BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014G09

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO77465.1|  hypothetical protein CISIN_1g027612mg                   134   8e-37   Citrus sinensis [apfelsine]
ref|XP_007024899.1|  Vesicle-associated membrane protein 726 isof...    137   1e-36   Theobroma cacao [chocolate]
ref|XP_006448759.1|  hypothetical protein CICLE_v10016613mg             135   2e-36   Citrus clementina [clementine]
gb|KJB69905.1|  hypothetical protein B456_011G049200                    135   4e-36   Gossypium raimondii
ref|XP_008383321.1|  PREDICTED: vesicle-associated membrane prote...    134   7e-36   Malus domestica [apple tree]
ref|XP_010092659.1|  Putative vesicle-associated membrane protein...    134   9e-36   Morus notabilis
ref|XP_008225792.1|  PREDICTED: vesicle-associated membrane prote...    133   2e-35   Prunus mume [ume]
ref|XP_007212008.1|  hypothetical protein PRUPE_ppa011167mg             133   2e-35   Prunus persica
gb|KJB57020.1|  hypothetical protein B456_009G150900                    131   3e-35   Gossypium raimondii
gb|KDO77463.1|  hypothetical protein CISIN_1g027612mg                   132   3e-35   Citrus sinensis [apfelsine]
gb|KDP29315.1|  hypothetical protein JCGZ_19410                         132   4e-35   Jatropha curcas
gb|KJB57021.1|  hypothetical protein B456_009G150900                    132   6e-35   Gossypium raimondii
ref|XP_002276767.1|  PREDICTED: putative vesicle-associated membr...    132   7e-35   Vitis vinifera
ref|XP_002530145.1|  Vesicle-associated membrane protein, putative      132   7e-35   Ricinus communis
gb|KJB57023.1|  hypothetical protein B456_009G150900                    131   7e-35   Gossypium raimondii
gb|KJB57019.1|  hypothetical protein B456_009G150900                    132   7e-35   Gossypium raimondii
ref|XP_009618936.1|  PREDICTED: vesicle-associated membrane prote...    132   8e-35   Nicotiana tomentosiformis
ref|XP_009802587.1|  PREDICTED: vesicle-associated membrane prote...    132   8e-35   Nicotiana sylvestris
ref|XP_010242074.1|  PREDICTED: vesicle-associated membrane prote...    132   9e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011096786.1|  PREDICTED: vesicle-associated membrane prote...    130   4e-34   Sesamum indicum [beniseed]
ref|XP_008371850.1|  PREDICTED: vesicle-associated membrane prote...    130   4e-34   
ref|XP_007147528.1|  hypothetical protein PHAVU_006G132100g             130   5e-34   Phaseolus vulgaris [French bean]
ref|XP_011016724.1|  PREDICTED: vesicle-associated membrane prote...    129   6e-34   Populus euphratica
emb|CDP18918.1|  unnamed protein product                                129   6e-34   Coffea canephora [robusta coffee]
ref|XP_006377004.1|  hypothetical protein POPTR_0012s12000g             129   7e-34   Populus trichocarpa [western balsam poplar]
ref|XP_007157801.1|  hypothetical protein PHAVU_002G099400g             129   7e-34   Phaseolus vulgaris [French bean]
gb|KHN14368.1|  Putative vesicle-associated membrane protein 726        129   1e-33   Glycine soja [wild soybean]
ref|XP_003535044.1|  PREDICTED: vesicle-associated membrane prote...    129   1e-33   
ref|XP_004293741.1|  PREDICTED: putative vesicle-associated membr...    129   1e-33   Fragaria vesca subsp. vesca
ref|NP_001236634.1|  uncharacterized protein LOC100500089               129   1e-33   
gb|AFY26886.1|  vesicle-associated membrane protein 72                  128   2e-33   Morella rubra [Chinese arbutus]
ref|XP_004233223.1|  PREDICTED: vesicle-associated membrane prote...    128   2e-33   
ref|XP_004955737.1|  PREDICTED: vesicle-associated membrane prote...    128   3e-33   Setaria italica
ref|XP_002322360.1|  hypothetical protein POPTR_0015s15690g             127   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011040378.1|  PREDICTED: vesicle-associated membrane prote...    127   4e-33   Populus euphratica
ref|XP_004145455.1|  PREDICTED: putative vesicle-associated membr...    127   4e-33   Cucumis sativus [cucumbers]
ref|XP_008459063.1|  PREDICTED: vesicle-associated membrane prote...    127   5e-33   Cucumis melo [Oriental melon]
ref|XP_006583934.1|  PREDICTED: vesicle-associated membrane prote...    127   6e-33   Glycine max [soybeans]
ref|XP_009604671.1|  PREDICTED: vesicle-associated membrane prote...    127   6e-33   Nicotiana tomentosiformis
gb|KHN08022.1|  Putative vesicle-associated membrane protein 726        127   7e-33   Glycine soja [wild soybean]
gb|EYU43691.1|  hypothetical protein MIMGU_mgv1a013245mg                126   9e-33   Erythranthe guttata [common monkey flower]
gb|ACU19359.1|  unknown                                                 126   1e-32   Glycine max [soybeans]
ref|XP_011020669.1|  PREDICTED: vesicle-associated membrane prote...    126   1e-32   Populus euphratica
gb|KHN07197.1|  Vesicle-associated membrane protein 722                 122   1e-32   Glycine soja [wild soybean]
ref|XP_010038359.1|  PREDICTED: vesicle-associated membrane prote...    125   2e-32   Eucalyptus grandis [rose gum]
ref|XP_009413307.1|  PREDICTED: vesicle-associated membrane prote...    125   3e-32   
ref|XP_007140570.1|  hypothetical protein PHAVU_008G123800g             123   3e-32   Phaseolus vulgaris [French bean]
tpg|DAA42468.1|  TPA: putative vesicle-associated membrane protei...    123   3e-32   
gb|KHG06809.1|  hypothetical protein F383_08210                         124   5e-32   Gossypium arboreum [tree cotton]
ref|XP_011034474.1|  PREDICTED: vesicle-associated membrane prote...    124   5e-32   Populus euphratica
gb|KJB37799.1|  hypothetical protein B456_006G220500                    122   7e-32   Gossypium raimondii
ref|XP_003532299.1|  PREDICTED: vesicle-associated membrane prote...    124   8e-32   Glycine max [soybeans]
ref|XP_009388457.1|  PREDICTED: vesicle-associated membrane prote...    124   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241434.1|  uncharacterized protein LOC100804314               124   8e-32   Glycine max [soybeans]
ref|XP_002459506.1|  hypothetical protein SORBIDRAFT_02g005730          124   8e-32   Sorghum bicolor [broomcorn]
tpg|DAA59924.1|  TPA: putative vesicle-associated membrane protei...    122   1e-31   
emb|CDY10053.1|  BnaC08g43980D                                          123   1e-31   Brassica napus [oilseed rape]
ref|XP_007140571.1|  hypothetical protein PHAVU_008G123800g             123   1e-31   Phaseolus vulgaris [French bean]
ref|XP_006352702.1|  PREDICTED: putative vesicle-associated membr...    123   2e-31   Solanum tuberosum [potatoes]
ref|XP_002304708.1|  synptobrevin-related family protein                123   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010522412.1|  PREDICTED: vesicle-associated membrane prote...    123   2e-31   Tarenaya hassleriana [spider flower]
ref|NP_001030968.1|  vesicle-associated membrane protein 7B             122   2e-31   
ref|XP_009588661.1|  PREDICTED: vesicle-associated membrane prote...    123   2e-31   Nicotiana tomentosiformis
ref|XP_004242395.1|  PREDICTED: vesicle-associated membrane prote...    123   2e-31   
gb|KJB37798.1|  hypothetical protein B456_006G220500                    122   3e-31   Gossypium raimondii
ref|NP_001059109.1|  Os07g0194000                                       122   3e-31   
ref|XP_006294968.1|  hypothetical protein CARUB_v10024024mg             122   3e-31   Capsella rubella
emb|CDX79510.1|  BnaC03g18460D                                          122   3e-31   
ref|XP_009132911.1|  PREDICTED: vesicle-associated membrane prote...    122   3e-31   Brassica rapa
dbj|BAJ88124.1|  predicted protein                                      122   3e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010509926.1|  PREDICTED: vesicle-associated membrane prote...    122   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006410450.1|  hypothetical protein EUTSA_v10017216mg             122   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_003557429.1|  PREDICTED: vesicle-associated membrane prote...    122   4e-31   Brachypodium distachyon [annual false brome]
emb|CDY19450.1|  BnaC04g11490D                                          122   4e-31   Brassica napus [oilseed rape]
ref|XP_009143895.1|  PREDICTED: vesicle-associated membrane prote...    122   4e-31   Brassica rapa
ref|XP_002881263.1|  hypothetical protein ARALYDRAFT_482248             122   4e-31   
ref|XP_009111083.1|  PREDICTED: vesicle-associated membrane prote...    122   4e-31   Brassica rapa
ref|NP_001148792.1|  vesicle-associated membrane protein 725            122   4e-31   Zea mays [maize]
ref|XP_010522416.1|  PREDICTED: vesicle-associated membrane prote...    122   4e-31   Tarenaya hassleriana [spider flower]
emb|CDY06150.1|  BnaA09g50530D                                          122   5e-31   
ref|XP_007034424.1|  Vesicle-associated membrane protein 726 isof...    122   5e-31   
ref|XP_009118621.1|  PREDICTED: vesicle-associated membrane prote...    122   5e-31   Brassica rapa
gb|KDP20321.1|  hypothetical protein JCGZ_06407                         122   5e-31   Jatropha curcas
emb|CDY15521.1|  BnaA08g28050D                                          122   6e-31   Brassica napus [oilseed rape]
ref|XP_010923320.1|  PREDICTED: vesicle-associated membrane prote...    122   6e-31   
ref|XP_009119258.1|  PREDICTED: vesicle-associated membrane prote...    122   6e-31   Brassica rapa
emb|CDY18254.1|  BnaC05g02770D                                          122   6e-31   Brassica napus [oilseed rape]
gb|KFK42812.1|  hypothetical protein AALP_AA1G041800                    121   6e-31   Arabis alpina [alpine rockcress]
ref|XP_010069066.1|  PREDICTED: putative vesicle-associated membr...    121   6e-31   Eucalyptus grandis [rose gum]
emb|CDX86608.1|  BnaC08g00950D                                          121   6e-31   
ref|XP_006650747.1|  PREDICTED: vesicle-associated membrane prote...    121   6e-31   Oryza brachyantha
ref|XP_006304190.1|  hypothetical protein CARUB_v10010251mg             121   6e-31   Capsella rubella
ref|NP_171967.1|  vesicle-associated membrane protein 7B                121   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892239.1|  vesicle-associated membrane protein 7B             121   6e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009787803.1|  PREDICTED: vesicle-associated membrane prote...    121   7e-31   Nicotiana sylvestris
dbj|BAD43410.1|  putative vesicle-associated membrane protein, sy...    121   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556949.1|  PREDICTED: vesicle-associated membrane prote...    121   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_010475139.1|  PREDICTED: vesicle-associated membrane prote...    121   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004134008.1|  PREDICTED: putative vesicle-associated membr...    121   7e-31   Cucumis sativus [cucumbers]
ref|XP_006657530.1|  PREDICTED: vesicle-associated membrane prote...    121   7e-31   Oryza brachyantha
gb|AAB80624.1|  Strong similarity to Arabidopsis ATHSAR1 (gb|M904...    120   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438380.1|  PREDICTED: putative vesicle-associated membr...    121   8e-31   Cucumis melo [Oriental melon]
ref|XP_010542985.1|  PREDICTED: vesicle-associated membrane prote...    121   8e-31   Tarenaya hassleriana [spider flower]
ref|NP_001051606.1|  Os03g0803000                                       121   9e-31   
gb|KDP26403.1|  hypothetical protein JCGZ_17561                         121   1e-30   Jatropha curcas
ref|XP_004981381.1|  PREDICTED: vesicle-associated membrane prote...    120   1e-30   Setaria italica
gb|ACU18382.1|  unknown                                                 119   1e-30   Glycine max [soybeans]
gb|KJB42280.1|  hypothetical protein B456_007G153200                    120   1e-30   Gossypium raimondii
ref|XP_006420620.1|  hypothetical protein CICLE_v10005852mg             120   1e-30   
ref|XP_002518125.1|  Vesicle-associated membrane protein, putative      120   2e-30   Ricinus communis
ref|XP_002267063.1|  PREDICTED: vesicle-associated membrane prote...    120   2e-30   Vitis vinifera
ref|XP_007034425.1|  Vesicle-associated membrane protein 726 isof...    120   2e-30   
gb|KJB42279.1|  hypothetical protein B456_007G153200                    120   2e-30   Gossypium raimondii
