BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014G07

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007024899.1|  Vesicle-associated membrane protein 726 isof...    264   2e-85   Theobroma cacao [chocolate]
ref|XP_007147528.1|  hypothetical protein PHAVU_006G132100g             263   4e-85   Phaseolus vulgaris [French bean]
ref|XP_008225792.1|  PREDICTED: vesicle-associated membrane prote...    263   7e-85   Prunus mume [ume]
ref|XP_007212008.1|  hypothetical protein PRUPE_ppa011167mg             263   7e-85   Prunus persica
ref|XP_006448759.1|  hypothetical protein CICLE_v10016613mg             262   8e-85   Citrus clementina [clementine]
ref|XP_010242074.1|  PREDICTED: vesicle-associated membrane prote...    261   3e-84   Nelumbo nucifera [Indian lotus]
ref|XP_011096786.1|  PREDICTED: vesicle-associated membrane prote...    261   3e-84   Sesamum indicum [beniseed]
ref|XP_009802587.1|  PREDICTED: vesicle-associated membrane prote...    261   3e-84   Nicotiana sylvestris
ref|XP_009618936.1|  PREDICTED: vesicle-associated membrane prote...    261   3e-84   Nicotiana tomentosiformis
gb|KJB69905.1|  hypothetical protein B456_011G049200                    261   4e-84   Gossypium raimondii
ref|XP_009604671.1|  PREDICTED: vesicle-associated membrane prote...    260   9e-84   Nicotiana tomentosiformis
emb|CDP18918.1|  unnamed protein product                                260   9e-84   Coffea canephora [robusta coffee]
ref|XP_002530145.1|  Vesicle-associated membrane protein, putative      259   1e-83   Ricinus communis
ref|XP_003535044.1|  PREDICTED: vesicle-associated membrane prote...    259   1e-83   
ref|XP_010092659.1|  Putative vesicle-associated membrane protein...    259   2e-83   Morus notabilis
gb|KHN14368.1|  Putative vesicle-associated membrane protein 726        258   6e-83   Glycine soja [wild soybean]
ref|XP_008383321.1|  PREDICTED: vesicle-associated membrane prote...    258   7e-83   Malus domestica [apple tree]
ref|XP_006377004.1|  hypothetical protein POPTR_0012s12000g             257   7e-83   Populus trichocarpa [western balsam poplar]
ref|XP_004233223.1|  PREDICTED: vesicle-associated membrane prote...    257   7e-83   
ref|NP_001236634.1|  uncharacterized protein LOC100500089               257   1e-82   
ref|XP_011016724.1|  PREDICTED: vesicle-associated membrane prote...    257   1e-82   Populus euphratica
gb|EYU43691.1|  hypothetical protein MIMGU_mgv1a013245mg                257   1e-82   Erythranthe guttata [common monkey flower]
gb|KJB57019.1|  hypothetical protein B456_009G150900                    256   3e-82   Gossypium raimondii
gb|AFY26886.1|  vesicle-associated membrane protein 72                  256   3e-82   Morella rubra [Chinese arbutus]
ref|XP_002322360.1|  hypothetical protein POPTR_0015s15690g             255   6e-82   Populus trichocarpa [western balsam poplar]
gb|KDP29315.1|  hypothetical protein JCGZ_19410                         254   8e-82   Jatropha curcas
gb|KJB57020.1|  hypothetical protein B456_009G150900                    253   9e-82   Gossypium raimondii
gb|ACU19359.1|  unknown                                                 254   1e-81   Glycine max [soybeans]
ref|XP_002276767.1|  PREDICTED: putative vesicle-associated membr...    254   1e-81   Vitis vinifera
ref|XP_008459063.1|  PREDICTED: vesicle-associated membrane prote...    254   2e-81   Cucumis melo [Oriental melon]
ref|XP_011040378.1|  PREDICTED: vesicle-associated membrane prote...    253   3e-81   Populus euphratica
ref|XP_004145455.1|  PREDICTED: putative vesicle-associated membr...    252   1e-80   Cucumis sativus [cucumbers]
gb|KHN08022.1|  Putative vesicle-associated membrane protein 726        250   8e-80   Glycine soja [wild soybean]
ref|XP_006352702.1|  PREDICTED: putative vesicle-associated membr...    248   4e-79   Solanum tuberosum [potatoes]
ref|XP_006583934.1|  PREDICTED: vesicle-associated membrane prote...    246   2e-78   Glycine max [soybeans]
ref|XP_004242395.1|  PREDICTED: vesicle-associated membrane prote...    246   3e-78   
ref|XP_009588661.1|  PREDICTED: vesicle-associated membrane prote...    244   8e-78   Nicotiana tomentosiformis
ref|XP_010069066.1|  PREDICTED: putative vesicle-associated membr...    244   1e-77   Eucalyptus grandis [rose gum]
emb|CDY10053.1|  BnaC08g43980D                                          244   2e-77   Brassica napus [oilseed rape]
ref|XP_003594451.1|  Vesicle-associated membrane protein                243   2e-77   
ref|XP_011020669.1|  PREDICTED: vesicle-associated membrane prote...    243   4e-77   Populus euphratica
gb|ACJ84389.1|  unknown                                                 241   8e-77   Medicago truncatula
ref|XP_010522416.1|  PREDICTED: vesicle-associated membrane prote...    242   8e-77   Tarenaya hassleriana [spider flower]
ref|XP_004505324.1|  PREDICTED: vesicle-associated membrane prote...    242   1e-76   
emb|CDY18254.1|  BnaC05g02770D                                          241   1e-76   Brassica napus [oilseed rape]
ref|XP_009413307.1|  PREDICTED: vesicle-associated membrane prote...    241   1e-76   
ref|XP_010522412.1|  PREDICTED: vesicle-associated membrane prote...    241   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_003607843.1|  Vesicle-associated membrane protein                241   1e-76   
gb|AFK40215.1|  unknown                                                 241   1e-76   Medicago truncatula
ref|XP_009119258.1|  PREDICTED: vesicle-associated membrane prote...    241   1e-76   Brassica rapa
ref|XP_009787803.1|  PREDICTED: vesicle-associated membrane prote...    241   1e-76   Nicotiana sylvestris
gb|AFK36461.1|  unknown                                                 241   2e-76   Lotus japonicus
emb|CDX86608.1|  BnaC08g00950D                                          241   2e-76   
ref|XP_010038359.1|  PREDICTED: vesicle-associated membrane prote...    241   2e-76   Eucalyptus grandis [rose gum]
