+ ER+  P PA    + V A        + S+NYLEFDFF
Sbjct  549  PPEIPKSVDIERL--PKPAALTNEKVAATKD----QKGSNNYLEFDFF  590



>gb|KJB68520.1| hypothetical protein B456_010G248100 [Gossypium raimondii]
Length=582

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  409  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  468

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  469  VGQPLRFPESPIVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  528

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAG  322
            PPE+P+PVE ER+PA P + S + +V AA 
Sbjct  529  PPEIPKPVELERVPASPASTSEKVAVNAAA  558



>ref|XP_009401494.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401495.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401496.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T A SMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  470  TDAHSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  529

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SPVVSF+ARDLIRGLLVKEP HRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  530  VGQPLRFPDSPVVSFAARDLIRGLLVKEPHHRLAYKRGATEIKQHPFFEGVNWALIRCAS  589

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PR VE ER   P  + S + + V     P      DNYLEFDFF
Sbjct  590  PPEIPRHVEIERPIRPVASTSEKATPVINQKGP------DNYLEFDFF  631



>gb|EYU27648.1| hypothetical protein MIMGU_mgv1a003809mg [Erythranthe guttata]
Length=563

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  393  SNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  452

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  453  VGQPLRFPESPVVSFAARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  512

Query  411  ----ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                P  V          APPP P+N K+ VA        Q SD YLEFDFF
Sbjct  513  PPEIPKAVDYERIPPPATAPPPPPANDKAAVAVAVGVK-DQKSDKYLEFDFF  563



>gb|AAA33509.1| protein kinase, partial [Zea mays]
Length=416

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 11/168 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T A+SMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  260  TDAKSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  319

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIRGLL+KEPQHRLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  320  VGQPLRFPESPVVSFAARDLIRGLLIKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAT  379

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP++P+PVE  R      A S+QK+  AA       +   +YLE +FF
Sbjct  380  PPDIPKPVEIPRSV----ASSSQKATSAA-------EKGSDYLELEFF  416



>ref|XP_006283574.1| hypothetical protein CARUB_v10004626mg [Capsella rubella]
 gb|EOA16472.1| hypothetical protein CARUB_v10004626mg [Capsella rubella]
Length=505

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  348  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  407

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  408  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  467

Query  411  ppevprpveferiPAPPPAP-----SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +  +  AA    S   +  NYLEFDFF
Sbjct  468  ---------------PPEIPKPVDLESAPATPAAATSTSVKSDQSNYLEFDFF  505



>dbj|BAF02156.1| putative protein kinase [Arabidopsis thaliana]
Length=506

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  349  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  408

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  409  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  468

Query  411  ppevprpveferiPAPPPAP-----SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +  +  AA    S   +  NYLEFDFF
Sbjct  469  ---------------PPEIPKPVDYESAPATPAAATSTSVKSDQSNYLEFDFF  506



>ref|NP_194391.1| D6 protein kinase like 1 [Arabidopsis thaliana]
 sp|Q9SUA3.1|D6KL1_ARATH RecName: Full=Serine/threonine-protein kinase D6PKL1; AltName: 
Full=Serine/threonine-protein kinase AGC1-2 [Arabidopsis thaliana]
 emb|CAB43857.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB79516.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL36279.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM14187.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE85226.1| D6 protein kinase like 1 [Arabidopsis thaliana]
Length=506

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  349  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  408

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  409  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  468

Query  411  ppevprpveferiPAPPPAP-----SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +  +  AA    S   +  NYLEFDFF
Sbjct  469  ---------------PPEIPKPVDYESAPATPAAATSTSVKSDQSNYLEFDFF  506



>ref|XP_010057774.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 ref|XP_010057775.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Eucalyptus 
grandis]
 gb|KCW75072.1| hypothetical protein EUGRSUZ_E03840 [Eucalyptus grandis]
 gb|KCW75073.1| hypothetical protein EUGRSUZ_E03840 [Eucalyptus grandis]
Length=613

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 138/178 (78%), Gaps = 25/178 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNRATLFNV
Sbjct  451  TEARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRATLFNV  510

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP+VSF+ARDLIRGLLVKEPQ+RLAYKRGATEIKQHPFF+G+NWALIRCA+
Sbjct  511  VGQPLRFPESPIVSFAARDLIRGLLVKEPQNRLAYKRGATEIKQHPFFDGLNWALIRCAT  570

Query  411  ppevprpveferiPAPPPAPS--------NQKSVVAAGAIPSCPQN--SDNYLEFDFF  268
                           PP  P            ++  A A+   P    S+NYLEFDFF
Sbjct  571  ---------------PPEIPKPVELERIPASATIEKAAAVTVAPNQIGSENYLEFDFF  613



>gb|EYU33716.1| hypothetical protein MIMGU_mgv1a004341mg [Erythranthe guttata]
Length=532

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 150/176 (85%), Gaps = 8/176 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT+GIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  357  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFLYELLFGKTPFKGSGNRATLFNV  416

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE PVVSF+ARDL+RGLLVKEPQ+R+ +KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  417  VGQPLRFPEQPVVSFAARDLVRGLLVKEPQNRVGFKRGATEIKQHPFFEGVNWALIRCAS  476

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP--------QNSDNYLEFDFF  268
            PPEVPRPVE E++ A P +     +  AA ++   P        +N+DNYLEFDFF
Sbjct  477  PPEVPRPVEIEKLSAGPTSLPPPPTATAAASVKIAPGPAVSPTRKNADNYLEFDFF  532



>ref|XP_002869601.1| hypothetical protein ARALYDRAFT_492147 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45860.1| hypothetical protein ARALYDRAFT_492147 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 20/173 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  353  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  412

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  413  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  472

Query  411  ppevprpveferiPAPPPAP-----SNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +  +  AA    S   +  NYLEFDFF
Sbjct  473  ---------------PPEIPKPVDIESAPATPAAATSTSVKSDQSNYLEFDFF  510



>ref|XP_010438725.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Camelina sativa]
Length=504

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 136/168 (81%), Gaps = 11/168 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  348  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  407

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  408  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  467

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+           P P          A A  +  +   +YLEFDFF
Sbjct  468  PPEI-----------PKPVDLESAPATPAAATSTSVKTDQSYLEFDFF  504



>ref|XP_010448241.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
 ref|XP_010448242.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
Length=504

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 132/168 (79%), Gaps = 11/168 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  348  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  407

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  408  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  467

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           P P          A A  +  +   +YLEFDFF
Sbjct  468  -----------PPEIPKPVDLESAPATPAAATSTSVKTDQSYLEFDFF  504



>ref|XP_010433468.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
 ref|XP_010433469.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Camelina 
sativa]
Length=504

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 136/168 (81%), Gaps = 11/168 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  348  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  407