ref|XP_009627066.1|  PREDICTED: vesicle-associated membrane prote...    120   2e-30   Nicotiana tomentosiformis
gb|ABK22119.1|  unknown                                                 120   2e-30   Picea sitchensis
ref|XP_010934067.1|  PREDICTED: putative vesicle-associated membr...    120   2e-30   
ref|XP_009418833.1|  PREDICTED: vesicle-associated membrane prote...    120   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008644423.1|  PREDICTED: vesicle-associated membrane prote...    120   3e-30   
ref|NP_001149329.1|  vesicle-associated membrane protein 725            119   4e-30   Zea mays [maize]
ref|XP_008235502.1|  PREDICTED: vesicle-associated membrane prote...    119   4e-30   Prunus mume [ume]
ref|XP_009408466.1|  PREDICTED: vesicle-associated membrane prote...    119   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW57284.1|  hypothetical protein EUGRSUZ_H00084                     122   5e-30   Eucalyptus grandis [rose gum]
ref|XP_011080177.1|  PREDICTED: vesicle-associated membrane prote...    119   6e-30   Sesamum indicum [beniseed]
ref|XP_008808719.1|  PREDICTED: vesicle-associated membrane prote...    119   6e-30   
ref|XP_004152023.1|  PREDICTED: putative vesicle-associated membr...    119   7e-30   Cucumis sativus [cucumbers]
ref|XP_010932918.1|  PREDICTED: putative vesicle-associated membr...    119   7e-30   
ref|XP_004492323.1|  PREDICTED: vesicle-associated membrane prote...    119   7e-30   Cicer arietinum [garbanzo]
ref|XP_008465086.1|  PREDICTED: vesicle-associated membrane prote...    119   8e-30   Cucumis melo [Oriental melon]
gb|AAA56991.1|  formerly called HAT24; synaptobrevin-related protein    118   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22568.1|  hypothetical protein B456_004G058500                    118   1e-29   Gossypium raimondii
ref|XP_008775432.1|  PREDICTED: vesicle-associated membrane prote...    118   1e-29   
ref|NP_180871.1|  vesicle-associated membrane protein 722               118   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083121.1|  PREDICTED: vesicle-associated membrane prote...    118   1e-29   Sesamum indicum [beniseed]
ref|NP_001031469.1|  vesicle-associated membrane protein 722            118   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84389.1|  unknown                                                 117   1e-29   Medicago truncatula
ref|XP_008803805.1|  PREDICTED: putative vesicle-associated membr...    118   1e-29   
ref|XP_009417150.1|  PREDICTED: vesicle-associated membrane prote...    118   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002297816.2|  hypothetical protein POPTR_0001s14430g             118   2e-29   
ref|XP_009336053.1|  PREDICTED: vesicle-associated membrane prote...    117   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_010109710.1|  Putative vesicle-associated membrane protein...    118   2e-29   Morus notabilis
ref|XP_002466264.1|  hypothetical protein SORBIDRAFT_01g004700          118   2e-29   
ref|XP_010241141.1|  PREDICTED: putative vesicle-associated membr...    117   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010674670.1|  PREDICTED: vesicle-associated membrane prote...    117   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001280954.1|  putative vesicle-associated membrane protein...    117   2e-29   Malus domestica [apple tree]
ref|XP_004247095.1|  PREDICTED: vesicle-associated membrane prote...    117   2e-29   
gb|EYU31743.1|  hypothetical protein MIMGU_mgv1a013482mg                117   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_007200442.1|  hypothetical protein PRUPE_ppa011218mg             117   2e-29   Prunus persica
ref|XP_010556950.1|  PREDICTED: vesicle-associated membrane prote...    117   2e-29   Tarenaya hassleriana [spider flower]
gb|KFK31144.1|  hypothetical protein AALP_AA6G074500                    117   3e-29   Arabis alpina [alpine rockcress]
ref|XP_003607843.1|  Vesicle-associated membrane protein                117   3e-29   
gb|AFK40215.1|  unknown                                                 117   3e-29   Medicago truncatula
gb|EPS70718.1|  hypothetical protein M569_04041                         117   3e-29   Genlisea aurea
ref|XP_009398406.1|  PREDICTED: putative vesicle-associated membr...    117   3e-29   
gb|ADK78986.1|  VAMP721                                                 117   4e-29   Petunia integrifolia subsp. inflata
ref|XP_006364264.1|  PREDICTED: vesicle-associated membrane prote...    117   4e-29   Solanum tuberosum [potatoes]
ref|XP_006418096.1|  hypothetical protein EUTSA_v10008729mg             117   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_003594451.1|  Vesicle-associated membrane protein                117   4e-29   
ref|XP_009132860.1|  PREDICTED: putative vesicle-associated membr...    117   4e-29   Brassica rapa
emb|CDY59642.1|  BnaAnng16140D                                          115   4e-29   Brassica napus [oilseed rape]
emb|CAN65946.1|  hypothetical protein VITISV_029427                     116   5e-29   Vitis vinifera
ref|XP_002264270.1|  PREDICTED: vesicle-associated membrane prote...    117   5e-29   Vitis vinifera
gb|EYU46345.1|  hypothetical protein MIMGU_mgv1a013442mg                117   5e-29   Erythranthe guttata [common monkey flower]
ref|XP_004505324.1|  PREDICTED: vesicle-associated membrane prote...    117   5e-29   
ref|XP_003636885.1|  Vesicle-associated membrane protein                114   6e-29   
gb|AAC04496.1|  putative synaptobrevin                                  116   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003604990.1|  Vesicle-associated membrane protein                116   7e-29   Medicago truncatula
ref|XP_009371395.1|  PREDICTED: putative vesicle-associated membr...    116   7e-29   Pyrus x bretschneideri [bai li]
emb|CDX79466.1|  BnaC03g18020D                                          115   8e-29   
ref|XP_009143949.1|  PREDICTED: putative vesicle-associated membr...    116   8e-29   Brassica rapa
ref|XP_002521112.1|  Vesicle-associated membrane protein, putative      116   8e-29   Ricinus communis
gb|KJB71677.1|  hypothetical protein B456_011G160700                    116   8e-29   Gossypium raimondii
ref|XP_004290222.1|  PREDICTED: vesicle-associated membrane prote...    116   9e-29   Fragaria vesca subsp. vesca
ref|XP_010314763.1|  PREDICTED: putative vesicle-associated membr...    115   1e-28   
ref|XP_007049803.1|  Vesicle-associated membrane protein 726            115   1e-28   
ref|XP_009608699.1|  PREDICTED: putative vesicle-associated membr...    115   1e-28   Nicotiana tomentosiformis
ref|XP_010228179.1|  PREDICTED: vesicle-associated membrane prote...    115   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_009757440.1|  PREDICTED: putative vesicle-associated membr...    115   1e-28   Nicotiana sylvestris
ref|XP_009335952.1|  PREDICTED: putative vesicle-associated membr...    115   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_010910152.1|  PREDICTED: vesicle-associated membrane prote...    115   1e-28   
ref|XP_006443628.1|  hypothetical protein CICLE_v10022162mg             115   1e-28   Citrus clementina [clementine]
ref|XP_009335953.1|  PREDICTED: putative vesicle-associated membr...    115   2e-28   
ref|XP_009370116.1|  PREDICTED: putative vesicle-associated membr...    115   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_003535217.1|  PREDICTED: putative vesicle-associated membr...    115   2e-28   Glycine max [soybeans]
ref|XP_009351028.1|  PREDICTED: putative vesicle-associated membr...    115   2e-28   Pyrus x bretschneideri [bai li]
gb|KFK31080.1|  hypothetical protein AALP_AA6G065800                    115   2e-28   Arabis alpina [alpine rockcress]
ref|XP_010326818.1|  PREDICTED: putative vesicle-associated membr...    114   2e-28   
emb|CDO99425.1|  unnamed protein product                                114   2e-28   Coffea canephora [robusta coffee]
emb|CDP03855.1|  unnamed protein product                                115   2e-28   Coffea canephora [robusta coffee]
ref|NP_180826.2|  vesicle-associated membrane protein 725               116   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008372458.1|  PREDICTED: putative vesicle-associated membr...    114   3e-28   
ref|XP_006293513.1|  hypothetical protein CARUB_v10024029mg             114   3e-28   Capsella rubella
ref|XP_002889523.1|  vesicle-associated membrane protein 7B             114   3e-28   Arabidopsis lyrata subsp. lyrata
ref|NP_171968.1|  vesicle-associated membrane protein 726               114   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253005.1|  PREDICTED: putative vesicle-associated membr...    114   3e-28   Solanum lycopersicum
ref|XP_010547078.1|  PREDICTED: vesicle-associated membrane prote...    114   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_003622969.1|  Vesicle-associated membrane protein                114   4e-28   Medicago truncatula
ref|XP_010524695.1|  PREDICTED: putative vesicle-associated membr...    114   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_010684935.1|  PREDICTED: vesicle-associated membrane prote...    114   4e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010264069.1|  PREDICTED: vesicle-associated membrane prote...    114   4e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010547077.1|  PREDICTED: vesicle-associated membrane prote...    114   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_007226125.1|  hypothetical protein PRUPE_ppa011188mg             114   5e-28   Prunus persica
ref|XP_003556884.1|  PREDICTED: putative vesicle-associated membr...    114   5e-28   Glycine max [soybeans]
ref|XP_008224587.1|  PREDICTED: putative vesicle-associated membr...    114   5e-28   Prunus mume [ume]
gb|KFK42811.1|  hypothetical protein AALP_AA1G041700                    114   5e-28   Arabis alpina [alpine rockcress]
gb|KEH41273.1|  synaptobrevin-like protein                              114   7e-28   Medicago truncatula
ref|XP_009621355.1|  PREDICTED: putative vesicle-associated membr...    113   8e-28   Nicotiana tomentosiformis
gb|EPS61521.1|  hypothetical protein M569_13274                         113   8e-28   Genlisea aurea
ref|XP_004247839.1|  PREDICTED: putative vesicle-associated membr...    113   9e-28   Solanum lycopersicum
ref|XP_002879406.1|  hypothetical protein ARALYDRAFT_482195             113   1e-27   
ref|XP_009767969.1|  PREDICTED: putative vesicle-associated membr...    113   1e-27   Nicotiana sylvestris
ref|XP_010326817.1|  PREDICTED: putative vesicle-associated membr...    113   1e-27   
ref|XP_006360344.1|  PREDICTED: vesicle-associated membrane prote...    113   1e-27   Solanum tuberosum [potatoes]
ref|XP_006857408.1|  hypothetical protein AMTR_s00067p00148060          113   1e-27   
ref|XP_011016158.1|  PREDICTED: vesicle-associated membrane prote...    113   1e-27   Populus euphratica
ref|XP_010413912.1|  PREDICTED: vesicle-associated membrane prote...    112   2e-27   Camelina sativa [gold-of-pleasure]
gb|KJB10140.1|  hypothetical protein B456_001G186000                    112   2e-27   Gossypium raimondii
gb|EPS71680.1|  hypothetical protein M569_03080                         112   2e-27   Genlisea aurea
ref|XP_008380599.1|  PREDICTED: putative vesicle-associated membr...    112   2e-27   Malus domestica [apple tree]
gb|AFK36461.1|  unknown                                                 112   2e-27   Lotus japonicus
ref|XP_010413913.1|  PREDICTED: vesicle-associated membrane prote...    112   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004296647.1|  PREDICTED: putative vesicle-associated membr...    112   3e-27   Fragaria vesca subsp. vesca
ref|XP_010469563.1|  PREDICTED: vesicle-associated membrane prote...    112   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010413966.1|  PREDICTED: putative vesicle-associated membr...    112   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006306317.1|  hypothetical protein CARUB_v10012187mg             112   3e-27   Capsella rubella
ref|XP_004514024.1|  PREDICTED: putative vesicle-associated membr...    112   4e-27   Cicer arietinum [garbanzo]
gb|KJB22567.1|  hypothetical protein B456_004G058500                    112   4e-27   Gossypium raimondii
ref|XP_004514025.1|  PREDICTED: putative vesicle-associated membr...    111   4e-27   Cicer arietinum [garbanzo]