gb|KDP26403.1|  hypothetical protein JCGZ_17561                         241   2e-76   Jatropha curcas
emb|CDY19450.1|  BnaC04g11490D                                          240   3e-76   Brassica napus [oilseed rape]
ref|XP_010556949.1|  PREDICTED: vesicle-associated membrane prote...    240   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_006304190.1|  hypothetical protein CARUB_v10010251mg             240   4e-76   Capsella rubella
ref|XP_002892239.1|  vesicle-associated membrane protein 7B             240   4e-76   Arabidopsis lyrata subsp. lyrata
ref|XP_010475139.1|  PREDICTED: vesicle-associated membrane prote...    240   4e-76   Camelina sativa [gold-of-pleasure]
gb|KFK42812.1|  hypothetical protein AALP_AA1G041800                    240   4e-76   Arabis alpina [alpine rockcress]
ref|XP_010109710.1|  Putative vesicle-associated membrane protein...    239   6e-76   Morus notabilis
ref|XP_002304708.1|  synptobrevin-related family protein                239   6e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010932918.1|  PREDICTED: putative vesicle-associated membr...    239   7e-76   
ref|XP_007034424.1|  Vesicle-associated membrane protein 726 isof...    239   7e-76   
emb|CDY06150.1|  BnaA09g50530D                                          239   8e-76   
gb|KHG06809.1|  hypothetical protein F383_08210                         239   9e-76   Gossypium arboreum [tree cotton]
ref|XP_009118621.1|  PREDICTED: vesicle-associated membrane prote...    239   9e-76   Brassica rapa
ref|XP_010542985.1|  PREDICTED: vesicle-associated membrane prote...    239   9e-76   Tarenaya hassleriana [spider flower]
gb|KJB57021.1|  hypothetical protein B456_009G150900                    239   1e-75   Gossypium raimondii
gb|KDP20321.1|  hypothetical protein JCGZ_06407                         239   1e-75   Jatropha curcas
ref|XP_007049803.1|  Vesicle-associated membrane protein 726            239   1e-75   
ref|XP_009132911.1|  PREDICTED: vesicle-associated membrane prote...    239   1e-75   Brassica rapa
emb|CDX79510.1|  BnaC03g18460D                                          239   1e-75   
ref|NP_171967.1|  vesicle-associated membrane protein 7B                239   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143895.1|  PREDICTED: vesicle-associated membrane prote...    239   2e-75   Brassica rapa
ref|XP_008235502.1|  PREDICTED: vesicle-associated membrane prote...    238   2e-75   Prunus mume [ume]
ref|XP_010509926.1|  PREDICTED: vesicle-associated membrane prote...    238   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006650747.1|  PREDICTED: vesicle-associated membrane prote...    238   2e-75   Oryza brachyantha
ref|XP_006420620.1|  hypothetical protein CICLE_v10005852mg             238   2e-75   
ref|XP_006410450.1|  hypothetical protein EUTSA_v10017216mg             238   2e-75   Eutrema salsugineum [saltwater cress]
ref|XP_008775432.1|  PREDICTED: vesicle-associated membrane prote...    238   2e-75   
ref|XP_007034425.1|  Vesicle-associated membrane protein 726 isof...    238   3e-75   
emb|CDY15521.1|  BnaA08g28050D                                          238   3e-75   Brassica napus [oilseed rape]
ref|XP_011080177.1|  PREDICTED: vesicle-associated membrane prote...    237   5e-75   Sesamum indicum [beniseed]
dbj|BAD43410.1|  putative vesicle-associated membrane protein, sy...    237   5e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KJB37798.1|  hypothetical protein B456_006G220500                    237   5e-75   Gossypium raimondii
ref|XP_009111083.1|  PREDICTED: vesicle-associated membrane prote...    237   5e-75   Brassica rapa
ref|XP_002264270.1|  PREDICTED: vesicle-associated membrane prote...    237   6e-75   Vitis vinifera
ref|XP_006294968.1|  hypothetical protein CARUB_v10024024mg             237   6e-75   Capsella rubella
gb|KCW57284.1|  hypothetical protein EUGRSUZ_H00084                     242   6e-75   Eucalyptus grandis [rose gum]
ref|XP_002267063.1|  PREDICTED: vesicle-associated membrane prote...    237   7e-75   Vitis vinifera
emb|CAN65946.1|  hypothetical protein VITISV_029427                     236   8e-75   Vitis vinifera
ref|XP_010264069.1|  PREDICTED: vesicle-associated membrane prote...    236   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_009336053.1|  PREDICTED: vesicle-associated membrane prote...    235   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_010674670.1|  PREDICTED: vesicle-associated membrane prote...    236   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001280954.1|  putative vesicle-associated membrane protein...    236   1e-74   Malus domestica [apple tree]
ref|XP_010241141.1|  PREDICTED: putative vesicle-associated membr...    236   1e-74   Nelumbo nucifera [Indian lotus]
gb|AAB80624.1|  Strong similarity to Arabidopsis ATHSAR1 (gb|M904...    234   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556950.1|  PREDICTED: vesicle-associated membrane prote...    236   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_006443628.1|  hypothetical protein CICLE_v10022162mg             236   2e-74   Citrus clementina [clementine]
ref|XP_009351028.1|  PREDICTED: putative vesicle-associated membr...    236   2e-74   Pyrus x bretschneideri [bai li]
ref|XP_007200442.1|  hypothetical protein PRUPE_ppa011218mg             236   2e-74   Prunus persica
gb|EYU46345.1|  hypothetical protein MIMGU_mgv1a013442mg                236   2e-74   Erythranthe guttata [common monkey flower]
gb|KFK31144.1|  hypothetical protein AALP_AA6G074500                    236   2e-74   Arabis alpina [alpine rockcress]
ref|XP_008803805.1|  PREDICTED: putative vesicle-associated membr...    236   2e-74   
ref|XP_002521112.1|  Vesicle-associated membrane protein, putative      235   3e-74   Ricinus communis
ref|XP_006418096.1|  hypothetical protein EUTSA_v10008729mg             235   3e-74   Eutrema salsugineum [saltwater cress]
gb|EPS70718.1|  hypothetical protein M569_04041                         235   3e-74   Genlisea aurea