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCAS
Sbjct  408  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAS  467

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+           P P          A A  +  +   +YLEFDFF
Sbjct  468  PPEI-----------PKPVDLESAPATPAAATSTSVKTDQSYLEFDFF  504



>ref|XP_009142543.1| PREDICTED: protein kinase G11A [Brassica rapa]
Length=513

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 135/174 (78%), Gaps = 22/174 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  356  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  415

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  416  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  475

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPS------CPQNSDNYLEFDFF  268
                            PP    Q    +A A P+         +  +YL+FDFF
Sbjct  476  ----------------PPEIPKQVEFESAPATPAPATSSSVKSDQSSYLDFDFF  513



>ref|NP_001057421.1| Os06g0291600 [Oryza sativa Japonica Group]
 sp|Q0DCT8.1|G11A_ORYSJ RecName: Full=Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAD54643.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAD69398.1| putative Protein kinase G11A [Oryza sativa Japonica Group]
 dbj|BAF19335.1| Os06g0291600 [Oryza sativa Japonica Group]
 dbj|BAG94521.1| unnamed protein product [Oryza sativa Japonica Group]
Length=589

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPVE ER    PP      S  AA    +  ++SD+YLEFDFF
Sbjct  546  PPEVPRPVEIER----PPKQPVSTSEPAAAPSDAAQKSSDSYLEFDFF  589



>emb|CDX89320.1| BnaA01g15730D [Brassica napus]
Length=513

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 135/174 (78%), Gaps = 22/174 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  356  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  415

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQHPFFEGVNWAL+RCAS
Sbjct  416  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALVRCAS  475

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPS------CPQNSDNYLEFDFF  268
                            PP    Q    +A A P+         +  +YL+FDFF
Sbjct  476  ----------------PPEIPKQVEFESAPATPAPATSSSVKSDQSSYLDFDFF  513



>sp|A2YBX5.1|G11A_ORYSI RecName: Full=Protein kinase G11A [Oryza sativa Indica Group]
Length=589

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPVE ER    PP      S  AA    +  ++SD+YLEFDFF
Sbjct  546  PPEVPRPVEIER----PPKQPVSTSEPAAAPSDAAQKSSDSYLEFDFF  589



>ref|XP_009120105.1| PREDICTED: protein kinase G11A [Brassica rapa]
Length=500

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 16/173 (9%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCA+
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAT  458

Query  411  ppevprpveferiPAPPPA---PSNQKSVVAAGAIPSCPQNSD--NYLEFDFF  268
                           P P    P  Q +     +  S    SD  NYLEFDFF
Sbjct  459  -----------PPEVPKPVDLEPVKQHAPATPASAASTSVRSDQSNYLEFDFF  500



>emb|CDY17366.1| BnaA10g10000D [Brassica napus]
Length=500

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 135/173 (78%), Gaps = 16/173 (9%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  339  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  398

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATE+KQHPFFEGVNWAL+RCA+
Sbjct  399  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEGVNWALVRCAT  458

Query  411  ppevprpveferiPAPPPA---PSNQKSVVAAGAIPSCPQNSD--NYLEFDFF  268
                           P P    P  Q +     +  S    SD  NYLEFDFF
Sbjct  459  -----------PPEVPKPVDLEPVKQHAPATPASAASTSVRSDQSNYLEFDFF  500



>gb|EEE65552.1| hypothetical protein OsJ_21028 [Oryza sativa Japonica Group]
Length=551

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  388  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  447

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  448  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  507

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPVE ER    PP      S  AA    +  ++SD+YLEFDFF
Sbjct  508  PPEVPRPVEIER----PPKQPVSTSEPAAAPSDAAQKSSDSYLEFDFF  551



>emb|CDY06552.1| BnaC02g12760D [Brassica napus]
Length=484

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 136/176 (77%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  324  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  383

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESPVVSF+ARDLIR LLVKEPQHRLAYKRGATEIKQH FFEGVNWAL+RCAS
Sbjct  384  VGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEIKQHAFFEGVNWALVRCAS  443

Query  411  ppevprpveferiPAPP--PAPSNQKSV------VAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P P   + V       AA A  S   +  NYLEFDFF
Sbjct  444  ---------------PPEIPKPVEIEPVNYAPPAAAAAASTSVRSDQSNYLEFDFF  484



>gb|EEC80426.1| hypothetical protein OsI_22605 [Oryza sativa Indica Group]
Length=551

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  388  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  447

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  448  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  507

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVPRPVE ER    PP      S  AA    +  ++SD+YLEFDFF
Sbjct  508  PPEVPRPVEIER----PPKQPVSTSEPAAAPSDAAQKSSDSYLEFDFF  551



>gb|AFW63631.1| putative protein kinase superfamily protein [Zea mays]
Length=280

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFGKTPFKGS NRATLFNV
Sbjct  115  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGKTPFKGSSNRATLFNV  174

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE P VSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  175  IGQQLRFPEYPAVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  234

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER    P +PS   +  A+   P   +  D YLEF FF
Sbjct  235  PPEVPKPVEIERPSNHPSSPSGAAADDASVGAPQ--KGVDGYLEFGFF  280



>ref|XP_008440970.1| PREDICTED: protein kinase G11A [Cucumis melo]
Length=607

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFN+
Sbjct  442  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNI  501

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP++PVVSF+A+DLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCA+
Sbjct  502  VGQPLRFPDAPVVSFAAKDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAT  561

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P   E    P    S  +  VA  A  +  + SDNYLEFDFF
Sbjct  562  --PPEIPRPVEIERIPHAVASTSEKAVAIAAAAADKKASDNYLEFDFF  607



>ref|XP_002454363.1| hypothetical protein SORBIDRAFT_04g029460 [Sorghum bicolor]
 gb|EES07339.1| hypothetical protein SORBIDRAFT_04g029460 [Sorghum bicolor]
Length=572

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS NRATLFNV
Sbjct  409  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSSNRATLFNV  468

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE PVVSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  469  IGQQLRFPEYPVVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  528

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE +R    P +PS      A  +I +  + +D YLEFDFF
Sbjct  529  PPEVPKPVEIDRPSKHPSSPSG----AADTSIGAPQKGADGYLEFDFF  572



>ref|XP_008353462.1| PREDICTED: protein kinase PVPK-1-like, partial [Malus domestica]
Length=354

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 132/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  194  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  253

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  254  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  313

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  314  ---------------PPQVPKHY--ILDTPDTPKEPMNGKMPGVDLKPSGNYLEMDFF  354



>ref|XP_010251076.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
 ref|XP_010251077.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
 ref|XP_010251078.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nelumbo 
nucifera]
Length=713

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  550  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  609

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCAS
Sbjct  610  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAS  669