ref|XP_010069661.1|  PREDICTED: vesicle-associated membrane prote...    112   4e-27   Eucalyptus grandis [rose gum]
ref|XP_006349937.1|  PREDICTED: vesicle-associated membrane prote...    110   4e-27   Solanum tuberosum [potatoes]
ref|XP_007145403.1|  hypothetical protein PHAVU_007G235900g             111   6e-27   Phaseolus vulgaris [French bean]
gb|EEC81677.1|  hypothetical protein OsI_25239                          112   6e-27   Oryza sativa Indica Group [Indian rice]
emb|CDY19154.1|  BnaA04g18940D                                          111   7e-27   Brassica napus [oilseed rape]
ref|XP_010475140.1|  PREDICTED: putative vesicle-associated membr...    111   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010457534.1|  PREDICTED: putative vesicle-associated membr...    110   8e-27   Camelina sativa [gold-of-pleasure]
gb|EYU17981.1|  hypothetical protein MIMGU_mgv1a013452mg                110   9e-27   Erythranthe guttata [common monkey flower]
ref|XP_006349936.1|  PREDICTED: vesicle-associated membrane prote...    110   1e-26   Solanum tuberosum [potatoes]
gb|AAQ15287.1|  synptobrevin-related protein                            109   1e-26   Pyrus pyrifolia [sha li]
ref|XP_009141263.1|  PREDICTED: vesicle-associated membrane prote...    110   2e-26   Brassica rapa
emb|CDY48531.1|  BnaC04g43180D                                          110   2e-26   Brassica napus [oilseed rape]
ref|XP_006410397.1|  hypothetical protein EUTSA_v10017717mg             110   2e-26   
ref|NP_001189664.1|  vesicle-associated membrane protein 722            107   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073775.1|  PREDICTED: putative vesicle-associated membr...    109   4e-26   Sesamum indicum [beniseed]
gb|EAZ25708.1|  hypothetical protein OsJ_09541                          107   6e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KJB33092.1|  hypothetical protein B456_006G056000                    108   6e-26   Gossypium raimondii
ref|XP_002303031.1|  hypothetical protein POPTR_0002s24200g             108   7e-26   
ref|XP_004985586.1|  PREDICTED: putative vesicle-associated membr...    108   1e-25   Setaria italica
ref|XP_006649451.1|  PREDICTED: putative vesicle-associated membr...    107   1e-25   Oryza brachyantha
emb|CDY19156.1|  BnaA04g18960D                                          105   1e-25   Brassica napus [oilseed rape]
ref|XP_004985585.1|  PREDICTED: putative vesicle-associated membr...    107   1e-25   Setaria italica
gb|EMT18448.1|  Putative vesicle-associated membrane protein 726        108   1e-25   
ref|XP_002468451.1|  hypothetical protein SORBIDRAFT_01g046130          107   2e-25   
gb|AAF40460.1|AC004809_18  Strong similarity to the synaptobrevin...    107   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049070.1|  Os03g0165800                                       106   5e-25   
ref|XP_004506588.1|  PREDICTED: vesicle-associated membrane prote...    105   6e-25   Cicer arietinum [garbanzo]
gb|KHM99990.1|  Putative vesicle-associated membrane protein 726        106   7e-25   Glycine soja [wild soybean]
ref|XP_008651398.1|  PREDICTED: putative vesicle-associated membr...    105   7e-25   
ref|XP_008651397.1|  PREDICTED: putative vesicle-associated membr...    105   7e-25   
ref|XP_008660540.1|  PREDICTED: putative vesicle-associated membr...    105   8e-25   Zea mays [maize]
ref|XP_008660539.1|  PREDICTED: putative vesicle-associated membr...    105   1e-24   Zea mays [maize]
ref|XP_008234811.1|  PREDICTED: putative vesicle-associated membr...    105   1e-24   Prunus mume [ume]
ref|XP_011091409.1|  PREDICTED: vesicle-associated membrane prote...    105   1e-24   Sesamum indicum [beniseed]
ref|XP_006664247.1|  PREDICTED: vesicle-associated membrane prote...    103   4e-24   Oryza brachyantha
ref|XP_003558739.1|  PREDICTED: putative vesicle-associated membr...    102   9e-24   Brachypodium distachyon [annual false brome]
gb|KCW62998.1|  hypothetical protein EUGRSUZ_G00599                     102   1e-23   Eucalyptus grandis [rose gum]
ref|XP_010068178.1|  PREDICTED: vesicle-associated membrane prote...    102   1e-23   
ref|XP_010065488.1|  PREDICTED: vesicle-associated membrane prote...    102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_008223166.1|  PREDICTED: vesicle-associated membrane prote...    102   2e-23   Prunus mume [ume]
ref|XP_010109711.1|  Vesicle-associated membrane protein 722          99.0    2e-23   
gb|AAY41423.1|  putative synaptobrevin-like protein                   98.6    2e-23   Ipomoea batatas [batate]
ref|XP_002986717.1|  hypothetical protein SELMODRAFT_235084             101   4e-23   Selaginella moellendorffii
ref|XP_007226119.1|  hypothetical protein PRUPE_ppa011159mg             100   6e-23   Prunus persica
gb|ABK27118.1|  unknown                                                 100   6e-23   Picea sitchensis
gb|ABK23325.1|  unknown                                                 100   9e-23   Picea sitchensis
gb|AFK40729.1|  unknown                                                 100   1e-22   Lotus japonicus
ref|XP_002960391.1|  hypothetical protein SELMODRAFT_164037             100   1e-22   Selaginella moellendorffii
ref|XP_002967324.1|  hypothetical protein SELMODRAFT_86867              100   1e-22   Selaginella moellendorffii
gb|ABK24294.1|  unknown                                                 100   1e-22   Picea sitchensis
gb|KJB12630.1|  hypothetical protein B456_002G028200                  98.6    1e-22   Gossypium raimondii
ref|XP_008375529.1|  PREDICTED: vesicle-associated membrane prote...  96.7    2e-22   
gb|KDO71623.1|  hypothetical protein CISIN_1g032590mg                 97.1    3e-22   
ref|XP_007010423.1|  Vesicle-associated membrane protein 727          99.4    3e-22   
ref|XP_002269134.1|  PREDICTED: vesicle-associated membrane prote...  99.0    4e-22   
gb|KJB12629.1|  hypothetical protein B456_002G028200                  99.4    4e-22   
gb|KDP43378.1|  hypothetical protein JCGZ_26478                       99.0    4e-22   
gb|KHG15268.1|  Vesicle-associated membrane protein                   98.6    5e-22   
ref|XP_001777330.1|  R-SNARE, VAMP72-family                           98.6    5e-22   
ref|XP_008390678.1|  PREDICTED: vesicle-associated membrane prote...  98.6    5e-22   
ref|XP_002515759.1|  Vesicle-associated membrane protein, putative    98.6    5e-22   
ref|XP_002315429.1|  hypothetical protein POPTR_0010s24630g           98.6    5e-22   
ref|XP_009146727.1|  PREDICTED: vesicle-associated membrane prote...  97.8    7e-22   
ref|XP_006414448.1|  hypothetical protein EUTSA_v10026189mg           97.8    8e-22   
ref|XP_009146719.1|  PREDICTED: vesicle-associated membrane prote...  97.8    8e-22   
gb|KFK44987.1|  hypothetical protein AALP_AA1G329300                  97.8    8e-22   
emb|CDY22900.1|  BnaA01g18380D                                        97.8    9e-22   
ref|XP_007142865.1|  hypothetical protein PHAVU_007G023300g           97.8    9e-22   
gb|ACU23563.1|  unknown                                               97.8    1e-21   
emb|CDY44179.1|  BnaC01g22290D                                        97.4    1e-21   
ref|XP_008244890.1|  PREDICTED: vesicle-associated membrane prote...  97.8    1e-21   
ref|XP_007218295.1|  hypothetical protein PRUPE_ppa010737mg           97.8    1e-21   
ref|XP_007035565.1|  Vesicle-associated membrane protein 724          97.4    1e-21   
gb|KJB38624.1|  hypothetical protein B456_006G263500                  97.1    1e-21   
ref|XP_010065491.1|  PREDICTED: vesicle-associated membrane prote...  97.4    1e-21   
ref|XP_003555880.1|  PREDICTED: vesicle-associated membrane prote...  97.4    1e-21   
ref|XP_006419598.1|  hypothetical protein CICLE_v10005844mg           97.1    1e-21   
ref|NP_001242377.1|  uncharacterized protein LOC100781950             97.1    1e-21   
ref|XP_006582892.1|  PREDICTED: uncharacterized protein LOC100781...  97.1    1e-21   
ref|XP_010065490.1|  PREDICTED: vesicle-associated membrane prote...  97.1    1e-21   
ref|XP_011032884.1|  PREDICTED: vesicle-associated membrane prote...  97.4    2e-21   
ref|XP_010931625.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_003550254.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_010434919.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_010695070.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_002868180.1|  hypothetical protein ARALYDRAFT_915207           96.7    2e-21   
sp|O23429.2|VA724_ARATH  RecName: Full=Vesicle-associated membran...  96.7    2e-21   
ref|XP_011024182.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_002273101.1|  PREDICTED: vesicle-associated membrane prote...  96.7    2e-21   
ref|XP_004497141.1|  PREDICTED: vesicle-associated membrane prote...  97.1    2e-21   
ref|XP_002311006.1|  Vesicle-associated membrane protein 727          97.1    2e-21   
ref|XP_010551064.1|  PREDICTED: vesicle-associated membrane prote...  96.3    3e-21   
ref|XP_003637224.1|  Vesicle-associated membrane protein              96.7    3e-21   
gb|ACU24529.1|  unknown                                               96.7    3e-21   
ref|XP_003536697.1|  PREDICTED: vesicle-associated membrane prote...  96.7    3e-21   
ref|XP_009355010.1|  PREDICTED: vesicle-associated membrane prote...  96.3    3e-21   
ref|XP_006855544.1|  hypothetical protein AMTR_s00057p00217050        96.3    3e-21   
ref|XP_010245408.1|  PREDICTED: vesicle-associated membrane prote...  96.3    4e-21   
gb|AAS88558.1|  putative synaptobrevin                                95.9    4e-21   
ref|XP_001784148.1|  R-SNARE, VAMP72-family                           95.9    4e-21   
ref|XP_010449891.1|  PREDICTED: vesicle-associated membrane prote...  95.9    4e-21   
ref|XP_008345948.1|  PREDICTED: vesicle-associated membrane prote...  96.3    4e-21   
ref|XP_009141288.1|  PREDICTED: vesicle-associated membrane prote...  95.9    4e-21   
emb|CAJ13552.1|  unnamed protein product                              95.9    4e-21   
emb|CDY37751.1|  BnaA04g19170D                                        95.9    4e-21   
gb|KEH41272.1|  synaptobrevin-like protein                            94.0    4e-21   
emb|CAJ13539.1|  unnamed protein product                              95.9    5e-21   
ref|XP_008800852.1|  PREDICTED: vesicle-associated membrane prote...  95.9    5e-21   
ref|XP_004171337.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...  95.5    5e-21   
gb|ACJ84394.1|  unknown                                               95.5    5e-21   
ref|XP_004143088.1|  PREDICTED: vesicle-associated membrane prote...  95.5    6e-21   
ref|XP_010037394.1|  PREDICTED: vesicle-associated membrane prote...  95.5    6e-21   
ref|XP_007154271.1|  hypothetical protein PHAVU_003G104700g           95.5    6e-21   
ref|XP_009352245.1|  PREDICTED: vesicle-associated membrane prote...  95.5    6e-21   
ref|XP_002877968.1|  ATVAMP727                                        95.5    6e-21   
ref|XP_010427103.1|  PREDICTED: vesicle-associated membrane prote...  95.5    7e-21   
ref|NP_190998.1|  vesicle-associated membrane protein 727             95.5    7e-21   
gb|AFK39584.1|  unknown                                               94.7    7e-21   
ref|XP_010504230.1|  PREDICTED: vesicle-associated membrane prote...  95.5    7e-21   
ref|XP_006291777.1|  hypothetical protein CARUB_v10017948mg           95.5    8e-21   
gb|AAV49990.1|  putative synaptobrevin/VAMP                           95.1    8e-21   
ref|XP_004249955.1|  PREDICTED: vesicle-associated membrane prote...  95.5    9e-21   
ref|XP_006284495.1|  hypothetical protein CARUB_v10005687mg           95.1    9e-21   
ref|NP_193313.5|  vesicle-associated membrane protein 724             95.1    9e-21   
ref|XP_008788949.1|  PREDICTED: vesicle-associated membrane prote...  95.1    1e-20   
ref|XP_009622317.1|  PREDICTED: vesicle-associated membrane prote...  95.1    1e-20   
emb|CDY23768.1|  BnaC04g43540D                                        93.6    1e-20   
ref|XP_009414577.1|  PREDICTED: vesicle-associated membrane prote...  94.7    1e-20   
ref|XP_004140905.1|  PREDICTED: vesicle-associated membrane prote...  94.7    1e-20   
ref|XP_008456603.1|  PREDICTED: vesicle-associated membrane prote...  94.7    1e-20   
ref|XP_010259650.1|  PREDICTED: vesicle-associated membrane prote...  94.7    1e-20   