ref|XP_011083121.1|  PREDICTED: vesicle-associated membrane prote...    235   3e-74   Sesamum indicum [beniseed]
ref|XP_009627066.1|  PREDICTED: vesicle-associated membrane prote...    235   3e-74   Nicotiana tomentosiformis
ref|XP_004134008.1|  PREDICTED: putative vesicle-associated membr...    235   4e-74   Cucumis sativus [cucumbers]
ref|XP_009370116.1|  PREDICTED: putative vesicle-associated membr...    235   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_009371395.1|  PREDICTED: putative vesicle-associated membr...    235   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_008371850.1|  PREDICTED: vesicle-associated membrane prote...    235   5e-74   
gb|ADK78986.1|  VAMP721                                                 235   5e-74   Petunia integrifolia subsp. inflata
ref|XP_004290222.1|  PREDICTED: vesicle-associated membrane prote...    234   6e-74   Fragaria vesca subsp. vesca
ref|NP_180871.1|  vesicle-associated membrane protein 722               234   6e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438380.1|  PREDICTED: putative vesicle-associated membr...    234   6e-74   Cucumis melo [Oriental melon]
ref|XP_009335952.1|  PREDICTED: putative vesicle-associated membr...    234   8e-74   Pyrus x bretschneideri [bai li]
ref|NP_001030968.1|  vesicle-associated membrane protein 7B             233   8e-74   
ref|XP_004293741.1|  PREDICTED: putative vesicle-associated membr...    234   1e-73   Fragaria vesca subsp. vesca
emb|CDP03855.1|  unnamed protein product                                234   1e-73   Coffea canephora [robusta coffee]
ref|XP_002889523.1|  vesicle-associated membrane protein 7B             233   2e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_011034474.1|  PREDICTED: vesicle-associated membrane prote...    233   2e-73   Populus euphratica
gb|KJB10140.1|  hypothetical protein B456_001G186000                    233   2e-73   Gossypium raimondii
ref|XP_002518125.1|  Vesicle-associated membrane protein, putative      233   2e-73   Ricinus communis
gb|ABK22119.1|  unknown                                                 233   2e-73   Picea sitchensis
ref|XP_008372458.1|  PREDICTED: putative vesicle-associated membr...    233   2e-73   
ref|XP_004247095.1|  PREDICTED: vesicle-associated membrane prote...    233   3e-73   
gb|KJB37799.1|  hypothetical protein B456_006G220500                    231   3e-73   Gossypium raimondii
ref|NP_171968.1|  vesicle-associated membrane protein 726               233   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380599.1|  PREDICTED: putative vesicle-associated membr...    233   3e-73   Malus domestica [apple tree]
ref|XP_010910152.1|  PREDICTED: vesicle-associated membrane prote...    233   3e-73   
ref|XP_007157801.1|  hypothetical protein PHAVU_002G099400g             233   4e-73   Phaseolus vulgaris [French bean]
ref|XP_003556884.1|  PREDICTED: putative vesicle-associated membr...    232   5e-73   Glycine max [soybeans]
ref|XP_006364264.1|  PREDICTED: vesicle-associated membrane prote...    232   5e-73   Solanum tuberosum [potatoes]
ref|XP_009408466.1|  PREDICTED: vesicle-associated membrane prote...    232   6e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132860.1|  PREDICTED: putative vesicle-associated membr...    232   6e-73   Brassica rapa
gb|KDO77465.1|  hypothetical protein CISIN_1g027612mg                   229   6e-73   Citrus sinensis [apfelsine]
ref|XP_009398406.1|  PREDICTED: putative vesicle-associated membr...    232   7e-73   
gb|AAA56991.1|  formerly called HAT24; synaptobrevin-related protein    232   8e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAC04496.1|  putative synaptobrevin                                  231   9e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31080.1|  hypothetical protein AALP_AA6G065800                    231   1e-72   Arabis alpina [alpine rockcress]
ref|XP_004152023.1|  PREDICTED: putative vesicle-associated membr...    231   1e-72   Cucumis sativus [cucumbers]
gb|EYU31743.1|  hypothetical protein MIMGU_mgv1a013482mg                231   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_006306317.1|  hypothetical protein CARUB_v10012187mg             231   2e-72   Capsella rubella
ref|XP_002881263.1|  hypothetical protein ARALYDRAFT_482248             231   2e-72   
dbj|BAJ88124.1|  predicted protein                                      231   2e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008465086.1|  PREDICTED: vesicle-associated membrane prote...    231   2e-72   Cucumis melo [Oriental melon]
ref|XP_006857408.1|  hypothetical protein AMTR_s00067p00148060          230   3e-72   
gb|AAQ15287.1|  synptobrevin-related protein                            229   4e-72   Pyrus pyrifolia [sha li]
ref|XP_003535217.1|  PREDICTED: putative vesicle-associated membr...    230   4e-72   Glycine max [soybeans]
gb|KFK42811.1|  hypothetical protein AALP_AA1G041700                    229   5e-72   Arabis alpina [alpine rockcress]
ref|XP_007226125.1|  hypothetical protein PRUPE_ppa011188mg             229   5e-72   Prunus persica
ref|XP_003604990.1|  Vesicle-associated membrane protein                229   5e-72   Medicago truncatula
gb|EYU17981.1|  hypothetical protein MIMGU_mgv1a013452mg                229   6e-72   Erythranthe guttata [common monkey flower]
ref|NP_180826.2|  vesicle-associated membrane protein 725               231   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413912.1|  PREDICTED: vesicle-associated membrane prote...    229   7e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010469563.1|  PREDICTED: vesicle-associated membrane prote...    229   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008224587.1|  PREDICTED: putative vesicle-associated membr...    229   8e-72   Prunus mume [ume]
ref|XP_009621355.1|  PREDICTED: putative vesicle-associated membr...    229   8e-72   Nicotiana tomentosiformis
ref|XP_006293513.1|  hypothetical protein CARUB_v10024029mg             229   1e-71   Capsella rubella