Query  411  ppevpr--pveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VP+   ++F      P AP+N+K +      P     S NYLE DFF
Sbjct  670  PPDVPKPFVIDFPTRTEVPKAPTNEK-MPGVDVKP-----SGNYLEIDFF  713



>emb|CBI34860.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 132/168 (79%), Gaps = 17/168 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  406  TTARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  465

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  466  VGQPLRFPESPAVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTN  525

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P       +A ++   P  S NYLE DFF
Sbjct  526  ---------------PPDMPKPFMIDFSARSVDVKP--SGNYLEIDFF  556



>ref|XP_006604033.1| PREDICTED: protein kinase PVPK-1-like isoform X1 [Glycine max]
 ref|XP_006604034.1| PREDICTED: protein kinase PVPK-1-like isoform X2 [Glycine max]
 gb|KHN20820.1| Protein kinase PVPK-1 [Glycine soja]
Length=631

 Score =   249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 132/168 (79%), Gaps = 16/168 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  480  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  539

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPESP VSF+ARDLIRGLLVKEPQ+RLAY+RGATEIKQHPFF  VNWALIRCA+
Sbjct  540  VGQPLKFPESPTVSFAARDLIRGLLVKEPQNRLAYRRGATEIKQHPFFHNVNWALIRCAN  599

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +AA  +P   + S NYL+ DFF
Sbjct  600  ---------------PPEVPRQAMKALAAEKVPGV-KPSGNYLDIDFF  631



>ref|XP_010942581.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
 ref|XP_010942583.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
 ref|XP_010942584.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Elaeis 
guineensis]
Length=618

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 134/176 (76%), Gaps = 23/176 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARS+SFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  458  TDARSLSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  517

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL FPESPVVSFSA+DLIRGLLVKEPQ+RLAYKRGATEIKQHPFFEG+NWALIRCAS
Sbjct  518  VGQPLHFPESPVVSFSAKDLIRGLLVKEPQNRLAYKRGATEIKQHPFFEGMNWALIRCAS  577

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN--------SDNYLEFDFF  268
                           PP  P   +         S  Q         S+NYLEFDFF
Sbjct  578  ---------------PPGIPKRIEIESPPAPAASASQKVRAPIEKGSNNYLEFDFF  618



>gb|AFK49302.1| unknown [Medicago truncatula]
Length=388

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 131/169 (78%), Gaps = 16/169 (9%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  235  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  294

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRCA+
Sbjct  295  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNINWALIRCAT  354

Query  411  ppevprpveferiPAPPPAPSN-QKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P    K+ +         + S NYL+ DFF
Sbjct  355  ---------------PPEVPRQAMKAALTPEKKAPGVKPSGNYLDIDFF  388



>ref|XP_006470235.1| PREDICTED: protein kinase PVPK-1-like [Citrus sinensis]
Length=677

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 137/182 (75%), Gaps = 29/182 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  511  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  570

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+K+HPFF+ VNWALIRCAS
Sbjct  571  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKRHPFFQSVNWALIRCAS  630

Query  411  ppevprpveferiPAPPPAPSNQKSVVA---AGAIPSCPQNSD-----------NYLEFD  274
                           PP  P  + +V+       +P+ P  ++           NYLE D
Sbjct  631  ---------------PPDVPKQKPAVMDLPLRTEVPNAPTTNNNTPGVDVKPSGNYLEID  675

Query  273  FF  268
            FF
Sbjct  676  FF  677



>ref|XP_007140939.1| hypothetical protein PHAVU_008G154000g [Phaseolus vulgaris]
 gb|ESW12933.1| hypothetical protein PHAVU_008G154000g [Phaseolus vulgaris]
Length=640

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 132/168 (79%), Gaps = 16/168 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  489  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  548

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPESP VSF+ARDLIRGLLVKEPQ+RLAY+RGATEIKQHPFF  VNWALIRCA+
Sbjct  549  VGQPLKFPESPTVSFAARDLIRGLLVKEPQNRLAYRRGATEIKQHPFFHNVNWALIRCAN  608

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +AA  +P   + S NYL+ DFF
Sbjct  609  ---------------PPEIPRQAMKALAAEKVPGV-KPSGNYLDIDFF  640



>gb|KEH24780.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=630

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 129/169 (76%), Gaps = 16/169 (9%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR T+FNV
Sbjct  477  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRTTMFNV  536

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF  VNWALIRCA+
Sbjct  537  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFHNVNWALIRCAN  596

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
                           PP  P     +           N S NYLEFD+F
Sbjct  597  ---------------PPEVPRQTMMMKPNSTENEVGMNPSGNYLEFDYF  630



>ref|XP_010530081.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Tarenaya hassleriana]
Length=590

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 134/173 (77%), Gaps = 22/173 (13%)
 Frame = -2

Query  765  ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG  586
            ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFG+TPFKGSGNR TLFNVVG
Sbjct  433  ARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSGNRQTLFNVVG  492

Query  585  QPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCASpp  406
            Q LRFPE+PVVSF+ARDLIR LLVKEPQHRLA KRGATEIKQHPFFEGVNWALIRCA+  
Sbjct  493  QSLRFPETPVVSFAARDLIRCLLVKEPQHRLASKRGATEIKQHPFFEGVNWALIRCAT--  550

Query  405  evprpveferiPAPPPAPS-------NQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                         PP  P        +  S  A G + +  + S+NYLEFDFF
Sbjct  551  -------------PPEIPKPLDLVGVSPTSSPATGLVLNARKGSENYLEFDFF  590



>gb|KDO55122.1| hypothetical protein CISIN_1g005793mg [Citrus sinensis]
Length=677

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 137/182 (75%), Gaps = 29/182 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  511  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  570

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+K+HPFF+ VNWALIRCAS
Sbjct  571  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKRHPFFQSVNWALIRCAS  630

Query  411  ppevprpveferiPAPPPAPSNQKSVVAA---GAIPSCPQNSD-----------NYLEFD  274
                           PP  P  + +V+       +P+ P  ++           NYLE D
Sbjct  631  ---------------PPDVPKQKPAVMDLPLRTEVPNAPTTNNNTPGVDVKPSGNYLEID  675

Query  273  FF  268
            FF
Sbjct  676  FF  677



>emb|CDP02058.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 133/169 (79%), Gaps = 12/169 (7%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  518  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  577

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  578  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  637

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
                           P P P +    V    +P    + S NYLE DFF
Sbjct  638  -----------PPDVPKPFPIDDILRVPKPDVPGVDVKPSGNYLEIDFF  675



>ref|XP_006446599.1| hypothetical protein CICLE_v10014494mg [Citrus clementina]
 gb|ESR59839.1| hypothetical protein CICLE_v10014494mg [Citrus clementina]
Length=677