ref|XP_009107862.1|  PREDICTED: vesicle-associated membrane prote...  94.0    1e-20   
gb|KHG06808.1|  hypothetical protein F383_08210                       81.6    1e-20   
gb|AFK42000.1|  unknown                                               94.4    1e-20   
ref|XP_006361486.1|  PREDICTED: vesicle-associated membrane prote...  94.7    1e-20   
ref|XP_010065492.1|  PREDICTED: vesicle-associated membrane prote...  94.4    2e-20   
ref|XP_003574932.1|  PREDICTED: vesicle-associated membrane prote...  94.7    2e-20   
emb|CAJ15414.1|  unnamed protein product                              94.4    2e-20   
emb|CAJ13968.1|  unnamed protein product                              94.4    2e-20   
gb|AFK38247.1|  unknown                                               94.0    2e-20   
emb|CDO99918.1|  unnamed protein product                              94.4    2e-20   
ref|XP_004487861.1|  PREDICTED: vesicle-associated membrane prote...  94.0    2e-20   
gb|KFK31079.1|  hypothetical protein AALP_AA6G065700                  94.0    2e-20   
ref|XP_009343983.1|  PREDICTED: vesicle-associated membrane prote...  94.0    2e-20   
ref|XP_002516908.1|  Vesicle-associated membrane protein, putative    94.0    2e-20   
gb|KHG04679.1|  Vesicle-associated membrane protein                   93.6    3e-20   
ref|XP_006403590.1|  hypothetical protein EUTSA_v10010674mg           94.0    3e-20   
emb|CDY22757.1|  BnaA08g05870D                                        93.2    3e-20   
gb|AFK47779.1|  unknown                                               93.6    3e-20   
ref|XP_008458455.1|  PREDICTED: vesicle-associated membrane prote...  93.6    3e-20   
ref|XP_010515951.1|  PREDICTED: vesicle-associated membrane prote...  93.6    3e-20   
ref|XP_006855103.1|  hypothetical protein AMTR_s00031p00183990        93.6    3e-20   
gb|KDP27786.1|  hypothetical protein JCGZ_18866                       92.8    4e-20   
ref|XP_008806092.1|  PREDICTED: vesicle-associated membrane prote...  93.6    4e-20   
gb|ACO87682.1|  synaptobrevin-like protein                            93.2    4e-20   
ref|XP_004974203.1|  PREDICTED: vesicle-associated membrane prote...  93.6    4e-20   
ref|NP_001237046.1|  uncharacterized protein LOC100527252             93.2    5e-20   
ref|XP_009139247.1|  PREDICTED: vesicle-associated membrane prote...  93.2    5e-20   
ref|XP_010910975.1|  PREDICTED: vesicle-associated membrane prote...  93.2    5e-20   
ref|XP_010554503.1|  PREDICTED: vesicle-associated membrane prote...  93.2    6e-20   
ref|XP_004306429.1|  PREDICTED: vesicle-associated membrane prote...  93.2    6e-20   
ref|XP_011101625.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...  92.8    6e-20   
ref|XP_004296828.1|  PREDICTED: vesicle-associated membrane prote...  92.4    7e-20   
ref|XP_003533403.1|  PREDICTED: vesicle-associated membrane prote...  92.4    9e-20   
ref|XP_007138903.1|  hypothetical protein PHAVU_009G247400g           92.0    1e-19   
ref|XP_008392281.1|  PREDICTED: vesicle-associated membrane prote...  92.0    1e-19   
ref|XP_010943829.1|  PREDICTED: vesicle-associated membrane prote...  92.4    1e-19   
ref|XP_004963344.1|  PREDICTED: putative vesicle-associated membr...  92.0    1e-19   
gb|KHG13199.1|  vesicle-associated membrane protein                   76.6    1e-19   
ref|XP_009116118.1|  PREDICTED: vesicle-associated membrane prote...  92.0    1e-19   
ref|XP_006389238.1|  hypothetical protein POPTR_0034s00330g           91.7    1e-19   
emb|CDX76153.1|  BnaA04g04170D                                        92.0    1e-19   
ref|XP_006659694.1|  PREDICTED: vesicle-associated membrane prote...  91.7    2e-19   
ref|NP_001136721.1|  uncharacterized protein LOC100216858             91.7    2e-19   
emb|CDY07551.1|  BnaC06g15130D                                        91.7    2e-19   
ref|NP_001132174.1|  uncharacterized protein LOC100193599             89.4    2e-19   
emb|CDX67594.1|  BnaA07g16340D                                        91.3    2e-19   
ref|XP_003577814.1|  PREDICTED: putative vesicle-associated membr...  91.3    2e-19   
ref|XP_009103912.1|  PREDICTED: vesicle-associated membrane prote...  91.3    3e-19   
ref|NP_001062495.1|  Os08g0558600                                     91.3    3e-19   
ref|NP_001067392.2|  Os12g0639800                                     90.9    3e-19   
ref|XP_006853346.1|  hypothetical protein AMTR_s00032p00095920        74.7    4e-19   
gb|KCW50174.1|  hypothetical protein EUGRSUZ_K03606                   90.5    4e-19   
emb|CDX78228.1|  BnaA09g34230D                                        90.9    4e-19   
gb|ACG34366.1|  vesicle-associated membrane protein 725               90.9    5e-19   
ref|XP_010031285.1|  PREDICTED: vesicle-associated membrane prote...  90.1    6e-19   
emb|CDX73490.1|  BnaC08g25130D                                        90.1    8e-19   
ref|XP_002442624.1|  hypothetical protein SORBIDRAFT_08g023180        89.7    9e-19   
ref|XP_007140572.1|  hypothetical protein PHAVU_008G123900g           89.4    1e-18   
ref|XP_011071446.1|  PREDICTED: vesicle-associated membrane prote...  89.0    2e-18   
ref|XP_004138954.1|  PREDICTED: putative vesicle-associated membr...  89.0    2e-18   
gb|EMT21571.1|  Vesicle-associated membrane protein 727               89.4    2e-18   
emb|CDY13199.1|  BnaC04g26360D                                        88.2    2e-18   
ref|XP_008667191.1|  PREDICTED: uncharacterized protein LOC100193...  89.0    2e-18   
ref|XP_008457254.1|  PREDICTED: vesicle-associated membrane prote...  88.2    2e-18   
ref|XP_011045447.1|  PREDICTED: vesicle-associated membrane prote...  88.2    3e-18   
ref|XP_002459621.1|  hypothetical protein SORBIDRAFT_02g007620        89.4    3e-18   
ref|XP_007034426.1|  Vesicle-associated membrane protein 721, VAMP7B  85.5    3e-18   
gb|KJB60248.1|  hypothetical protein B456_009G303300                  87.4    6e-18   
ref|NP_001059291.1|  Os07g0249200                                     87.8    6e-18   
gb|KJB60252.1|  hypothetical protein B456_009G303300                  87.4    6e-18   
ref|XP_006342793.1|  PREDICTED: vesicle-associated membrane prote...  86.7    9e-18   
gb|KDO77468.1|  hypothetical protein CISIN_1g027612mg                 86.3    9e-18   
ref|XP_006658441.1|  PREDICTED: vesicle-associated membrane prote...  86.3    1e-17   
ref|XP_010093888.1|  Putative vesicle-associated membrane protein...  84.0    1e-17   
ref|XP_006448758.1|  hypothetical protein CICLE_v10016613mg           85.9    1e-17   
ref|XP_006485186.1|  PREDICTED: vesicle-associated membrane prote...  86.7    1e-17   
gb|KHG28831.1|  Vesicle-associated membrane protein                   74.7    1e-17   
ref|XP_008662658.1|  PREDICTED: vesicle-associated membrane prote...  86.7    1e-17   
ref|XP_009784059.1|  PREDICTED: vesicle-associated membrane prote...  86.3    1e-17   
emb|CDP19534.1|  unnamed protein product                              86.3    1e-17   
gb|KGN66897.1|  hypothetical protein Csa_1G707620                     82.4    2e-17   
ref|XP_011090953.1|  PREDICTED: vesicle-associated membrane prote...  85.5    3e-17   
gb|EMT03059.1|  Putative vesicle-associated membrane protein 726      85.9    3e-17   
ref|XP_010024689.1|  PREDICTED: vesicle-associated membrane prote...  85.1    4e-17   
ref|XP_009592498.1|  PREDICTED: vesicle-associated membrane prote...  85.1    4e-17   
ref|XP_003561275.1|  PREDICTED: vesicle-associated membrane prote...  85.1    5e-17   
gb|KHG23670.1|  vesicle-associated membrane protein                   75.9    5e-17   
gb|EAZ07996.1|  hypothetical protein OsI_30258                        87.8    6e-17   
gb|EYU43939.1|  hypothetical protein MIMGU_mgv1a024116mg              83.2    6e-17   
ref|XP_011020670.1|  PREDICTED: vesicle-associated membrane prote...  84.0    7e-17   
ref|XP_003062253.1|  predicted protein                                84.3    7e-17   
ref|XP_008651495.1|  PREDICTED: vesicle-associated membrane prote...  84.3    8e-17   
ref|XP_002507800.1|  synaptobrevin like protein                       84.3    8e-17   
ref|XP_008651494.1|  PREDICTED: vesicle-associated membrane prote...  84.3    9e-17   
ref|NP_001150264.1|  vesicle-associated membrane protein 724          84.3    9e-17   
ref|XP_001779971.1|  R-SNARE, VAMP72-family                           84.0    1e-16   
gb|EEE69144.1|  hypothetical protein OsJ_28268                        87.4    1e-16   
ref|XP_004229234.1|  PREDICTED: vesicle-associated membrane prote...  83.6    1e-16   
gb|EYU19818.1|  hypothetical protein MIMGU_mgv1a012998mg              82.8    3e-16   
gb|ABR09143.1|  synaptobrevin-related protein 1                       79.0    3e-16   
gb|KEH22818.1|  synaptobrevin-like protein                            80.1    6e-16   
ref|XP_009419510.1|  PREDICTED: vesicle-associated membrane prote...  80.9    1e-15   
ref|XP_001764415.1|  R-SNARE, VAMP72-family                           81.3    1e-15   
ref|XP_003622943.1|  Vesicle-associated membrane protein              80.9    1e-15   
gb|KDO49381.1|  hypothetical protein CISIN_1g0277592mg                80.1    2e-15   
gb|EPS64544.1|  hypothetical protein M569_10239                       80.5    2e-15   
tpg|DAA42471.1|  TPA: putative vesicle-associated membrane protei...  80.1    2e-15   
gb|KCW63002.1|  hypothetical protein EUGRSUZ_G00602                   79.7    2e-15   
ref|XP_002959057.1|  hypothetical protein VOLCADRAFT_70298            80.1    2e-15   
ref|XP_004955897.1|  PREDICTED: vesicle-associated membrane prote...  80.1    3e-15   
tpg|DAA42470.1|  TPA: putative vesicle-associated membrane protei...  79.3    3e-15   
ref|XP_001692216.1|  R-SNARE protein, VAMP72-family                   79.3    4e-15   
gb|KJB33093.1|  hypothetical protein B456_006G056000                  78.6    4e-15   
ref|XP_005843431.1|  hypothetical protein CHLNCDRAFT_28123            78.2    1e-14   
ref|XP_010024691.1|  PREDICTED: vesicle-associated membrane prote...  77.8    1e-14   
gb|KDD72743.1|  synaptobrevin                                         77.0    2e-14   
gb|KJB22566.1|  hypothetical protein B456_004G058500                  77.4    2e-14   
ref|XP_005643794.1|  R-SNARE protein, VAMP72-family                   77.0    3e-14   
ref|XP_007219366.1|  hypothetical protein PRUPE_ppa019784mg           73.9    4e-14   
ref|XP_002958904.1|  hypothetical protein VOLCADRAFT_78158            76.6    4e-14   
gb|KHN03622.1|  Putative vesicle-associated membrane protein 726      74.3    9e-14   
ref|XP_009412480.1|  PREDICTED: vesicle-associated membrane prote...  75.1    1e-13   
ref|XP_001692208.1|  R-SNARE protein, VAMP72-family                   75.1    1e-13   
ref|XP_009412477.1|  PREDICTED: vesicle-associated membrane prote...  75.1    1e-13   
ref|XP_003552141.1|  PREDICTED: vesicle-associated membrane prote...  74.7    2e-13   
ref|XP_001418265.1|  predicted protein                                74.3    2e-13   
gb|EPS62366.1|  hypothetical protein M569_12426                       71.6    4e-13   
gb|ABA99617.1|  Synaptobrevin family protein, expressed               73.2    5e-13   
ref|XP_007513254.1|  unknown                                          74.3    7e-13   
gb|EAZ21365.1|  hypothetical protein OsJ_37022                        72.0    8e-13   
ref|XP_002274165.2|  PREDICTED: vesicle-associated membrane prote...  71.2    8e-13   
ref|NP_001189966.1|  vesicle-associated membrane protein              70.5    2e-12   
ref|XP_001692324.1|  R-SNARE protein, VAMP72-family                   71.6    2e-12   
gb|AES87177.2|  synaptobrevin-like protein                            69.7    4e-12   
ref|XP_003604980.1|  Vesicle-associated membrane protein              69.3    4e-12   
dbj|BAB02899.1|  unnamed protein product                              70.5    5e-12   
ref|XP_001777794.1|  R-SNARE, VAMP72-family                           70.1    8e-12   
ref|XP_010491809.1|  PREDICTED: vesicle-associated membrane prote...  69.7    1e-11   
ref|XP_005832059.1|  vesicle-associated membrane protein 7C           69.7    1e-11   
ref|NP_196676.1|  vesicle-associated membrane protein 713             69.7    1e-11   
ref|XP_010419668.1|  PREDICTED: vesicle-associated membrane prote...  69.3    1e-11   
emb|CDY48527.1|  BnaC04g43220D                                        67.0    1e-11   