ref|XP_010413966.1|  PREDICTED: putative vesicle-associated membr...    229   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010413913.1|  PREDICTED: vesicle-associated membrane prote...    229   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010475140.1|  PREDICTED: putative vesicle-associated membr...    229   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010457534.1|  PREDICTED: putative vesicle-associated membr...    228   1e-71   Camelina sativa [gold-of-pleasure]
ref|NP_001031469.1|  vesicle-associated membrane protein 722            229   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879406.1|  hypothetical protein ARALYDRAFT_482195             228   2e-71   
gb|KEH41273.1|  synaptobrevin-like protein                              228   2e-71   Medicago truncatula
ref|XP_009143949.1|  PREDICTED: putative vesicle-associated membr...    228   3e-71   Brassica rapa
ref|XP_006360344.1|  PREDICTED: vesicle-associated membrane prote...    228   4e-71   Solanum tuberosum [potatoes]
emb|CDY19154.1|  BnaA04g18940D                                          227   4e-71   Brassica napus [oilseed rape]
ref|XP_010524695.1|  PREDICTED: putative vesicle-associated membr...    227   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_010069661.1|  PREDICTED: vesicle-associated membrane prote...    227   5e-71   Eucalyptus grandis [rose gum]
ref|XP_009767969.1|  PREDICTED: putative vesicle-associated membr...    227   5e-71   Nicotiana sylvestris
ref|XP_009417150.1|  PREDICTED: vesicle-associated membrane prote...    227   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002297816.2|  hypothetical protein POPTR_0001s14430g             227   6e-71   
ref|XP_011016158.1|  PREDICTED: vesicle-associated membrane prote...    226   1e-70   Populus euphratica
ref|XP_004296647.1|  PREDICTED: putative vesicle-associated membr...    226   1e-70   Fragaria vesca subsp. vesca
gb|KJB42279.1|  hypothetical protein B456_007G153200                    226   1e-70   Gossypium raimondii
ref|XP_004955737.1|  PREDICTED: vesicle-associated membrane prote...    226   2e-70   Setaria italica
gb|KJB71677.1|  hypothetical protein B456_011G160700                    226   2e-70   Gossypium raimondii
emb|CDO99425.1|  unnamed protein product                                224   2e-70   Coffea canephora [robusta coffee]
ref|XP_009757440.1|  PREDICTED: putative vesicle-associated membr...    225   2e-70   Nicotiana sylvestris
ref|XP_009608699.1|  PREDICTED: putative vesicle-associated membr...    225   2e-70   Nicotiana tomentosiformis
ref|XP_009335953.1|  PREDICTED: putative vesicle-associated membr...    225   3e-70   
gb|AAF40460.1|AC004809_18  Strong similarity to the synaptobrevin...    225   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61521.1|  hypothetical protein M569_13274                         225   4e-70   Genlisea aurea
gb|KJB22568.1|  hypothetical protein B456_004G058500                    225   4e-70   Gossypium raimondii
emb|CDY59642.1|  BnaAnng16140D                                          223   4e-70   Brassica napus [oilseed rape]
emb|CDX79466.1|  BnaC03g18020D                                          223   5e-70   
ref|XP_004247839.1|  PREDICTED: putative vesicle-associated membr...    224   6e-70   Solanum lycopersicum
ref|XP_006410397.1|  hypothetical protein EUTSA_v10017717mg             225   7e-70   
gb|KHM99990.1|  Putative vesicle-associated membrane protein 726        224   8e-70   Glycine soja [wild soybean]
ref|XP_009141263.1|  PREDICTED: vesicle-associated membrane prote...    224   8e-70   Brassica rapa
ref|XP_004253005.1|  PREDICTED: putative vesicle-associated membr...    224   1e-69   Solanum lycopersicum
ref|XP_004506588.1|  PREDICTED: vesicle-associated membrane prote...    223   1e-69   Cicer arietinum [garbanzo]
ref|XP_007145403.1|  hypothetical protein PHAVU_007G235900g             223   2e-69   Phaseolus vulgaris [French bean]
emb|CDY48531.1|  BnaC04g43180D                                          223   2e-69   Brassica napus [oilseed rape]
gb|EPS71680.1|  hypothetical protein M569_03080                         223   2e-69   Genlisea aurea
ref|NP_001148792.1|  vesicle-associated membrane protein 725            222   5e-69   Zea mays [maize]
ref|XP_011073775.1|  PREDICTED: putative vesicle-associated membr...    222   6e-69   Sesamum indicum [beniseed]
ref|XP_002459506.1|  hypothetical protein SORBIDRAFT_02g005730          221   8e-69   Sorghum bicolor [broomcorn]
ref|XP_010547077.1|  PREDICTED: vesicle-associated membrane prote...    221   8e-69   Tarenaya hassleriana [spider flower]
ref|XP_004514024.1|  PREDICTED: putative vesicle-associated membr...    221   8e-69   Cicer arietinum [garbanzo]
ref|XP_003622969.1|  Vesicle-associated membrane protein                221   1e-68   Medicago truncatula
ref|XP_008234811.1|  PREDICTED: putative vesicle-associated membr...    221   1e-68   Prunus mume [ume]
ref|XP_003532299.1|  PREDICTED: vesicle-associated membrane prote...    221   1e-68   Glycine max [soybeans]
ref|NP_001241434.1|  uncharacterized protein LOC100804314               221   1e-68   Glycine max [soybeans]
ref|XP_007140571.1|  hypothetical protein PHAVU_008G123800g             220   3e-68   Phaseolus vulgaris [French bean]
gb|KJB33092.1|  hypothetical protein B456_006G056000                    220   3e-68   Gossypium raimondii
ref|XP_010326818.1|  PREDICTED: putative vesicle-associated membr...    218   4e-68   
ref|XP_006349936.1|  PREDICTED: vesicle-associated membrane prote...    219   6e-68   Solanum tuberosum [potatoes]
ref|NP_001059109.1|  Os07g0194000                                       219   7e-68   
ref|XP_010314763.1|  PREDICTED: putative vesicle-associated membr...    218   8e-68   
ref|XP_010923320.1|  PREDICTED: vesicle-associated membrane prote...    219   8e-68   
gb|KDO77463.1|  hypothetical protein CISIN_1g027612mg                   218   1e-67   Citrus sinensis [apfelsine]