 Score =   249 bits (636),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 137/182 (75%), Gaps = 29/182 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  511  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  570

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+K+HPFF+ VNWALIRCAS
Sbjct  571  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKRHPFFQSVNWALIRCAS  630

Query  411  ppevprpveferiPAPPPAPSNQKSVVAA---GAIPSCPQNSD-----------NYLEFD  274
                           PP  P  + +V+       +P+ P  ++           NYLE D
Sbjct  631  ---------------PPDVPKQKPAVMDLPLRTEVPNAPTTNNNTPGVDVKPSGNYLEID  675

Query  273  FF  268
            FF
Sbjct  676  FF  677



>ref|XP_010108834.1| Protein kinase PVPK-1 [Morus notabilis]
 gb|EXC20349.1| Protein kinase PVPK-1 [Morus notabilis]
Length=681

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 131/178 (74%), Gaps = 25/178 (14%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  519  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  578

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRC +
Sbjct  579  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCTN  638

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P      +     P  P N          S NY+E DFF
Sbjct  639  ---------------PPDVPKQYVMDIPRTNSPKAPTNGKAQGVDVKTSGNYVEIDFF  681



>ref|XP_003563941.1| PREDICTED: protein kinase G11A-like [Brachypodium distachyon]
Length=563

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS NRATLFNV
Sbjct  400  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSANRATLFNV  459

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  460  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  519

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPE+PRPVE ER P  P + S   +     A     + SDNYLEFDFF
Sbjct  520  PPEIPRPVEIERAPKLPVSTSEAAAAPTGAA----QKGSDNYLEFDFF  563



>ref|XP_011097407.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Sesamum 
indicum]
Length=623

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEI+KGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFN+
Sbjct  464  TNARSMSFVGTHEYLAPEIVKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNI  523

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  524  VGQPLRFPDSPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAS  583

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP P   +    PPPA      V    A         NY E DFF
Sbjct  584  PPEVPPPYIMDNAGVPPPAAGTVHGVDVKPA--------GNYYEIDFF  623



>ref|XP_003547714.1| PREDICTED: protein kinase PVPK-1-like isoform X1 [Glycine max]
 ref|XP_006599089.1| PREDICTED: protein kinase PVPK-1-like isoform X2 [Glycine max]
 gb|KHN27550.1| Protein kinase PVPK-1 [Glycine soja]
Length=631

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 132/168 (79%), Gaps = 16/168 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  480  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  539

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPESP VSF+ARDLIRGLLVKEPQ+RLAY+RGATEIKQHPFF  VNWALIRCA+
Sbjct  540  VGQPLKFPESPTVSFAARDLIRGLLVKEPQNRLAYRRGATEIKQHPFFHNVNWALIRCAN  599

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P      +AA  +P   + S NYL+ DFF
Sbjct  600  ---------------PPEVPRLAMKALAAEKVPGV-KPSGNYLDIDFF  631



>ref|XP_009761249.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nicotiana 
sylvestris]
Length=656

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 133/172 (77%), Gaps = 23/172 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  504  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  563

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  564  VGQPLRFPSSPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  623

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----SDNYLEFDFF  268
                           PP  P   K  V    +PS P      +DNY E DFF
Sbjct  624  ---------------PPDVP---KPFVLHD-VPSTPATKVPGADNYFEIDFF  656



>ref|XP_008353460.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase PVPK-1-like, partial 
[Malus domestica]
Length=388

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 131/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  228  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  287

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC  
Sbjct  288  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCT-  346

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  347  --------------XPPQVPKHY--ILDTPDTPKEPMNGKMPGVDLKPSGNYLEMDFF  388



>ref|XP_004304655.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Fragaria 
vesca subsp. vesca]
Length=685

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  520  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  579

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  580  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTN  639

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
            PP VP       I    P P   K+    G +P    + S NY+E DFF
Sbjct  640  PPSVPPKQNPLDIS---PRPDTPKAASTDGKVPGVDLKPSGNYIEIDFF  685



>ref|XP_002272711.2| PREDICTED: protein kinase PVPK-1 [Vitis vinifera]
Length=683

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 134/179 (75%), Gaps = 26/179 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  520  TTARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  579

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  580  VGQPLRFPESPAVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTN  639

Query  411  ppevprpveferiPAPPPAP----------SNQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
                           PP  P          S+      AG +P    + S NYLE DFF
Sbjct  640  ---------------PPDMPKPFMIDFSARSDTTKAPTAGKVPGVDVKPSGNYLEIDFF  683



>ref|XP_008230533.1| PREDICTED: protein kinase PVPK-1 [Prunus mume]
 ref|XP_008230534.1| PREDICTED: protein kinase PVPK-1 [Prunus mume]
Length=674

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 140/169 (83%), Gaps = 9/169 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
            PP+VP+    E   AP P P N       G +P    + S NYLE DFF
Sbjct  634  PPQVPKHYILESPDAPKP-PIN-------GKVPGVDLKPSGNYLEIDFF  674



>ref|XP_007217638.1| hypothetical protein PRUPE_ppa002420mg [Prunus persica]
 gb|EMJ18837.1| hypothetical protein PRUPE_ppa002420mg [Prunus persica]
Length=674

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 140/169 (83%), Gaps = 9/169 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKG+GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGTGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
            PP+VP+    E   AP P P N       G +P    + S NYLE DFF
Sbjct  634  PPQVPKHYILESPDAPKP-PIN-------GKVPGVDLKPSGNYLEIDFF  674



>ref|XP_010538444.1| PREDICTED: serine/threonine-protein kinase D6PKL2-like [Tarenaya 
hassleriana]
Length=604

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 135/177 (76%), Gaps = 26/177 (15%)
 Frame = -2

Query  765  ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVG  586
            ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWT+GIFLYELLFG+TPFKGS NR TLFNVVG
Sbjct  443  ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTYGIFLYELLFGRTPFKGSSNRQTLFNVVG  502

Query  585  QPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCASpp  406
            QPLRFPE+PVVSF+ARDLIRGLLVKEPQHRLA+KRGATEIKQHPFFEGVNWALIRCA+  
Sbjct  503  QPLRFPETPVVSFAARDLIRGLLVKEPQHRLAFKRGATEIKQHPFFEGVNWALIRCAT--  560

Query  405  evprpveferiPAPPPAPSNQKSV----------VAAGAIPSCPQNSD-NYLEFDFF  268
                         PP  P    ++             G + +  + SD NYLEFDFF
Sbjct  561  -------------PPEIPKPITNLEPPSPSPPSEKTTGLVLNAQKGSDNNYLEFDFF  604



>ref|XP_010248634.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nelumbo 
nucifera]
Length=710