>gb|KDO77465.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=143

 Score =   134 bits (338),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G K+R K
Sbjct  49   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRK  108

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  109  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  143



>ref|XP_007024899.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY27521.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=221

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_006448759.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 ref|XP_006468428.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR61999.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77464.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=221

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>gb|KJB69905.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
Length=222

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRS G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRSTGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_008383321.1| PREDICTED: vesicle-associated membrane protein 721-like [Malus 
domestica]
 ref|XP_009353936.1| PREDICTED: vesicle-associated membrane protein 721-like [Pyrus 
x bretschneideri]
Length=221

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILII++SVCHGFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILIIIMSVCHGFNCGK  221



>ref|XP_010092659.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXB51910.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=221

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTAGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWL+NMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  187  MWLKNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_008225792.1| PREDICTED: vesicle-associated membrane protein 721-like [Prunus 
mume]
Length=221

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALIL+I+LSVCHGFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
 gb|EMJ13207.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
Length=221

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALIL+I+LSVCHGFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>gb|KJB57020.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=169

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  74   EISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRK  133

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  134  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  167



>gb|KDO77463.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=203

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E  KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G K+R K
Sbjct  109  EFGKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRK  168

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  169  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  203



>gb|KDP29315.1| hypothetical protein JCGZ_19410 [Jatropha curcas]
Length=221

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTSGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  221



>gb|KJB57021.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=216

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  121  EISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRK  180

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  181  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  214



>ref|XP_002276767.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis 
vinifera]
 emb|CAN81365.1| hypothetical protein VITISV_015772 [Vitis vinifera]
 emb|CBI27181.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVK QVSEVKGVMMENIEKV DRGEKIEL VDKT N H+QAQDFRS G KIR K
Sbjct  127  EISKLAKVKDQVSEVKGVMMENIEKVLDRGEKIELLVDKTHNLHEQAQDFRSAGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI++ALILIIVLSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGILVALILIIVLSVCHGFNCGK  221



>ref|XP_002530145.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF32237.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=221

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G KIR K
Sbjct  127  EISKFAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSSGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  221



>gb|KJB57023.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=201

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  106  EISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRK  165

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  166  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  199



>gb|KJB57019.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=222

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G KIR K
Sbjct  127  EISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  220



>ref|XP_009618936.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
tomentosiformis]
Length=222

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  188  MWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_009802587.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
sylvestris]
Length=222

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  188  MWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_010242074.1| PREDICTED: vesicle-associated membrane protein 721-like [Nelumbo 
nucifera]
Length=222

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G K+R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRNTGTKMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  188  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_011096786.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=226

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  132  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRATGTKIRRK  191

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  192  MWLQNMKIKLIVLAIVIALILIIVLSVCKGFNCGK  226



>ref|XP_008371850.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_008371869.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_009357270.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
 ref|XP_009378895.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
Length=221

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILII+LS+CHGFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILIIILSICHGFNCGK  221



>ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
 gb|ESW19522.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
Length=221

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRTSGTRIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_011016724.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=221

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRS G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>emb|CDP18918.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G K+R K
Sbjct  132  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGTKMRRK  191

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVL I+IALILII+LS C GFNCGK
Sbjct  192  MWLQNMKVKLIVLAIVIALILIIILSACKGFNCGK  226



>ref|XP_006377004.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
 gb|ABK92923.1| unknown [Populus trichocarpa]
 gb|ABK94486.1| unknown [Populus trichocarpa]
 gb|ABK95420.1| unknown [Populus trichocarpa]
 gb|ERP54801.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
Length=221

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRS G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
 gb|ESW29795.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
Length=226

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  131  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  190

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVL I+IALILIIVLSVC GFNCGK
Sbjct  191  MWLQNMKVKLIVLAILIALILIIVLSVCRGFNCGK  225



>gb|KHN14368.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_003535044.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
1 [Glycine max]
 gb|ACJ61478.1| synaptobrevin-related protein [Glycine max]
 gb|KHN22964.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_004293741.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE  H QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTETLHHQAQDFRNVGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMK+KLIVLGI+IALILII+LSVCHGFNCGK
Sbjct  187  MWLQNMKVKLIVLGILIALILIIILSVCHGFNCGK  221



>ref|NP_001236634.1| uncharacterized protein LOC100500089 [Glycine max]
 gb|ACU14879.1| unknown [Glycine max]
Length=221

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>gb|AFY26886.1| vesicle-associated membrane protein 72 [Morella rubra]
Length=219

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_004233223.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
lycopersicum]
 ref|XP_006362607.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
tuberosum]
Length=222

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  188  MWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>ref|XP_004955737.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=222

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGIIIALILII+LSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFNCGK  221



>ref|XP_002322360.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
 gb|EEF06487.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
Length=219

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI+I LILIIVLS+C GFNC
Sbjct  187  MWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>ref|XP_011040378.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI+I LILIIVLS+C GFNC
Sbjct  187  MWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>ref|XP_004145455.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004165486.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
Length=222

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDF++ G KIR K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHTQAQDFKTSGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCG
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>ref|XP_008459063.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=222

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDF++ G KIR K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFKTSGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCG
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>ref|XP_006583934.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
 gb|KHN42974.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  131  EISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  190

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  191  MWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_009604671.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
tomentosiformis]
 ref|XP_009759428.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
sylvestris]
Length=222

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  128  EISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGTQIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  188  MWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>gb|KHN08022.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  131  EISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  190

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  191  MWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>gb|EYU43691.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
 gb|EYU43692.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
Length=226

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKV+AQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN H QAQDF++ G KIR K
Sbjct  132  EISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLHNQAQDFKTTGTKIRRK  191

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVL I+IALILII+LSVC GFNCGK
Sbjct  192  MWLQNMKIKLIVLAIVIALILIIILSVCKGFNCGK  226



>gb|ACU19359.1| unknown [Glycine max]
Length=221

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV EVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR+ G +IR K
Sbjct  127  EISKLAKVKAQVFEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_011020669.1| PREDICTED: vesicle-associated membrane protein 721 isoform X1 
[Populus euphratica]
Length=219

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRKQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMK+KLIVLGIIIALILIIVLSVCHGFNC
Sbjct  187  MWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>gb|KHN07197.1| Vesicle-associated membrane protein 722 [Glycine soja]
Length=104

 Score =   122 bits (307),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  10   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  69

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  70   MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  104



>ref|XP_010038359.1| PREDICTED: vesicle-associated membrane protein 721-like [Eucalyptus 
grandis]
 gb|KCW50175.1| hypothetical protein EUGRSUZ_K03606 [Eucalyptus grandis]
Length=222

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGIIIALIL+IVLSVCHGFNCG
Sbjct  187  MWLQNMKIKLIVLGIIIALILVIVLSVCHGFNCG  220



>ref|XP_009413307.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_007140570.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|ESW12564.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=164

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  70   EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  129

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  130  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  164



>tpg|DAA42468.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=168

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  73   EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  132

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  133  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  166



>gb|KHG06809.1| hypothetical protein F383_08210 [Gossypium arboreum]
Length=219

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>ref|XP_011034474.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
 ref|XP_011034475.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVL IIIALILIIVLS+CHGFNC
Sbjct  187  MWIQNMKIKLIVLAIIIALILIIVLSICHGFNC  219



>gb|KJB37799.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=160

 Score =   122 bits (307),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  68   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNMRRK  127

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  128  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  160



>ref|XP_003532299.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
Length=221

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|XP_009388457.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  G K+R K
Sbjct  127  EISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycine max]
 gb|ACU24640.1| unknown [Glycine max]
 gb|KHN36363.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|XP_002459506.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 ref|XP_008667049.1| PREDICTED: uncharacterized protein LOC100191650 isoform X1 [Zea 
mays]
 gb|ACF84519.1| unknown [Zea mays]
 gb|ACF84742.1| unknown [Zea mays]
 gb|ACG28427.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACN28437.1| unknown [Zea mays]
 gb|EER96027.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 tpg|DAA42472.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=222

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>tpg|DAA59924.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=161

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  66   EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVRRK  125

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  126  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  159



>emb|CDY10053.1| BnaC08g43980D [Brassica napus]
Length=220

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+AL LIIVLSVCHGF C
Sbjct  188  MWLQNMKIKLIVLAIIVALTLIIVLSVCHGFKC  220



>ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|AGV54239.1| vesicle-associated membrane protein [Phaseolus vulgaris]
 gb|ESW12565.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=221

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|XP_006352702.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Solanum tuberosum]
Length=220

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ G K+R K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII+ALIL+IVLS+CHGFNC
Sbjct  187  MWLQNMKIKLIVLGIILALILVIVLSICHGFNC  219



>ref|XP_002304708.1| synptobrevin-related family protein [Populus trichocarpa]
 gb|EEE79687.1| synptobrevin-related family protein [Populus trichocarpa]
Length=219

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMK+KLIVLGIIIALILIIVLSVCHGFNC
Sbjct  187  MWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>ref|XP_010522412.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|NP_001030968.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 dbj|BAD44122.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27739.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=181

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  89   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  148

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  149  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  181



>ref|XP_009588661.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
tomentosiformis]
Length=220

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVL II+ALIL+IVLS+CHGF C
Sbjct  187  MWLQNMKVKLIVLAIIVALILVIVLSICHGFKC  219



>ref|XP_004242395.1| PREDICTED: vesicle-associated membrane protein 721-like [Solanum 
lycopersicum]
Length=220

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ G K+R K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII ALI++IVLS+CHGFNC
Sbjct  187  MWLQNMKIKLIVLGIIFALIMVIVLSICHGFNC  219



>gb|KJB37798.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=219

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>ref|NP_001059109.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAD30158.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 emb|CAD70274.1| synaptobrevin 1 [Oryza sativa Japonica Group]
 dbj|BAF21023.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAG87612.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96866.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006294968.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
 gb|EOA27866.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
Length=221