ref|NP_001051606.1|  Os03g0803000                                       219   1e-67   
ref|XP_002303031.1|  hypothetical protein POPTR_0002s24200g             218   1e-67   
tpg|DAA59924.1|  TPA: putative vesicle-associated membrane protei...    216   1e-67   
gb|KJB22567.1|  hypothetical protein B456_004G058500                    218   1e-67   Gossypium raimondii
ref|XP_004981381.1|  PREDICTED: vesicle-associated membrane prote...    218   2e-67   Setaria italica
ref|XP_006657530.1|  PREDICTED: vesicle-associated membrane prote...    218   2e-67   Oryza brachyantha
ref|XP_010326817.1|  PREDICTED: putative vesicle-associated membr...    218   3e-67   
ref|XP_009388457.1|  PREDICTED: vesicle-associated membrane prote...    217   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA42468.1|  TPA: putative vesicle-associated membrane protei...    215   6e-67   
gb|KJB42280.1|  hypothetical protein B456_007G153200                    216   8e-67   Gossypium raimondii
ref|XP_009418833.1|  PREDICTED: vesicle-associated membrane prote...    216   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547078.1|  PREDICTED: vesicle-associated membrane prote...    216   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_007140570.1|  hypothetical protein PHAVU_008G123800g             214   2e-66   Phaseolus vulgaris [French bean]
gb|KCW62998.1|  hypothetical protein EUGRSUZ_G00599                     215   2e-66   Eucalyptus grandis [rose gum]
gb|EMT18448.1|  Putative vesicle-associated membrane protein 726        216   2e-66   
ref|XP_010068178.1|  PREDICTED: vesicle-associated membrane prote...    215   2e-66   
ref|XP_003557429.1|  PREDICTED: vesicle-associated membrane prote...    215   2e-66   Brachypodium distachyon [annual false brome]
ref|XP_011091409.1|  PREDICTED: vesicle-associated membrane prote...    215   3e-66   Sesamum indicum [beniseed]
ref|XP_010934067.1|  PREDICTED: putative vesicle-associated membr...    214   4e-66   
ref|XP_006349937.1|  PREDICTED: vesicle-associated membrane prote...    213   4e-66   Solanum tuberosum [potatoes]
ref|XP_010065488.1|  PREDICTED: vesicle-associated membrane prote...    214   1e-65   Eucalyptus grandis [rose gum]
ref|NP_001149329.1|  vesicle-associated membrane protein 725            213   1e-65   Zea mays [maize]
ref|XP_008808719.1|  PREDICTED: vesicle-associated membrane prote...    213   1e-65   
gb|AFK47779.1|  unknown                                                 213   1e-65   Medicago truncatula
ref|XP_008651398.1|  PREDICTED: putative vesicle-associated membr...    213   2e-65   
ref|XP_008651397.1|  PREDICTED: putative vesicle-associated membr...    213   2e-65   
ref|XP_006649451.1|  PREDICTED: putative vesicle-associated membr...    213   2e-65   Oryza brachyantha
gb|AFK40729.1|  unknown                                                 212   3e-65   Lotus japonicus
ref|XP_010065491.1|  PREDICTED: vesicle-associated membrane prote...    212   4e-65   Eucalyptus grandis [rose gum]
ref|NP_001049070.1|  Os03g0165800                                       212   5e-65   
ref|XP_002466264.1|  hypothetical protein SORBIDRAFT_01g004700          212   5e-65   
ref|XP_004985586.1|  PREDICTED: putative vesicle-associated membr...    211   8e-65   Setaria italica
ref|XP_004985585.1|  PREDICTED: putative vesicle-associated membr...    211   9e-65   Setaria italica
ref|XP_004492323.1|  PREDICTED: vesicle-associated membrane prote...    210   3e-64   Cicer arietinum [garbanzo]
ref|XP_008660540.1|  PREDICTED: putative vesicle-associated membr...    210   3e-64   Zea mays [maize]
ref|XP_008644423.1|  PREDICTED: vesicle-associated membrane prote...    210   3e-64   
ref|XP_008660539.1|  PREDICTED: putative vesicle-associated membr...    210   3e-64   Zea mays [maize]
ref|XP_010684935.1|  PREDICTED: vesicle-associated membrane prote...    209   4e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO77468.1|  hypothetical protein CISIN_1g027612mg                   208   4e-64   Citrus sinensis [apfelsine]
ref|XP_010228179.1|  PREDICTED: vesicle-associated membrane prote...    209   5e-64   Brachypodium distachyon [annual false brome]
ref|XP_010065492.1|  PREDICTED: vesicle-associated membrane prote...    209   7e-64   Eucalyptus grandis [rose gum]
gb|EAZ25708.1|  hypothetical protein OsJ_09541                          206   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|AFK39584.1|  unknown                                                 206   2e-63   Lotus japonicus
gb|KJB57023.1|  hypothetical protein B456_009G150900                    207   2e-63   Gossypium raimondii
ref|XP_010065490.1|  PREDICTED: vesicle-associated membrane prote...    207   5e-63   Eucalyptus grandis [rose gum]
gb|ABK24294.1|  unknown                                                 207   5e-63   Picea sitchensis
ref|XP_006448758.1|  hypothetical protein CICLE_v10016613mg             205   5e-63   
ref|XP_002986717.1|  hypothetical protein SELMODRAFT_235084             206   6e-63   Selaginella moellendorffii
gb|KFK31079.1|  hypothetical protein AALP_AA6G065700                    205   2e-62   Arabis alpina [alpine rockcress]
gb|KCW50174.1|  hypothetical protein EUGRSUZ_K03606                     205   2e-62   Eucalyptus grandis [rose gum]
ref|XP_003558739.1|  PREDICTED: putative vesicle-associated membr...    205   3e-62   Brachypodium distachyon [annual false brome]
ref|XP_001777330.1|  R-SNARE, VAMP72-family                             204   3e-62   
ref|XP_004514025.1|  PREDICTED: putative vesicle-associated membr...    204   3e-62   Cicer arietinum [garbanzo]
ref|XP_002960391.1|  hypothetical protein SELMODRAFT_164037             204   4e-62   Selaginella moellendorffii
ref|XP_009141288.1|  PREDICTED: vesicle-associated membrane prote...    204   4e-62   Brassica rapa
ref|XP_002967324.1|  hypothetical protein SELMODRAFT_86867              204   4e-62   Selaginella moellendorffii
gb|EEC81677.1|  hypothetical protein OsI_25239                          204   8e-62   Oryza sativa Indica Group [Indian rice]