 Score =   247 bits (631),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 138/169 (82%), Gaps = 6/169 (4%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  547  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  606

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC S
Sbjct  607  IGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTS  666

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-SDNYLEFDFF  268
            PPEVP+P   +      P  +     +A   +P      S NYLE DFF
Sbjct  667  PPEVPKPFMMDL-----PTTTEVPKALANDKMPGMDMKPSGNYLEIDFF  710



>ref|XP_002521471.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF40961.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=676

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 135/180 (75%), Gaps = 27/180 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFGKTPFKG+GNRATLFNV
Sbjct  512  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGKTPFKGAGNRATLFNV  571

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFP+SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRC +
Sbjct  572  IGQPLRFPDSPPVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCTN  631

Query  411  ppevprpveferiPAPPPAPSNQ-----------KSVVAAGAIPSCP-QNSDNYLEFDFF  268
                           PP  P              K+  AAG +P    + S NYLE DFF
Sbjct  632  ---------------PPDVPKQAMIDFLMRADVPKTTQAAGNVPGIDVKPSGNYLEIDFF  676



>ref|XP_008660772.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase G11A-like [Zea 
mays]
Length=545

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFGKTPFKGS NRATLFNV
Sbjct  380  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGKTPFKGSSNRATLFNV  439

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE P VSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  440  IGQQLRFPEYPAVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  499

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER    P +PS   +  A+   P   +  D YLEF FF
Sbjct  500  PPEVPKPVEIERPSNHPSSPSGAAADDASVGAPQ--KGVDGYLEFGFF  545



>gb|EYU44793.1| hypothetical protein MIMGU_mgv1a004470mg [Erythranthe guttata]
Length=525

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 134/173 (77%), Gaps = 9/173 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFG TPFKG GN+ATLFNV
Sbjct  357  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGTTPFKGQGNKATLFNV  416

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGA+EIKQHPFF+ VNWALIRC S
Sbjct  417  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGASEIKQHPFFQNVNWALIRCTS  476

Query  411  -----ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                  P V          A  PAPS    V +   +    + SDNYLE DFF
Sbjct  477  PPDVPEPFVMDFDCDRGFRAGAPAPSVVNKVQSGVDV----KPSDNYLEIDFF  525



>ref|XP_009793786.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Nicotiana 
sylvestris]
Length=609

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 133/174 (76%), Gaps = 21/174 (12%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  451  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  510

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  511  VGQPLRFPETPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAS  570

Query  411  ppevprpveferiPAPPPAPS-----NQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
                           PP  P      +    + AG +     + S NY E DFF
Sbjct  571  ---------------PPDVPRPCMTYDMPRTLPAGKVAGVDVKPSGNYFEIDFF  609



>ref|XP_009615256.1| PREDICTED: protein kinase PVPK-1-like [Nicotiana tomentosiformis]
 ref|XP_009615257.1| PREDICTED: protein kinase PVPK-1-like [Nicotiana tomentosiformis]
Length=655

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  497  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  556

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  557  VGQPLRFPETPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAS  616

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VPRP     +P  PPA      V      P     S NY E DFF
Sbjct  617  PPDVPRPCMTYDMPRTPPA----GKVAGVDVKP-----SGNYFEIDFF  655



>gb|KJB33848.1| hypothetical protein B456_006G034200 [Gossypium raimondii]
Length=587

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 132/180 (73%), Gaps = 27/180 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  423  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  482

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCA+
Sbjct  483  VGQPLRFPEYPNVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAN  542

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P P+          I   P N          S NYLE DFF
Sbjct  543  ---------------PPEVPKPAMMDFSATQTDIGKVPTNNKMPGLDVKPSGNYLEIDFF  587



>ref|XP_008677207.1| PREDICTED: LOC100281711 isoform X1 [Zea mays]
 gb|AFW63632.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW63633.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=583

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFGKTPFKGS NRATLFNV
Sbjct  418  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGKTPFKGSSNRATLFNV  477

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE P VSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  478  IGQQLRFPEYPAVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  537

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER    P +PS   +  A+   P   +  D YLEF FF
Sbjct  538  PPEVPKPVEIERPSNHPSSPSGAAADDASVGAPQ--KGVDGYLEFGFF  583



>ref|NP_001148103.1| LOC100281711 [Zea mays]
 gb|ACG29743.1| protein kinase G11A [Zea mays]
Length=583

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFG+FLYELLFGKTPFKGS NRATLFNV
Sbjct  418  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGVFLYELLFGKTPFKGSSNRATLFNV  477

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQ LRFPE P VSFSARDLIRGLLVKEPQ RLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  478  IGQQLRFPEYPAVSFSARDLIRGLLVKEPQQRLAYKRGATEIKQHPFFEGVNWALIRCAS  537

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+PVE ER    P +PS   +  A+   P   +  D YLEF FF
Sbjct  538  PPEVPKPVEIERPSNHPSSPSGAAADDASVGAPQ--KGVDGYLEFGFF  583



>gb|KHG10864.1| kinase PVPK-1 [Gossypium arboreum]
Length=587

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 132/180 (73%), Gaps = 27/180 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  423  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  482

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCA+
Sbjct  483  VGQPLRFPEYPNVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAN  542

Query  411  ppevprpveferiPAPP--PAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P P+          I   P N          S NYLE DFF
Sbjct  543  ---------------PPEVPKPAMMDFSATRTDIGKVPTNNKMPGLDVKPSGNYLEIDFF  587



>gb|KEH22141.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=618

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 132/172 (77%), Gaps = 22/172 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  465  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  524

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRCA+
Sbjct  525  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNINWALIRCAT  584

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCP----QNSDNYLEFDFF  268
                           PP  P   +  + A   P       + S NYL+ DFF
Sbjct  585  ---------------PPEVP---RQAMKAALTPEKKAPGVKPSGNYLDIDFF  618



>ref|XP_008341388.1| PREDICTED: protein kinase PVPK-1 isoform X2 [Malus domestica]
Length=648

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 132/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  488  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  547

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  548  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  607

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  608  ---------------PPQVPKHY--ILDTPDTPKEPMNGKMPGVDLKPSGNYLEMDFF  648



>ref|XP_002298543.1| kinase 1 family protein [Populus trichocarpa]
 gb|EEE83348.1| kinase 1 family protein [Populus trichocarpa]
Length=646

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  483  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  542

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRC +
Sbjct  543  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSINWALIRCTN  602

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     +EF      P AP++    V    +   P  S NYLE DFF
Sbjct  603  PPEVPKQAIMEFLMRADSPKAPTD----VNVPGVDVKP--SGNYLEIDFF  646



>ref|XP_008341386.1| PREDICTED: protein kinase PVPK-1 isoform X1 [Malus domestica]
 ref|XP_008341387.1| PREDICTED: protein kinase PVPK-1 isoform X1 [Malus domestica]
Length=674