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>emb|CDX79510.1| BnaC03g18460D [Brassica napus]
Length=222

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  188  MWFQNMKIKLIVLAIVIALILIIVLSVCGGFNCGK  222



>ref|XP_009132911.1| PREDICTED: vesicle-associated membrane protein 722-like [Brassica 
rapa]
 emb|CDX84702.1| BnaA03g15280D [Brassica napus]
Length=222

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  188  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  222



>dbj|BAJ88124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKV+AQVSEVK VMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EINKLAKVQAQVSEVKNVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGII+ALILII+LSVCHGFNCGK
Sbjct  187  MWLQNMKIKLIVLGIIVALILIIILSVCHGFNCGK  221



>ref|XP_010509926.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
 ref|XP_010413909.1| PREDICTED: vesicle-associated membrane protein 722 isoform X1 
[Camelina sativa]
 ref|XP_010413910.1| PREDICTED: vesicle-associated membrane protein 722 isoform X2 
[Camelina sativa]
 ref|XP_010469516.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
Length=221

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_006410450.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
 gb|ESQ51903.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
Length=221

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_003557429.1| PREDICTED: vesicle-associated membrane protein 721 [Brachypodium 
distachyon]
Length=221

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C K
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKCNK  221



>emb|CDY19450.1| BnaC04g11490D [Brassica napus]
Length=223

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  129  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  188

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  189  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|XP_009143895.1| PREDICTED: vesicle-associated membrane protein 722 [Brassica 
rapa]
 emb|CDY17139.1| BnaA05g10490D [Brassica napus]
Length=223

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  129  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  188

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  189  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|XP_002881263.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57522.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
Length=231

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  137  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  196

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILII+LSVC GFNCGK
Sbjct  197  MWFQNMKIKLIVLAIIIALILIIILSVCGGFNCGK  231



>ref|XP_009111083.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=219

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|NP_001148792.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACG32929.1| vesicle-associated membrane protein 725 [Zea mays]
Length=222

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCG  180
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>ref|XP_010522416.1| PREDICTED: vesicle-associated membrane protein 725 [Tarenaya 
hassleriana]
Length=220

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIAL+LI+VLS+CHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALVLIMVLSICHGFKC  219



>emb|CDY06150.1| BnaA09g50530D [Brassica napus]
Length=220

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  188  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=219

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_009118621.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=220

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  188  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>gb|KDP20321.1| hypothetical protein JCGZ_06407 [Jatropha curcas]
Length=219

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KI+ K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMK+KLIV GI++ALILIIVLSVCHGFNC
Sbjct  187  MWIENMKMKLIVFGIVLALILIIVLSVCHGFNC  219



>emb|CDY15521.1| BnaA08g28050D [Brassica napus]
Length=219

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_010923320.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=219

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009119258.1| PREDICTED: vesicle-associated membrane protein 721 [Brassica 
rapa]
 emb|CDX89793.1| BnaA10g02890D [Brassica napus]
Length=220

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  188  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>emb|CDY18254.1| BnaC05g02770D [Brassica napus]
Length=220

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  188  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>gb|KFK42812.1| hypothetical protein AALP_AA1G041800 [Arabis alpina]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_010069066.1| PREDICTED: putative vesicle-associated membrane protein 726 [Eucalyptus 
grandis]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  219



>emb|CDX86608.1| BnaC08g00950D [Brassica napus]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_006650747.1| PREDICTED: vesicle-associated membrane protein 721-like [Oryza 
brachyantha]
Length=220

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGTQVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006304190.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 ref|XP_006418097.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
 ref|XP_010484183.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 ref|XP_010457533.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 gb|EOA37088.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 gb|ESQ36450.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|NP_171967.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 sp|Q9ZTW3.1|VA721_ARATH RecName: Full=Vesicle-associated membrane protein 721; Short=AtVAMP721; 
AltName: Full=v-SNARE synaptobrevin 7B; Short=AtVAMP7B 
[Arabidopsis thaliana]
 gb|AAC98905.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 gb|AAL85003.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 gb|AAM91491.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 dbj|BAD42978.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43361.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43374.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43437.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43557.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43592.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43735.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43994.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44048.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44054.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44149.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44415.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44419.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44642.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27738.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_002892239.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68498.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_009787803.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
sylvestris]
Length=220

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVL IIIALIL+IVLS+CHGF C
Sbjct  187  MWLQNMKVKLIVLAIIIALILVIVLSICHGFKC  219



>dbj|BAD43410.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
Length=219

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGSQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_010556949.1| PREDICTED: vesicle-associated membrane protein 721 [Tarenaya 
hassleriana]
Length=220

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_010475139.1| PREDICTED: vesicle-associated membrane protein 721-like [Camelina 
sativa]
Length=219

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_004134008.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004157674.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN56755.1| hypothetical protein Csa_3G132570 [Cucumis sativus]
Length=219

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGIIVALILIIILSVCHGFQC  219



>ref|XP_006657530.1| PREDICTED: vesicle-associated membrane protein 725-like [Oryza 
brachyantha]
Length=220

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EITKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|AAB80624.1| Strong similarity to Arabidopsis ATHSAR1 (gb|M90418). ESTs gb|T44122,gb|N65276,gb|AA041135 
come from this gene [Arabidopsis 
thaliana]
Length=175

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  83   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRK  142

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  143  MWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  175



>ref|XP_008438380.1| PREDICTED: putative vesicle-associated membrane protein 726 [Cucumis 
melo]
Length=219

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_010542985.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLGKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|NP_001051606.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|AAO72389.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 gb|ABF99408.1| Vesicle-associated membrane protein 724, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13520.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|EEC76360.1| hypothetical protein OsI_13946 [Oryza sativa Indica Group]
 gb|EEE60123.1| hypothetical protein OsJ_13000 [Oryza sativa Japonica Group]
Length=220

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGTQVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|KDP26403.1| hypothetical protein JCGZ_17561 [Jatropha curcas]
Length=219

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_004981381.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=220

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|ACU18382.1| unknown [Glycine max]
Length=171

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN    AQDF   G KIR K
Sbjct  77   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSHAQDFTQQGTKIRRK  136

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  137  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  171



>gb|KJB42280.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=217

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDK+EN   QAQDFR  G ++R K
Sbjct  125  EVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGTQMRRK  184

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IAL+LIIVLSVCHGFNC
Sbjct  185  MWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  217



>ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006420621.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006489783.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Citrus sinensis]
 gb|ESR33860.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|ESR33861.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|KDO49379.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
 gb|KDO49380.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
Length=219

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_002518125.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF44258.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=219

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  187  MWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_002267063.1| PREDICTED: vesicle-associated membrane protein 722 [Vitis vinifera]
 emb|CBI37278.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLS+C GFNC
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSICGGFNC  219



>ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
 gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
Length=219

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>gb|KJB42279.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=219

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDK+EN   QAQDFR  G ++R K
Sbjct  127  EVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IAL+LIIVLSVCHGFNC
Sbjct  187  MWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  219



>ref|XP_009627066.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
tomentosiformis]
 ref|XP_009777065.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
sylvestris]
Length=220

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G  +R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTTMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVC GFNC
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>gb|ABK22119.1| unknown [Picea sitchensis]
 gb|ABK25940.1| unknown [Picea sitchensis]
Length=222

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRFQAQDFQKQGTQLRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMK+KLIVLGI++ALILIIVLSVCHGFNC K
Sbjct  187  MWFQNMKVKLIVLGIVVALILIIVLSVCHGFNCSK  221



>ref|XP_010934067.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=219

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009418833.1| PREDICTED: vesicle-associated membrane protein 721 [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGIIIAL+LIIVLSVCHGF C
Sbjct  187  MWLQNMKVKLIVLGIIIALVLIIVLSVCHGFKC  219



>ref|XP_008644423.1| PREDICTED: vesicle-associated membrane protein 721-like [Zea 
mays]
 ref|XP_008644424.1| PREDICTED: vesicle-associated membrane protein 721-like [Zea 
mays]
 gb|AFW67311.1| putative vesicle-associated membrane protein family protein [Zea 
mays]
Length=220

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|NP_001149329.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACF83939.1| unknown [Zea mays]
 gb|ACG35049.1| vesicle-associated membrane protein 725 [Zea mays]
 tpg|DAA51998.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=220

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G  +R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_008235502.1| PREDICTED: vesicle-associated membrane protein 722 [Prunus mume]
Length=219

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC GFNC
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCKGFNC  219



>ref|XP_009408466.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EIS+LAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+ H QAQDFR  G ++R K
Sbjct  127  EISRLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTESLHSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVL IIIALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIILSVCHGFKC  219



>gb|KCW57284.1| hypothetical protein EUGRSUZ_H00084 [Eucalyptus grandis]
Length=378

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  G KIR K
Sbjct  286  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGTKIRRK  345

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  346  MWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  378



>ref|XP_011080177.1| PREDICTED: vesicle-associated membrane protein 721 [Sesamum indicum]
Length=220

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_008808719.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=219

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R +
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRR  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_004152023.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004169386.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN58350.1| hypothetical protein Csa_3G625650 [Cucumis sativus]
Length=219

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMK+KLIVL II+ALILII+LSVC GFNC
Sbjct  187  MWYQNMKMKLIVLAIILALILIIILSVCGGFNC  219



>ref|XP_010932918.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=220

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_004492323.1| PREDICTED: vesicle-associated membrane protein 725-like [Cicer 
arietinum]
Length=221

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGII+A+ILIIVLS+C GFNC K
Sbjct  187  MWFQNMKIKLIVLGIIVAIILIIVLSICGGFNCTK  221



>ref|XP_008465086.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=219

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVL I++ALILII+LSVC GFNC
Sbjct  187  MWYQNMKIKLIVLAIVLALILIIILSVCGGFNC  219



>gb|AAA56991.1| formerly called HAT24; synaptobrevin-related protein [Arabidopsis 
thaliana]
Length=221

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>gb|KJB22568.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=220

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK+AKVKAQVSEVKGVMMENIEKV DRGE+IEL VD+TEN   QAQDFR  G ++R K
Sbjct  127  EISKIAKVKAQVSEVKGVMMENIEKVLDRGERIELLVDRTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI++ALILIIVLSVCHGF C
Sbjct  187  MWLQNMKVKLIVLGILVALILIIVLSVCHGFKC  219



>ref|XP_008775432.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=220

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKA+VSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAEVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQHGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|NP_180871.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 sp|P47192.2|VA722_ARATH RecName: Full=Vesicle-associated membrane protein 722; Short=AtVAMP722; 
AltName: Full=Synaptobrevin-related protein 1 [Arabidopsis 
thaliana]
 gb|AAL31896.1|AF419564_1 At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAC04921.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL62414.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL79587.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAM48025.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM64431.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM91096.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AEC08787.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=221

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>ref|XP_011083121.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=220

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R +
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRR  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVL II+ALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLAIIVALILIIVLSVCGGFKC  219



>ref|NP_001031469.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 dbj|BAH20114.1| AT2G33120 [Arabidopsis thaliana]
 gb|AEC08788.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=229

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  135  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  194

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  195  MWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  229



>gb|ACJ84389.1| unknown [Medicago truncatula]
Length=197

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  129  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  188

Query  281  MWLQNM  264
            MWLQNM
Sbjct  189  MWLQNM  194



>ref|XP_008803805.1| PREDICTED: putative vesicle-associated membrane protein 726 [Phoenix 
dactylifera]
Length=220

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EIS LAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISNLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009417150.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGIIIALILIIVLS+CHGF C
Sbjct  187  MWLQNMKVKLIVLGIIIALILIIVLSICHGFKC  219



>ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
 gb|EEE82621.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
Length=219

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVLGIIIALILIIVLS+CHGFNC
Sbjct  187  MWIQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>ref|XP_009336053.1| PREDICTED: vesicle-associated membrane protein 722, partial [Pyrus 
x bretschneideri]
Length=182

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  90   EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  149

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI+IALILIIVLSVC+GF C
Sbjct  150  MWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  182



>ref|XP_010109710.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXC24180.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=219

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLA VKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLANVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+ ALILIIVLSVC GFNC
Sbjct  187  MWLQNMKIKLIVLGILFALILIIVLSVCGGFNC  219



>ref|XP_002466264.1| hypothetical protein SORBIDRAFT_01g004700 [Sorghum bicolor]
 gb|EER93262.1| hypothetical protein SORBIDRAFT_01g004700 [Sorghum bicolor]
Length=220