gb|KEH41272.1|  synaptobrevin-like protein                              200   1e-61   Medicago truncatula
emb|CDY37751.1|  BnaA04g19170D                                          203   1e-61   Brassica napus [oilseed rape]
ref|XP_007140572.1|  hypothetical protein PHAVU_008G123900g             201   6e-61   Phaseolus vulgaris [French bean]
ref|XP_001784148.1|  R-SNARE, VAMP72-family                             199   7e-60   
ref|XP_004138954.1|  PREDICTED: putative vesicle-associated membr...    198   1e-59   
gb|KHG23670.1|  vesicle-associated membrane protein                     198   2e-59   
gb|ACU18382.1|  unknown                                                 196   2e-59   
ref|XP_011020670.1|  PREDICTED: vesicle-associated membrane prote...    196   4e-59   
gb|ACO87682.1|  synaptobrevin-like protein                              197   4e-59   
ref|XP_002468451.1|  hypothetical protein SORBIDRAFT_01g046130          196   5e-59   
ref|XP_003577814.1|  PREDICTED: putative vesicle-associated membr...    196   5e-59   
emb|CDY23768.1|  BnaC04g43540D                                          194   7e-59   
gb|KDO49381.1|  hypothetical protein CISIN_1g0277592mg                  193   2e-58   
ref|XP_008223166.1|  PREDICTED: vesicle-associated membrane prote...    194   3e-58   
gb|ABK27118.1|  unknown                                                 194   3e-58   
ref|XP_008457254.1|  PREDICTED: vesicle-associated membrane prote...    193   8e-58   
ref|XP_006664247.1|  PREDICTED: vesicle-associated membrane prote...    193   9e-58   
ref|XP_007226119.1|  hypothetical protein PRUPE_ppa011159mg             193   1e-57   
gb|KCW63002.1|  hypothetical protein EUGRSUZ_G00602                     191   2e-57   
gb|KHG28831.1|  Vesicle-associated membrane protein                     193   2e-57   
ref|XP_008662658.1|  PREDICTED: vesicle-associated membrane prote...    192   3e-57   
ref|XP_010259650.1|  PREDICTED: vesicle-associated membrane prote...    192   3e-57   
ref|XP_002273101.1|  PREDICTED: vesicle-associated membrane prote...    192   4e-57   
ref|XP_008390678.1|  PREDICTED: vesicle-associated membrane prote...    191   4e-57   
ref|XP_006855544.1|  hypothetical protein AMTR_s00057p00217050          190   1e-56   
gb|KFK44987.1|  hypothetical protein AALP_AA1G329300                    190   1e-56   
ref|NP_001242377.1|  uncharacterized protein LOC100781950               189   2e-56   
sp|O23429.2|VA724_ARATH  RecName: Full=Vesicle-associated membran...    189   2e-56   
ref|XP_006582892.1|  PREDICTED: uncharacterized protein LOC100781...    189   2e-56   
ref|XP_006414448.1|  hypothetical protein EUTSA_v10026189mg             189   3e-56   
ref|XP_002868180.1|  hypothetical protein ARALYDRAFT_915207             189   3e-56   
gb|ACJ84394.1|  unknown                                                 189   3e-56   
ref|XP_003550254.1|  PREDICTED: vesicle-associated membrane prote...    189   3e-56   
ref|XP_010449891.1|  PREDICTED: vesicle-associated membrane prote...    189   4e-56   
ref|XP_006419598.1|  hypothetical protein CICLE_v10005844mg             189   6e-56   
ref|XP_010434919.1|  PREDICTED: vesicle-associated membrane prote...    189   6e-56   
ref|XP_009352245.1|  PREDICTED: vesicle-associated membrane prote...    188   6e-56   
ref|XP_010551064.1|  PREDICTED: vesicle-associated membrane prote...    188   8e-56   
ref|XP_009146719.1|  PREDICTED: vesicle-associated membrane prote...    188   8e-56   
ref|XP_003622943.1|  Vesicle-associated membrane protein                188   8e-56   
ref|XP_007154271.1|  hypothetical protein PHAVU_003G104700g             188   9e-56   
gb|KHG15268.1|  Vesicle-associated membrane protein                     188   9e-56   
ref|XP_006284495.1|  hypothetical protein CARUB_v10005687mg             188   1e-55   
emb|CDY22900.1|  BnaA01g18380D                                          188   1e-55   
gb|AFK38247.1|  unknown                                                 188   1e-55   
emb|CDY44179.1|  BnaC01g22290D                                          188   1e-55   
ref|NP_193313.5|  vesicle-associated membrane protein 724               188   1e-55   
gb|KJB12630.1|  hypothetical protein B456_002G028200                    186   1e-55   
gb|KHG06808.1|  hypothetical protein F383_08210                         189   1e-55   
ref|XP_004487861.1|  PREDICTED: vesicle-associated membrane prote...    187   2e-55   
gb|ABK23325.1|  unknown                                                 187   2e-55   
gb|EMT03059.1|  Putative vesicle-associated membrane protein 726        188   2e-55   
gb|AAS88558.1|  putative synaptobrevin                                  187   3e-55   
ref|XP_010037394.1|  PREDICTED: vesicle-associated membrane prote...    187   3e-55   
gb|KJB12629.1|  hypothetical protein B456_002G028200                    188   3e-55   
ref|NP_001237046.1|  uncharacterized protein LOC100527252               186   4e-55   
ref|XP_009343983.1|  PREDICTED: vesicle-associated membrane prote...    186   5e-55   
ref|XP_010931625.1|  PREDICTED: vesicle-associated membrane prote...    186   5e-55   
gb|KJB33093.1|  hypothetical protein B456_006G056000                    184   7e-55   
ref|XP_004296828.1|  PREDICTED: vesicle-associated membrane prote...    186   8e-55   
ref|XP_011071446.1|  PREDICTED: vesicle-associated membrane prote...    186   9e-55   
ref|XP_004171337.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    185   1e-54   
gb|AAV49990.1|  putative synaptobrevin/VAMP                             185   1e-54   
ref|XP_002516908.1|  Vesicle-associated membrane protein, putative      185   1e-54   
ref|XP_007035565.1|  Vesicle-associated membrane protein 724            185   1e-54   
ref|XP_004963344.1|  PREDICTED: putative vesicle-associated membr...    185   2e-54   
emb|CAJ13552.1|  unnamed protein product                                185   2e-54   
ref|XP_007138903.1|  hypothetical protein PHAVU_009G247400g             185   2e-54   