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 132/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  634  ---------------PPQVPKHY--ILDTPDTPKEPMNGKMPGVDLKPSGNYLEMDFF  674



>gb|KGN59708.1| hypothetical protein Csa_3G840350 [Cucumis sativus]
Length=671

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  508  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  567

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  568  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  627

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     ++F      P  P+ +K +      P     S NYLE DFF
Sbjct  628  PPEVPRVDVIDFSSRMETPHTPAGEK-MPGVDVKP-----SGNYLEIDFF  671



>ref|XP_009377149.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
 ref|XP_009377150.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
Length=674

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 132/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  634  ---------------PPQVPKHY--ILETPDTPKEPMNGKMPGVDLKPSGNYLEIDFF  674



>ref|XP_004965256.1| PREDICTED: protein kinase G11A-like isoform X1 [Setaria italica]
 ref|XP_004965257.1| PREDICTED: protein kinase G11A-like isoform X2 [Setaria italica]
Length=588

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 133/168 (79%), Gaps = 5/168 (3%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKG+GHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  426  SDARSMSFVGTHEYLAPEIIKGDGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  485

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSF ARDLIRGLL KEPQ RL YKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  486  IGQPLRFPEYPVVSFPARDLIRGLLAKEPQQRLGYKRGATEIKQHPFFEGVNWALIRCAS  545

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                P       I  PP  P++     A+       + SDNYLEF FF
Sbjct  546  ---PPEVPRPFEIGKPPKQPASTSESAASAGASQ--KGSDNYLEFGFF  588



>gb|EPS60863.1| hypothetical protein M569_13937 [Genlisea aurea]
Length=470

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 131/171 (77%), Gaps = 18/171 (11%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T A+SMSFVGTHEYLAPEIIKGEGHGS+VDWWTFGIF+YEL+FGKTPFKGS NRATLFNV
Sbjct  315  TEAKSMSFVGTHEYLAPEIIKGEGHGSSVDWWTFGIFMYELMFGKTPFKGSSNRATLFNV  374

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VS + RDLIR LLVKEPQ RL YKRGA EIKQHPFFEGVNWALIRCA+
Sbjct  375  VGQPLRFPETPPVSIAGRDLIRALLVKEPQCRLGYKRGAGEIKQHPFFEGVNWALIRCAN  434

Query  411  ppevprpveferiPAPP--PAPSNQ-KSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P P +   +  AA  +P  P  SD YLEFDFF
Sbjct  435  ---------------PPEIPKPVDVPDAATAAAHVPPPPHKSDKYLEFDFF  470



>ref|XP_009370368.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
 ref|XP_009370369.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
Length=674

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 132/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S NYLE DFF
Sbjct  634  ---------------PPQVPKHY--ILETPDTPKEPMNGKMPGVDLKPSGNYLEIDFF  674



>sp|P15792.1|KPK1_PHAVU RecName: Full=Protein kinase PVPK-1 [Phaseolus vulgaris]
 gb|AAA33772.1| PVPK-1 protein [Phaseolus vulgaris]
Length=609

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 134/173 (77%), Gaps = 26/173 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  458  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  517

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  518  IGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAT  577

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-----SDNYLEFDFF  268
                           PP  P   + V+    +P   ++     S NYL+ DFF
Sbjct  578  ---------------PPEVP---RQVI---NLPQTEKDLGVKPSGNYLDIDFF  609



>ref|XP_008464921.1| PREDICTED: protein kinase PVPK-1 [Cucumis melo]
 ref|XP_008464922.1| PREDICTED: protein kinase PVPK-1 [Cucumis melo]
 ref|XP_008464923.1| PREDICTED: protein kinase PVPK-1 [Cucumis melo]
Length=671

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  508  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  567

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  568  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  627

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     ++F      P  P+ +K +      P     S NYLE DFF
Sbjct  628  PPEVPRVDVIDFSSRMETPHTPAGEK-MPGVDVKP-----SGNYLEIDFF  671



>ref|XP_004514004.1| PREDICTED: protein kinase PVPK-1-like isoform X1 [Cicer arietinum]
 ref|XP_004514005.1| PREDICTED: protein kinase PVPK-1-like isoform X2 [Cicer arietinum]
Length=629

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 132/169 (78%), Gaps = 17/169 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  477  SNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  536

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQ+RLAY+RGATEIKQHPFF  +NWALIRCA+
Sbjct  537  VGQPLRFPESPSVSFAARDLIRGLLVKEPQNRLAYRRGATEIKQHPFFHNINWALIRCAT  596

Query  411  ppevprpveferiPAPPPAPSN-QKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P    K++     +P   + S NYL+ DFF
Sbjct  597  ---------------PPEVPRQAMKALTTEKKVPGV-KPSGNYLDIDFF  629



>ref|XP_007150929.1| hypothetical protein PHAVU_004G006600g [Phaseolus vulgaris]
 gb|ESW22923.1| hypothetical protein PHAVU_004G006600g [Phaseolus vulgaris]
Length=609

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 134/173 (77%), Gaps = 26/173 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  458  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  517

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  518  IGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAT  577

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN-----SDNYLEFDFF  268
                           PP  P   + V+    +P   ++     S NYL+ DFF
Sbjct  578  ---------------PPEVP---RQVI---NLPQTEKDLGVKPSGNYLDIDFF  609



>ref|XP_009603203.1| PREDICTED: serine/threonine-protein kinase D6PKL1-like [Nicotiana 
tomentosiformis]
Length=659

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 133/177 (75%), Gaps = 28/177 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GN+ATLFNV
Sbjct  502  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNKATLFNV  561

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFP SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  562  IGQPLRFPSSPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  621

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN---------SDNYLEFDFF  268
                           PP  P   K  V    +PS P           +DNY E DFF
Sbjct  622  ---------------PPDVP---KPFVLHD-VPSAPATKVPGADVKPADNYFEIDFF  659



>ref|XP_004233321.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Solanum lycopersicum]
 ref|XP_010317089.1| PREDICTED: serine/threonine-protein kinase D6PKL1 [Solanum lycopersicum]
Length=666

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 134/177 (76%), Gaps = 28/177 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  509  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  568

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  569  VGQPLRFPSSPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  628

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN---------SDNYLEFDFF  268
                           PP  P   K+ V   A P  P +         +DNY E DFF
Sbjct  629  ---------------PPDIP---KAFVLHDA-PRAPASTGPGVDVKPTDNYFEIDFF  666