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ+FR  G  +R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQNFRQQGTNVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLI LGIIIALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIGLGIIIALILIIILSVCHGFKC  219



>ref|XP_010241141.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nelumbo 
nucifera]
Length=219

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K++ K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKLKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGI +AL+LIIVLS+CHGFNC
Sbjct  187  MWWENMKIKLIVLGIFVALVLIIVLSICHGFNC  219



>ref|XP_010674670.1| PREDICTED: vesicle-associated membrane protein 722 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E++KLAKV+AQ+SEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EMNKLAKVQAQISEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLS+CHGFNCGK
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSICHGFNCGK  221



>ref|NP_001280954.1| putative vesicle-associated membrane protein 726 [Malus domestica]
 gb|AGG35508.1| vesicle-associated membrance protein [Malus domestica]
Length=219

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI+IALILIIVLSVC+GF C
Sbjct  187  MWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_004247095.1| PREDICTED: vesicle-associated membrane protein 722 [Solanum lycopersicum]
Length=220

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G  +R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTTMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Erythranthe guttata]
Length=219

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK+AKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKIAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKL V GI +AL L++ LS+CHGF C
Sbjct  187  MWVQNMKIKLAVFGIFVALGLVVFLSICHGFKC  219



>ref|XP_007200442.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
 gb|EMJ01641.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
Length=219

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_010556950.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSICHGFKC  219



>gb|KFK31144.1| hypothetical protein AALP_AA6G074500 [Arabis alpina]
Length=220

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  127  EINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGI+IALILII+LSVCHGF C
Sbjct  187  MWFENMKIKLIVLGIVIALILIIILSVCHGFKC  219



>ref|XP_003607843.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|ACJ83853.1| unknown [Medicago truncatula]
 gb|AES90040.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  129  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  188

Query  281  MWLQNM  264
            MWLQNM
Sbjct  189  MWLQNM  194



>gb|AFK40215.1| unknown [Medicago truncatula]
Length=220

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  129  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  188

Query  281  MWLQNM  264
            MWLQNM
Sbjct  189  MWLQNM  194



>gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea]
Length=220

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRMQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_009398406.1| PREDICTED: putative vesicle-associated membrane protein 726 [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWMKNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|ADK78986.1| VAMP721 [Petunia integrifolia subsp. inflata]
Length=220

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GFNC
Sbjct  187  LWYENMKIKLIVLGIIIALILIIILSVCPGFNC  219



>ref|XP_006364264.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=220

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G  +R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRLQAQDFRTQGTTMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_006418096.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
 gb|ESQ36449.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
Length=220

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ FR+ G K+R K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQAFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWL NMKIKL+V GII+ALILII LSVCHGF C
Sbjct  187  MWLDNMKIKLVVFGIIVALILIIFLSVCHGFKC  219



>ref|XP_003594451.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES64702.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N H QAQDFRS G  IR K
Sbjct  131  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFRSSGTSIRRK  190

Query  281  MWLQNM  264
            MWLQNM
Sbjct  191  MWLQNM  196



>ref|XP_009132860.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDX84731.1| BnaA03g14990D [Brassica napus]
Length=220

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ G KIR K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GIIIALILII+LSVCHGF C
Sbjct  187  MWFENMKIKLIVAGIIIALILIIILSVCHGFKC  219



>emb|CDY59642.1| BnaAnng16140D [Brassica napus]
Length=178

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  85   EINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  144

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  145  MWWENMKIKLIVLGIIIALILIIILSVCHGFKC  177



>emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera]
Length=200

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  108  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  167

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  168  MWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  200



>ref|XP_002264270.1| PREDICTED: vesicle-associated membrane protein 721 [Vitis vinifera]
 emb|CBI40837.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  128  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  188  MWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  220



>gb|EYU46345.1| hypothetical protein MIMGU_mgv1a013442mg [Erythranthe guttata]
Length=220

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII+ALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGIIVALILIIVLSVCGGFKC  219



>ref|XP_004505324.1| PREDICTED: vesicle-associated membrane protein 722-like [Cicer 
arietinum]
Length=222

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G KIR K
Sbjct  131  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRK  190

Query  281  MWLQNM  264
            MW+QNM
Sbjct  191  MWMQNM  196



>ref|XP_003636885.1| Vesicle-associated membrane protein [Medicago truncatula]
Length=115

 Score =   114 bits (284),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  21   EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMKRK  80

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLI +GII  ++L+I +S+C GF+C
Sbjct  81   MWIQNMKIKLIAVGIIFVIVLMIFMSICRGFSC  113



>gb|AAC04496.1| putative synaptobrevin [Arabidopsis thaliana]
Length=220

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGIII LILII+LSVC GF C
Sbjct  187  MWFENMKIKLIVLGIIITLILIIILSVCGGFKC  219



>ref|XP_003604990.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES87187.1| synaptobrevin-like protein [Medicago truncatula]
 gb|AFK36407.1| unknown [Medicago truncatula]
Length=219

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENI+KV DRGEKIE+ VDKTEN   QAQDFR  G ++R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIDKVIDRGEKIEVLVDKTENLRSQAQDFRQQGTQLRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVL IIIALILIIVLSVCHGF+C
Sbjct  187  MWYQNMKIKLIVLAIIIALILIIVLSVCHGFSC  219



>ref|XP_009371395.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009371400.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=219

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>emb|CDX79466.1| BnaC03g18020D [Brassica napus]
Length=176

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KL KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ G KIR K
Sbjct  83   EINKLVKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKIRRK  142

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GIIIALILII+LSVCHGF C
Sbjct  143  MWFENMKIKLIVAGIIIALILIIILSVCHGFKC  175



>ref|XP_009143949.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDY12188.1| BnaC04g12180D [Brassica napus]
Length=220

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  127  EINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  187  MWWENMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_002521112.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF41263.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=220

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>gb|KJB71677.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71678.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71679.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
Length=219

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KI+ K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMK+KLIV GI++AL+LIIVLS+C GF C
Sbjct  187  MWIENMKMKLIVFGIVLALVLIIVLSICPGFKC  219



>ref|XP_004290222.1| PREDICTED: vesicle-associated membrane protein 722 [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  187  MWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_010314763.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=183

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  G KIR K
Sbjct  89   EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIRRK  148

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  149  MWYENMKIKLVVFAIILVLILIIILSVCPGFKC  181



>ref|XP_007049803.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
 gb|EOX93960.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
Length=219

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILII+LSVC GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIILSVCGGFKC  219



>ref|XP_009608699.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVL III +ILII+LSVC GF C
Sbjct  187  MWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>ref|XP_010228179.1| PREDICTED: vesicle-associated membrane protein 721-like [Brachypodium 
distachyon]
Length=220

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKV+AQVSEVK VMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EINKLAKVQAQVSEVKNVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQVRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  187  MWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  219



>ref|XP_009757440.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVL III +ILII+LSVC GF C
Sbjct  187  MWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>ref|XP_009335952.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
Length=220

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  187  MWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_010910152.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=220

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI KLAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EIGKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGI+IALILII+LSVCHGF C
Sbjct  187  MWWQNMKIKLIVLGILIALILIIILSVCHGFKC  219



>ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 ref|XP_006479311.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR56868.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 gb|KDO65900.1| hypothetical protein CISIN_1g027720mg [Citrus sinensis]
Length=219

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VD+TEN   QAQDFR  G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMDNIEKVLDRGEKIELLVDRTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGIIIALILIIVLSVC GFNC
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>ref|XP_009335953.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=220

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  187  MWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_009370116.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  187  MWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_003535217.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
 gb|KHN16316.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKVKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMK+KLIV GI +ALILI+ +S+C GF+C
Sbjct  187  MWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>ref|XP_009351028.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  187  MWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>gb|KFK31080.1| hypothetical protein AALP_AA6G065800 [Arabis alpina]
Length=221

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW +NMKIKLIVL IIIALILIIVLSVC GF C K
Sbjct  187  MWFKNMKIKLIVLAIIIALILIIVLSVCGGFKCTK  221



>ref|XP_010326818.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X3 [Solanum lycopersicum]
Length=183

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  89   EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  148

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  149  LWYENMKIKLIVLGIIIALILIIILSVCPGFKC  181



>emb|CDO99425.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAK+KAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K++ K
Sbjct  89   EINKLAKIKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMKRK  148

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIV GII+A++LII+LSVC GF C
Sbjct  149  MWVQNMKIKLIVAGIILAILLIIILSVCPGFKC  181



>emb|CDP03855.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLSVC G  C
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSVCGGVKC  219



>ref|NP_180826.2| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
 sp|O48850.2|VA725_ARATH RecName: Full=Vesicle-associated membrane protein 725; Short=AtVAMP725 
[Arabidopsis thaliana]
 dbj|BAC42934.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAP06822.1| putative synaptobrevin protein [Arabidopsis thaliana]
 gb|AEC08714.1| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
Length=285

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  192  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  251

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIVLGIII LILII+LSVC GF C
Sbjct  252  MWFENMKIKLIVLGIIITLILIIILSVCGGFKC  284



>ref|XP_008372458.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
Length=219

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  187  MWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_006293513.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
 gb|EOA26411.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
Length=220

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GI++ALILII+LSVCHGF C
Sbjct  187  MWFENMKIKLIVFGIVVALILIIILSVCHGFKC  219



>ref|XP_002889523.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65782.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIV GII+ALILII+LSVCHGF C
Sbjct  187  LWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|NP_171968.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
 sp|Q9MAS5.2|VA726_ARATH RecName: Full=Putative vesicle-associated membrane protein 726; 
Short=AtVAMP726 [Arabidopsis thaliana]
 gb|AEE27740.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
Length=220

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIV GII+ALILII+LSVCHGF C
Sbjct  187  LWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|XP_004253005.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=221

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  G KIR K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  187  MWYENMKIKLVVFAIILVLILIIILSVCPGFKC  219



>ref|XP_010547078.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X2 [Tarenaya hassleriana]
Length=227

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  G K+R  
Sbjct  135  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLRRN  194

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  195  MWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  227



>ref|XP_003622969.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES79187.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EISKLSKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGTKLRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVLGIIIALILIIVLS+C GFNC K
Sbjct  187  MWFQNMKIKLIVLGIIIALILIIVLSICGGFNCSK  221



>ref|XP_010524695.1| PREDICTED: putative vesicle-associated membrane protein 726 [Tarenaya 
hassleriana]
Length=219

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  G K+R  
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLRRN  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_010684935.1| PREDICTED: vesicle-associated membrane protein 722-like [Beta 
vulgaris subsp. vulgaris]
Length=221

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V+ II+ALI+I++LS+C GF C
Sbjct  187  MWWENMKIKLVVIAIIVALIIILILSICGGFKC  219



>ref|XP_010264069.1| PREDICTED: vesicle-associated membrane protein 722 [Nelumbo nucifera]
Length=219

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+ KLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G K+R K
Sbjct  127  EVGKLAKVKAQVSEVKEVMMENIEKVLDRGEKIELLVDKTENLKSQAQDFRQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGIIIALILIIVLS+CHGFNC
Sbjct  187  MWLQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>ref|XP_010547077.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Tarenaya hassleriana]
Length=219

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  G K+R  
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTKLRRN  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  187  MWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_007226125.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
 gb|EMJ27324.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
Length=220

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIV+GIII +  +I LS+CHGF C
Sbjct  187  MWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>ref|XP_003556884.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
Length=221

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKVKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMK+KLIV GI +ALILI+ +S+C GF+C
Sbjct  187  MWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>ref|XP_008224587.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=220

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIV+GIII +  +I LS+CHGF C
Sbjct  187  MWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>gb|KFK42811.1| hypothetical protein AALP_AA1G041700 [Arabis alpina]
Length=220

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWL NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  187  MWLDNMKIKLVVFGIVVALILIIILSVCHGFKC  219



>gb|KEH41273.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLI +GII  ++L+I +S+C GF+C
Sbjct  187  MWIQNMKIKLIAVGIIFVIVLMIFMSICRGFSC  219



>ref|XP_009621355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF+C
Sbjct  187  LWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>gb|EPS61521.1| hypothetical protein M569_13274 [Genlisea aurea]
Length=220

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK++KVKAQVSEVKGVMMENIEKV DRGEKIEL VD+TEN   QAQDFR  G  +R K
Sbjct  127  EISKISKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDRTENLRSQAQDFRMQGTSMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMKIKL VLG I+A ILI+VLSVC GF C
Sbjct  187  MWLQNMKIKLFVLGFIVAFILILVLSVCGGFKC  219