ref|XP_004143088.1|  PREDICTED: vesicle-associated membrane prote...    185   2e-54   
emb|CAJ13539.1|  unnamed protein product                                185   2e-54   
gb|KDP27786.1|  hypothetical protein JCGZ_18866                         184   2e-54   
gb|KJB22566.1|  hypothetical protein B456_004G058500                    184   2e-54   
ref|XP_008392281.1|  PREDICTED: vesicle-associated membrane prote...    184   3e-54   
gb|KJB38624.1|  hypothetical protein B456_006G263500                    184   3e-54   
emb|CAJ15414.1|  unnamed protein product                                184   6e-54   
ref|XP_008800852.1|  PREDICTED: vesicle-associated membrane prote...    184   7e-54   
ref|XP_008458455.1|  PREDICTED: vesicle-associated membrane prote...    182   1e-53   
ref|XP_009107862.1|  PREDICTED: vesicle-associated membrane prote...    182   1e-53   
ref|XP_003533403.1|  PREDICTED: vesicle-associated membrane prote...    182   1e-53   
emb|CAJ13968.1|  unnamed protein product                                182   2e-53   
ref|XP_009784059.1|  PREDICTED: vesicle-associated membrane prote...    182   2e-53   
ref|XP_003552141.1|  PREDICTED: vesicle-associated membrane prote...    181   3e-53   
ref|XP_006389238.1|  hypothetical protein POPTR_0034s00330g             182   3e-53   
ref|XP_006342793.1|  PREDICTED: vesicle-associated membrane prote...    181   4e-53   
ref|XP_009592498.1|  PREDICTED: vesicle-associated membrane prote...    181   4e-53   
ref|XP_010024689.1|  PREDICTED: vesicle-associated membrane prote...    180   1e-52   
gb|KCW63001.1|  hypothetical protein EUGRSUZ_G00601                     178   1e-52   
gb|EYU43939.1|  hypothetical protein MIMGU_mgv1a024116mg                177   3e-52   
gb|KHG04679.1|  Vesicle-associated membrane protein                     179   4e-52   
gb|ACG34366.1|  vesicle-associated membrane protein 725                 181   4e-52   
ref|NP_001059291.1|  Os07g0249200                                       179   6e-52   
ref|XP_002269134.1|  PREDICTED: vesicle-associated membrane prote...    178   9e-52   
ref|XP_007142865.1|  hypothetical protein PHAVU_007G023300g             178   1e-51   
ref|XP_011090953.1|  PREDICTED: vesicle-associated membrane prote...    177   1e-51   
emb|CDP19534.1|  unnamed protein product                                177   1e-51   
ref|XP_002515759.1|  Vesicle-associated membrane protein, putative      177   2e-51   
ref|NP_850201.1|  vesicle-associated membrane protein 723               177   2e-51   
ref|XP_008788949.1|  PREDICTED: vesicle-associated membrane prote...    177   2e-51   
ref|XP_006658441.1|  PREDICTED: vesicle-associated membrane prote...    176   2e-51   
ref|XP_004229234.1|  PREDICTED: vesicle-associated membrane prote...    176   3e-51   
ref|XP_011045447.1|  PREDICTED: vesicle-associated membrane prote...    176   3e-51   
emb|CDY19156.1|  BnaA04g18960D                                          174   3e-51   
emb|CDY22757.1|  BnaA08g05870D                                          175   4e-51   
gb|KDP43378.1|  hypothetical protein JCGZ_26478                         176   5e-51   
ref|XP_007024900.1|  Vesicle-associated membrane protein 726 isof...    174   5e-51   
ref|NP_001067392.2|  Os12g0639800                                       175   8e-51   
ref|XP_008667191.1|  PREDICTED: uncharacterized protein LOC100193...    176   9e-51   
gb|AFK42000.1|  unknown                                                 174   2e-50   
gb|AES87177.2|  synaptobrevin-like protein                              171   3e-50   
ref|XP_003604980.1|  Vesicle-associated membrane protein                171   3e-50   
ref|XP_003555880.1|  PREDICTED: vesicle-associated membrane prote...    174   3e-50   
ref|XP_008806092.1|  PREDICTED: vesicle-associated membrane prote...    174   4e-50   
ref|XP_002459621.1|  hypothetical protein SORBIDRAFT_02g007620          177   4e-50   
ref|XP_009412477.1|  PREDICTED: vesicle-associated membrane prote...    173   4e-50   
ref|XP_008244890.1|  PREDICTED: vesicle-associated membrane prote...    174   5e-50   
ref|XP_007218295.1|  hypothetical protein PRUPE_ppa010737mg             174   5e-50   
gb|ACU23563.1|  unknown                                                 174   6e-50   
gb|KDO77469.1|  hypothetical protein CISIN_1g027612mg                   171   6e-50   
tpg|DAA42470.1|  TPA: putative vesicle-associated membrane protei...    172   6e-50   
ref|XP_010245408.1|  PREDICTED: vesicle-associated membrane prote...    173   7e-50   
ref|XP_003536697.1|  PREDICTED: vesicle-associated membrane prote...    173   7e-50   
ref|XP_002315429.1|  hypothetical protein POPTR_0010s24630g             173   8e-50   
tpg|DAA42471.1|  TPA: putative vesicle-associated membrane protei...    172   9e-50   
gb|KGN66898.1|  hypothetical protein Csa_1G707630                       172   1e-49   
gb|KJB69906.1|  hypothetical protein B456_011G049200                    170   1e-49   
gb|AFK34145.1|  unknown                                                 171   1e-49   
ref|XP_003574932.1|  PREDICTED: vesicle-associated membrane prote...    173   1e-49   
ref|XP_010943829.1|  PREDICTED: vesicle-associated membrane prote...    172   2e-49   
ref|XP_010024691.1|  PREDICTED: vesicle-associated membrane prote...    171   3e-49   
ref|XP_003637224.1|  Vesicle-associated membrane protein                172   3e-49   
ref|XP_004497141.1|  PREDICTED: vesicle-associated membrane prote...    172   3e-49   
ref|XP_001779971.1|  R-SNARE, VAMP72-family                             172   4e-49   
ref|XP_011024182.1|  PREDICTED: vesicle-associated membrane prote...    171   4e-49   
gb|KDO77466.1|  hypothetical protein CISIN_1g027612mg                   170   5e-49   
ref|XP_004974203.1|  PREDICTED: vesicle-associated membrane prote...    171   5e-49   
ref|XP_003561275.1|  PREDICTED: vesicle-associated membrane prote...    171   5e-49   