>ref|XP_003554867.1| PREDICTED: protein kinase PVPK-1-like isoform X1 [Glycine max]
 ref|XP_006603783.1| PREDICTED: protein kinase PVPK-1-like isoform X2 [Glycine max]
 ref|XP_006603784.1| PREDICTED: protein kinase PVPK-1-like isoform X3 [Glycine max]
 gb|KHN19676.1| Protein kinase PVPK-1 [Glycine soja]
Length=612

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 130/168 (77%), Gaps = 16/168 (10%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  461  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSVNRATLFNV  520

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  521  IGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCAN  580

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                            PP    Q   +A        + S NYL+ DFF
Sbjct  581  ----------------PPEVPRQVMKLAQTEKELGVKPSGNYLDIDFF  612



>gb|AAA33905.1| G11A protein, partial [Oryza sativa]
Length=531

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            + ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  373  SDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  432

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            +GQPLRFPE PVVSFSARDLIRGLLVKEPQ RL  KRGATEIKQHPFFEGVNWALIRCAS
Sbjct  433  IGQPLRFPEYPVVSFSARDLIRGLLVKEPQQRLGCKRGATEIKQHPFFEGVNWALIRCAS  492



>ref|XP_006357202.1| PREDICTED: protein kinase PVPK-1-like [Solanum tuberosum]
Length=675

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 133/177 (75%), Gaps = 28/177 (16%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  518  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  577

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  578  VGQPLRFPSSPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  637

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN---------SDNYLEFDFF  268
                           PP  P   K+ V   A P  P           +DNY E DFF
Sbjct  638  ---------------PPDVP---KAFVLHDA-PRAPATTGPGVDVKPTDNYFEIDFF  675



>ref|XP_011015041.1| PREDICTED: protein kinase PVPK-1-like [Populus euphratica]
 ref|XP_011015042.1| PREDICTED: protein kinase PVPK-1-like [Populus euphratica]
 ref|XP_011015043.1| PREDICTED: protein kinase PVPK-1-like [Populus euphratica]
Length=680

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  517  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  576

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRC +
Sbjct  577  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSINWALIRCTN  636

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     +EF      P AP++    V    +   P  S NYLE DFF
Sbjct  637  PPEVPKQAIMEFLMRADSPKAPAD----VNVPGVDVKP--SGNYLEIDFF  680



>ref|XP_011003131.1| PREDICTED: protein kinase PVPK-1 [Populus euphratica]
 ref|XP_011003132.1| PREDICTED: protein kinase PVPK-1 [Populus euphratica]
 ref|XP_011003133.1| PREDICTED: protein kinase PVPK-1 [Populus euphratica]
Length=680

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  517  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  576

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRC +
Sbjct  577  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSINWALIRCTN  636

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     +EF      P AP++    V    +   P  S NYLE DFF
Sbjct  637  PPEVPKQAIMEFLMRADSPKAPAD----VNVPGVDVKP--SGNYLEIDFF  680



>gb|KHG08634.1| kinase PVPK-1 [Gossypium arboreum]
Length=639

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 134/182 (74%), Gaps = 31/182 (17%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  475  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  534

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+A+DLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  535  VGQPLRFPEYPSVSFAAKDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  594

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGA----IPSCPQN----------SDNYLEFD  274
                           PP  P       +AG     +P  P N          S NYLE D
Sbjct  595  ---------------PPDVPKQVVMDCSAGTNSAKVP--PTNDKVPGLDVKPSGNYLEID  637

Query  273  FF  268
            FF
Sbjct  638  FF  639



>ref|XP_006852313.1| hypothetical protein AMTR_s00049p00198350 [Amborella trichopoda]
 gb|ERN13780.1| hypothetical protein AMTR_s00049p00198350 [Amborella trichopoda]
Length=764

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV
Sbjct  586  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  645

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAYKRGATE+KQHPFF+ +NWALIRC S
Sbjct  646  VGQPLRFPESPTVSFAARDLIRGLLVKEPQHRLAYKRGATEVKQHPFFQSINWALIRCTS  705



>ref|XP_006338619.1| PREDICTED: protein kinase PVPK-1-like [Solanum tuberosum]
 emb|CAA62476.1| stpk1 protein kinase [Solanum tuberosum]
Length=631

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 133/175 (76%), Gaps = 22/175 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  472  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  531

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+P VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRC S
Sbjct  532  VGQPLKFPETPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCTS  591

Query  411  ppevprpveferiPAPP--PAPS----NQKSVVAAGAIPSCP-QNSDNYLEFDFF  268
                           PP  P PS    N      AG  P    + S NY E DFF
Sbjct  592  ---------------PPDVPKPSSMTYNMPRTPPAGKTPGVDVKPSGNYFEIDFF  631



>gb|KHG01211.1| kinase PVPK-1 [Gossypium arboreum]
Length=607

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 131/178 (74%), Gaps = 33/178 (19%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  453  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGNGNRATLFNV  512

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCA+
Sbjct  513  VGQPLRFPEYPNVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAN  572

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P          A+   P N          S NYLE DFF
Sbjct  573  ---------------PPEVPKQ--------AMMETPMNNKGPGLDVKPSGNYLEIDFF  607



>gb|KJB75934.1| hypothetical protein B456_012G064400 [Gossypium raimondii]
 gb|KJB75935.1| hypothetical protein B456_012G064400 [Gossypium raimondii]
Length=639

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 134/182 (74%), Gaps = 31/182 (17%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  475  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGAGNRATLFNV  534

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+A+DLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  535  VGQPLRFPEYPSVSFAAKDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  594

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGA----IPSCPQN----------SDNYLEFD  274
                           PP  P       +AG     +P  P N          S NYLE D
Sbjct  595  ---------------PPDVPKQVVMDFSAGTNSAKVP--PTNDKVPGLDVKPSGNYLEID  637

Query  273  FF  268
            FF
Sbjct  638  FF  639



>gb|KJB70894.1| hypothetical protein B456_011G094600 [Gossypium raimondii]
Length=649

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 131/178 (74%), Gaps = 33/178 (19%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG+GNRATLFNV
Sbjct  495  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGNGNRATLFNV  554

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCA+
Sbjct  555  VGQPLRFPEYPNVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAN  614

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P          A+   P N          S NYLE DFF
Sbjct  615  ---------------PPEVPKQ--------AMMETPMNNKGPGLDVKPSGNYLEIDFF  649



>ref|XP_011098415.1| PREDICTED: protein kinase PVPK-1 [Sesamum indicum]
Length=678

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  516  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  575

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCAS
Sbjct  576  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAS  635



>ref|XP_010033330.1| PREDICTED: protein kinase PVPK-1 [Eucalyptus grandis]
 ref|XP_010033331.1| PREDICTED: protein kinase PVPK-1 [Eucalyptus grandis]
 gb|KCW52934.1| hypothetical protein EUGRSUZ_J02248 [Eucalyptus grandis]
Length=680