>ref|XP_004247839.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=221

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  187  LWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55665.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K+R K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRAQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW  NMKIKLIVLGIII LILII+LSVC G+ C
Sbjct  187  MWFDNMKIKLIVLGIIITLILIIILSVCGGYKC  219



>ref|XP_009767969.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGIKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF+C
Sbjct  187  LWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>ref|XP_010326817.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=232

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  138  EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  197

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  198  LWYENMKIKLIVLGIIIALILIIILSVCPGFKC  230



>ref|XP_006360344.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=221

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  187  LWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>ref|XP_006857408.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
 gb|ERN18875.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
Length=217

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFRS G K+R K
Sbjct  127  EMSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRSQGTKMRRK  186

Query  281  MWLQNM  264
            MWLQNM
Sbjct  187  MWLQNM  192



>ref|XP_011016158.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRG KIEL VDKT+N H QAQDFR  G +IR K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGVKIELLVDKTDNLHSQAQDFRQHGTQIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVL I+IALI+IIVLS+C GF C
Sbjct  187  MWWQNMKIKLIVLAILIALIIIIVLSICGGFKC  219



>ref|XP_010413912.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X1 [Camelina sativa]
Length=221

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DR   IE+ VDKTEN   QAQDF++ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>gb|KJB10140.1| hypothetical protein B456_001G186000 [Gossypium raimondii]
Length=219

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISK+AKVKAQVSEVKGVMMENIEKV DRG KIE+ VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKIAKVKAQVSEVKGVMMENIEKVLDRGGKIEILVDKTENLRSQAQDFRQQGTRMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MWLQNMK+KLIVLGI+IALILIIVLS+C GF+C
Sbjct  187  MWLQNMKVKLIVLGILIALILIIVLSICGGFHC  219



>gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlisea aurea]
Length=219

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G +++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGTRMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMKIKLIV GI +AL L++ LSVCHGF C
Sbjct  187  MWVKNMKIKLIVFGIFVALALVVFLSVCHGFKC  219



>ref|XP_008380599.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
 ref|XP_009376355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMK+KLIV+GI+I + L+I L++C GF C
Sbjct  187  MWFQNMKMKLIVVGILILIALMIYLTICRGFKC  219



>gb|AFK36461.1| unknown [Lotus japonicus]
Length=226

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+ G  IR K
Sbjct  134  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRTSGTSIRRK  193

Query  281  MWLQNM  264
            M LQNM
Sbjct  194  MRLQNM  199



>ref|XP_010413913.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Camelina sativa]
Length=221

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DR   IE+ VDKTEN   QAQDF++ G ++R K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            MW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  187  MWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_004296647.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDF+  G K+R K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFKQQGTKMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMK+KLIV GI++AL LI+ LS+C GF C
Sbjct  187  MWFQNMKMKLIVAGIVVALGLILFLSICGGFKC  219



>ref|XP_010469563.1| PREDICTED: vesicle-associated membrane protein 725-like [Camelina 
sativa]
Length=220

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ G K++ K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKLKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW  NMKIKLIV GII+AL+LII+LSVC GF C
Sbjct  187  MWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_010413966.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=220

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ G K++ K
Sbjct  127  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKLKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW  NMKIKLIV GII+AL+LII+LSVC GF C
Sbjct  187  MWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_006306317.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
 gb|EOA39215.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
Length=220

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKLIV GI++ALILIIVLSVC GF C
Sbjct  187  LWFENMKIKLIVFGIVVALILIIVLSVCPGFKC  219



>ref|XP_004514024.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X1 [Cicer arietinum]
Length=221

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMKIKLI  GII+A+IL+I +S+C GF+C
Sbjct  187  MWIENMKIKLIAFGIILAIILMIFMSLCRGFSC  219



>gb|KJB22567.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=226

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 83/99 (84%), Gaps = 6/99 (6%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEK------VXDRGEKIELXVDKTENFHQQAQDFRSXG  300
            EISK+AKVKAQVSEVKGVMMENIEK      V DRGE+IEL VD+TEN   QAQDFR  G
Sbjct  127  EISKIAKVKAQVSEVKGVMMENIEKLTNFFQVLDRGERIELLVDRTENLRSQAQDFRQQG  186

Query  299  XKIRXKMWLQNMkiklivlgiiialiliivLSVCHGFNC  183
             ++R KMWLQNMK+KLIVLGI++ALILIIVLSVCHGF C
Sbjct  187  TQMRRKMWLQNMKVKLIVLGILVALILIIVLSVCHGFKC  225



>ref|XP_004514025.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X2 [Cicer arietinum]
Length=215

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  121  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKMKRK  180

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMKIKLI  GII+A+IL+I +S+C GF+C
Sbjct  181  MWIENMKIKLIAFGIILAIILMIFMSLCRGFSC  213



>ref|XP_010069661.1| PREDICTED: vesicle-associated membrane protein 722 [Eucalyptus 
grandis]
 gb|KCW58076.1| hypothetical protein EUGRSUZ_H00803 [Eucalyptus grandis]
Length=220

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G +IR K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQIRRK  186

Query  281  MWLQNM  264
            MWLQNM
Sbjct  187  MWLQNM  192



>ref|XP_006349937.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X2 [Solanum tuberosum]
Length=183

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  G KIR K
Sbjct  89   EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIRRK  148

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  149  MWYENMKIKLVVFSIILVLILIIILSVCPGFKC  181



>ref|XP_007145403.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
 gb|ESW17397.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
Length=221

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ G K++ K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGTKVKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW+QNMKIKLIV GI++AL LI+ +S+C G +C
Sbjct  187  MWVQNMKIKLIVFGIVVALFLIMFMSICRGISC  219



>gb|EEC81677.1| hypothetical protein OsI_25239 [Oryza sativa Indica Group]
 gb|EEE66734.1| hypothetical protein OsJ_23425 [Oryza sativa Japonica Group]
Length=249

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 83/109 (76%), Gaps = 16/109 (15%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQ--------------  324
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   Q              
Sbjct  140  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQKYRIMVPKVIWLTV  199

Query  323  --AQDFRSXGXKIRXKMWLQNMkiklivlgiiialiliivLSVCHGFNC  183
              AQDFR  G K+R KMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  200  DMAQDFRQQGTKVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  248



>emb|CDY19154.1| BnaA04g18940D [Brassica napus]
Length=220

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ G KIR K
Sbjct  127  EINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GII ALILII++SVC GF C
Sbjct  187  MWWENMKIKLIVAGIITALILIIIISVCPGFKC  219



>ref|XP_010475140.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  187  LWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_010457534.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            +W +NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  187  LWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>gb|EYU17981.1| hypothetical protein MIMGU_mgv1a013452mg [Erythranthe guttata]
Length=220

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R K
Sbjct  127  EVSKMAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVLGII+ALILII+LS+C GF C
Sbjct  187  MWFQNMKIKLIVLGIIVALILIIILSICGGFKC  219



>ref|XP_006349936.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Solanum tuberosum]
Length=221

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  G KIR K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  187  MWYENMKIKLVVFSIILVLILIIILSVCPGFKC  219



>gb|AAQ15287.1| synptobrevin-related protein [Pyrus pyrifolia]
Length=194

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  G ++R K
Sbjct  127  EISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTQMRRK  186

Query  281  MWLQNM  264
            MWLQNM
Sbjct  187  MWLQNM  192



>ref|XP_009141263.1| PREDICTED: vesicle-associated membrane protein 725-like [Brassica 
rapa]
Length=220

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ G KIR K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GIIIALILII++SVC GF C
Sbjct  187  MWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>emb|CDY48531.1| BnaC04g43180D [Brassica napus]
Length=220

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ G KIR K
Sbjct  127  EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIRRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKLIV GIIIALILII++SVC GF C
Sbjct  187  MWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>ref|XP_006410397.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
 gb|ESQ51850.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
Length=248

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G KIR K
Sbjct  176  EISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRK  235

Query  281  MWLQNM  264
            MW +NM
Sbjct  236  MWFENM  241



>ref|NP_001189664.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 gb|AEC08789.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=139

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  458  ISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXKM  279
            IS    VKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ G ++R KM
Sbjct  46   ISTRDMVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKM  105

Query  278  WLQNMkiklivlgiiialiliivLSVCHGFNCGK  177
            W QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  106  WFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  139



>ref|XP_011073775.1| PREDICTED: putative vesicle-associated membrane protein 726 [Sesamum 
indicum]
Length=219

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EIS+LAKVKAQVSEVKGVM+ENIEKV DRGEKIEL VDKTEN   QAQDFR+ G K++ K
Sbjct  127  EISQLAKVKAQVSEVKGVMLENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKLKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMKIKL+V  I   LILIIVLS+C  F C
Sbjct  187  MWYENMKIKLVVFAIFFVLILIIVLSICPRFKC  219



>gb|EAZ25708.1| hypothetical protein OsJ_09541 [Oryza sativa Japonica Group]
Length=183

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  G KIR K
Sbjct  90   EIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRKAGTKIRRK  149

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMK+KLIV GI++ALIL+I+L+VC   NC
Sbjct  150  MWWENMKMKLIVFGIVVALILVIILTVCRDLNC  182



>gb|KJB33092.1| hypothetical protein B456_006G056000 [Gossypium raimondii]
Length=219

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  G KI+ K
Sbjct  127  EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQQGTKIKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW++NMK+KLIV GI+  +I++I++SVC   NC
Sbjct  187  MWIENMKMKLIVFGIVAVIIIVIIISVCRNLNC  219



>ref|XP_002303031.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
 gb|EEE82304.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
Length=219

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            E+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ FR  G +I+ K
Sbjct  127  EVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQVFRQQGGQIKRK  186

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW QNMKIKLIVL I+I LILIIVLS+C GF C
Sbjct  187  MWWQNMKIKLIVLAILIVLILIIVLSICGGFKC  219



>ref|XP_004985586.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X2 [Setaria italica]
Length=220

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  G KIR K
Sbjct  128  EIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGTKIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMK+KLIV GI++ALIL+IVL+VC  FNC
Sbjct  188  MWWENMKMKLIVFGIVVALILLIVLTVCKDFNC  220



>ref|XP_006649451.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Oryza brachyantha]
Length=223

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  G KIR K
Sbjct  130  EIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGTKIRRK  189

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMK+KLIV GI++ALIL+IVL++C  FNC
Sbjct  190  MWWENMKMKLIVFGIVVALILLIVLTICRDFNC  222



>emb|CDY19156.1| BnaA04g18960D [Brassica napus]
Length=144

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ G KIR K
Sbjct  50   EINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGTKIRRK  109

Query  281  MWLQNMkiklivl-giiialiliivLSVCHGFNC  183
            MW +NMKIKLIV+   I  +++II++SVC GF C
Sbjct  110  MWWENMKIKLIVVGITIALILIIIIISVCPGFKC  143



>ref|XP_004985585.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X1 [Setaria italica]
Length=221

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENFHQQAQDFRSXGXKIRXK  282
            EI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  G KIR K
Sbjct  128  EIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGTKIRRK  187

Query  281  MWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            MW +NMK+KLIV GI++ALIL+IVL+VC  FNC
Sbjct  188  MWWENMKMKLIVFGIVVALILLIVLTVCKDFNC  220



>gb|EMT18448.1| Putative vesicle-associated membrane protein 726 [Aegilops tauschii]
Length=249

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 85/122 (70%), Gaps = 27/122 (22%)
 Frame = -2

Query  461  EISKLAKVKAQVSEVKGVMMENIEKV---------------------------XDRGEKI  363
            EI+KLAKV+AQVSEVK VMMENIEKV                            DRGEKI
Sbjct  127  EINKLAKVQAQVSEVKNVMMENIEKVHLCTLQIHRRYNLEEVSDPYSTSEIQVLDRGEKI  186

Query  362  ELXVDKTENFHQQAQDFRSXGXKIRXKMWLQNMkiklivlgiiialiliivLSVCHGFNC  183
            EL VDKTEN   QAQDFR  G ++R KMWLQNMKIKLIVLGII+ALILII+LSVCHGFNC
Sbjct  187  ELLVDKTENLRSQAQDFRQQGTQVRRKMWLQNMKIKLIVLGIIVALILIIILSVCHGFNC  246

Query  182  GK  177
            GK
Sbjct  247  GK  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535