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKG+GNRATL NV
Sbjct  515  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGAGNRATLINV  574

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE+P VSF+ARDLIRGLLVKEPQ+RLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  575  VGQPLRFPETPSVSFAARDLIRGLLVKEPQNRLAYRRGATEIKQHPFFQSVNWALIRCAN  634

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PP+VPRPV  E    P  +   Q S      +   P  S NYLE DFF
Sbjct  635  PPDVPRPVAPESPMKPASSTPPQASASEVTGVDVKP--SGNYLEIDFF  680



>gb|EEE68908.1| hypothetical protein OsJ_27758 [Oryza sativa Japonica Group]
Length=1950

 Score =   250 bits (638),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 127/168 (76%), Positives = 133/168 (79%), Gaps = 15/168 (9%)
 Frame = -2

Query  771   TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
             T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL        PFKGSGNRATLFNV
Sbjct  1798  TDARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFL--------PFKGSGNRATLFNV  1849

Query  591   VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
             VGQPLRFPESP+VSFSARDLIRGLLVK+PQHRLAYKRGATEIKQHPFFEGVNWALIRCAS
Sbjct  1850  VGQPLRFPESPMVSFSARDLIRGLLVKDPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  1909

Query  411   ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                   P   E    P PAP+ +K   AA       + SDNYLEF+FF
Sbjct  1910  --PPEIPKPVELERPPKPAPATEKVAPAANQ-----KGSDNYLEFEFF  1950



>ref|XP_010681851.1| PREDICTED: serine/threonine-protein kinase D6PK-like [Beta vulgaris 
subsp. vulgaris]
Length=631

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKG GNRATLFNV
Sbjct  467  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGQGNRATLFNV  526

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFP+SP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ +NWALIRCA+
Sbjct  527  VGQPLRFPDSPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSINWALIRCAT  586



>ref|XP_007031589.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 ref|XP_007031590.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY02515.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
 gb|EOY02516.1| D6 protein kinase like 2 isoform 1 [Theobroma cacao]
Length=678

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 138/170 (81%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELL+GKTPFKG+GNRATLFNV
Sbjct  515  TNARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLYGKTPFKGAGNRATLFNV  574

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRCA+
Sbjct  575  VGQPLRFPEYPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCAN  634

Query  411  ppevprpveferiPAPPPA--PSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
            PPEVP+    +       A  P+N K V      P     S NYLE DFF
Sbjct  635  PPEVPKQAMMDFSVRTDMAKVPNNDK-VPGVDVKP-----SGNYLEIDFF  678



>ref|XP_009334142.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
 ref|XP_009334143.1| PREDICTED: protein kinase PVPK-1-like [Pyrus x bretschneideri]
Length=674

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 131/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  514  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGQGNRATLFNV  573

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPE P VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  574  VGQPLRFPELPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  633

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P  +  ++     P  P N          S NYLE DFF
Sbjct  634  ---------------PPQVP--KHYILETPDTPKEPLNGKMPGVDLKPSGNYLEIDFF  674



>ref|XP_004231848.1| PREDICTED: serine/threonine-protein kinase D6PK [Solanum lycopersicum]
Length=625

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 134/175 (77%), Gaps = 22/175 (13%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  466  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGQTPFKGAGNRATLFNV  525

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPL+FPE+P VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRC S
Sbjct  526  VGQPLKFPETPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQNVNWALIRCTS  585

Query  411  ppevprpveferiPAPP--PAPSNQKSVV----AAGAIPSCP-QNSDNYLEFDFF  268
                           PP  P PS+    +     AG  P    + S NY E DFF
Sbjct  586  ---------------PPDVPKPSSMTYDMPRTPPAGKAPGLDVKPSGNYFEIDFF  625



>ref|XP_004489234.1| PREDICTED: protein kinase PVPK-1-like [Cicer arietinum]
Length=612

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 126/168 (75%), Gaps = 15/168 (9%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKGS NRATLFNV
Sbjct  460  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGSANRATLFNV  519

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ RDLIRGLLVKEPQHRLAY+RGATEIKQHPFF  VNWALIRCA+
Sbjct  520  VGQPLRFPESPTVSFAVRDLIRGLLVKEPQHRLAYRRGATEIKQHPFFHNVNWALIRCAN  579

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                           PP  P        +         S NYL+ DFF
Sbjct  580  ---------------PPEVPRQTMMRPNSTDQELGVNPSGNYLDIDFF  612



>ref|XP_009366949.1| PREDICTED: protein kinase PVPK-1-like, partial [Pyrus x bretschneideri]
Length=501

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 131/178 (74%), Gaps = 27/178 (15%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHG+AVDWWTFGIFLYELLFG+TPFKG GNRATLFNV
Sbjct  341  TSARSMSFVGTHEYLAPEIIKGEGHGNAVDWWTFGIFLYELLFGRTPFKGEGNRATLFNV  400

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATE+KQHPFF+ VNWALIRC +
Sbjct  401  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEVKQHPFFQSVNWALIRCTT  460

Query  411  ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQN----------SDNYLEFDFF  268
                           PP  P +   ++     P  P N          S N LE DFF
Sbjct  461  ---------------PPQVPKHY--ILETPGTPKEPINGKMPGVDLKPSVNCLEIDFF  501



>ref|XP_004158354.1| PREDICTED: protein kinase PVPK-1-like [Cucumis sativus]
Length=820

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  657  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  716

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  717  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  776

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     ++F      P  P+ +K +      P     S NYLE DFF
Sbjct  777  PPEVPRVDVIDFSSRMETPHTPAGEK-MPGVDVKP-----SGNYLEIDFF  820



>ref|XP_004141198.1| PREDICTED: protein kinase PVPK-1-like [Cucumis sativus]
Length=820

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  771  TGARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNV  592
            T ARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG+TPFKG+GNRATLFNV
Sbjct  657  TSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGRTPFKGAGNRATLFNV  716

Query  591  VGQPLRFPESPVVSFSARDLIRGLLVKEPQHRLAYKRGATEIKQHPFFEGVNWALIRCAS  412
            VGQPLRFPESP VSF+ARDLIRGLLVKEPQHRLAY+RGATEIKQHPFF+ VNWALIRCA+
Sbjct  717  VGQPLRFPESPSVSFAARDLIRGLLVKEPQHRLAYRRGATEIKQHPFFQSVNWALIRCAN  776

Query  411  --ppevprpveferiPAPPPAPSNQKSVVAAGAIPSCPQNSDNYLEFDFF  268
                     ++F      P  P+ +K +      P     S NYLE DFF
Sbjct  777  PPEVPRVDVIDFSSRMETPHTPAGEK-MPGVDVKP-----SGNYLEIDFF  820



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310