ref|XP_007010423.1|  Vesicle-associated membrane protein 727            171   6e-49   
ref|XP_010554503.1|  PREDICTED: vesicle-associated membrane prote...    171   7e-49   
ref|XP_009355010.1|  PREDICTED: vesicle-associated membrane prote...    171   8e-49   
ref|XP_006855103.1|  hypothetical protein AMTR_s00031p00183990          171   9e-49   
gb|ACU24529.1|  unknown                                                 171   9e-49   
ref|XP_001764415.1|  R-SNARE, VAMP72-family                             171   9e-49   
ref|XP_011101625.1|  PREDICTED: LOW QUALITY PROTEIN: vesicle-asso...    170   1e-48   
ref|XP_009419510.1|  PREDICTED: vesicle-associated membrane prote...    170   1e-48   
ref|XP_010910975.1|  PREDICTED: vesicle-associated membrane prote...    170   1e-48   
ref|XP_009622317.1|  PREDICTED: vesicle-associated membrane prote...    170   1e-48   
ref|XP_010031285.1|  PREDICTED: vesicle-associated membrane prote...    170   2e-48   
ref|XP_008456603.1|  PREDICTED: vesicle-associated membrane prote...    170   2e-48   
ref|XP_004140905.1|  PREDICTED: vesicle-associated membrane prote...    170   2e-48   
ref|XP_010695070.1|  PREDICTED: vesicle-associated membrane prote...    169   2e-48   
emb|CDO99918.1|  unnamed protein product                                169   3e-48   
ref|XP_006403590.1|  hypothetical protein EUTSA_v10010674mg             169   3e-48   
ref|XP_008345948.1|  PREDICTED: vesicle-associated membrane prote...    169   3e-48   
ref|XP_011032884.1|  PREDICTED: vesicle-associated membrane prote...    169   3e-48   
ref|XP_002311006.1|  Vesicle-associated membrane protein 727            169   3e-48   
gb|KEH22818.1|  synaptobrevin-like protein                              166   4e-48   
gb|KJB57022.1|  hypothetical protein B456_009G150900                    167   5e-48   
ref|XP_004306429.1|  PREDICTED: vesicle-associated membrane prote...    169   5e-48   
ref|XP_008651494.1|  PREDICTED: vesicle-associated membrane prote...    169   5e-48   
ref|NP_001150264.1|  vesicle-associated membrane protein 724            169   6e-48   
ref|XP_009412480.1|  PREDICTED: vesicle-associated membrane prote...    168   6e-48   
ref|XP_004249955.1|  PREDICTED: vesicle-associated membrane prote...    168   7e-48   
gb|KHG13199.1|  vesicle-associated membrane protein                     169   7e-48   
ref|XP_006361486.1|  PREDICTED: vesicle-associated membrane prote...    168   8e-48   
ref|XP_009414577.1|  PREDICTED: vesicle-associated membrane prote...    168   8e-48   
ref|NP_001136721.1|  uncharacterized protein LOC100216858               167   1e-47   
ref|XP_001692216.1|  R-SNARE protein, VAMP72-family                     167   2e-47   
ref|XP_010427103.1|  PREDICTED: vesicle-associated membrane prote...    167   2e-47   
ref|XP_004955897.1|  PREDICTED: vesicle-associated membrane prote...    167   2e-47   
ref|XP_002959057.1|  hypothetical protein VOLCADRAFT_70298              166   2e-47   
emb|CDX67594.1|  BnaA07g16340D                                          167   2e-47   
gb|EPS64544.1|  hypothetical protein M569_10239                         166   2e-47   
ref|XP_009139247.1|  PREDICTED: vesicle-associated membrane prote...    167   3e-47   
ref|XP_007200441.1|  hypothetical protein PRUPE_ppa011218mg             164   4e-47   
ref|XP_009103912.1|  PREDICTED: vesicle-associated membrane prote...    166   4e-47   
ref|XP_002877968.1|  ATVAMP727                                          166   5e-47   
ref|XP_006853346.1|  hypothetical protein AMTR_s00032p00095920          166   5e-47   
ref|NP_190998.1|  vesicle-associated membrane protein 727               166   6e-47   
ref|XP_006291777.1|  hypothetical protein CARUB_v10017948mg             166   7e-47   
ref|XP_010504230.1|  PREDICTED: vesicle-associated membrane prote...    165   9e-47   
emb|CDX76153.1|  BnaA04g04170D                                          166   1e-46   
emb|CDY07551.1|  BnaC06g15130D                                          165   1e-46   
ref|XP_009116118.1|  PREDICTED: vesicle-associated membrane prote...    165   2e-46   
ref|XP_006659694.1|  PREDICTED: vesicle-associated membrane prote...    164   2e-46   
ref|XP_008457256.1|  PREDICTED: vesicle-associated membrane prote...    162   2e-46   
gb|EMT21571.1|  Vesicle-associated membrane protein 727                 166   3e-46   
ref|XP_010515951.1|  PREDICTED: vesicle-associated membrane prote...    164   4e-46   
gb|KEH22817.1|  synaptobrevin-like protein                              162   7e-46   
emb|CDM82457.1|  unnamed protein product                                168   8e-46   
ref|NP_001062495.1|  Os08g0558600                                       163   8e-46   
ref|XP_008457255.1|  PREDICTED: vesicle-associated membrane prote...    162   8e-46   
emb|CDX73490.1|  BnaC08g25130D                                          163   8e-46   
gb|KJB60248.1|  hypothetical protein B456_009G303300                    162   1e-45   
emb|CDX78228.1|  BnaA09g34230D                                          162   1e-45   
ref|XP_008457253.1|  PREDICTED: vesicle-associated membrane prote...    162   2e-45   
ref|XP_006485186.1|  PREDICTED: vesicle-associated membrane prote...    161   3e-45   
gb|KDO71623.1|  hypothetical protein CISIN_1g032590mg                   155   4e-44   
ref|XP_002507800.1|  synaptobrevin like protein                         157   8e-44   
ref|XP_008662654.1|  PREDICTED: vesicle-associated membrane prote...    158   9e-44   
ref|XP_008662650.1|  PREDICTED: vesicle-associated membrane prote...    158   1e-43   
ref|XP_008651495.1|  PREDICTED: vesicle-associated membrane prote...    157   1e-43   
gb|EYU19818.1|  hypothetical protein MIMGU_mgv1a012998mg                156   2e-43   
gb|KJB60252.1|  hypothetical protein B456_009G303300                    156   3e-43   
gb|KHN03622.1|  Putative vesicle-associated membrane protein 726        153   3e-43   
gb|KDD72743.1|  synaptobrevin                                           151   4e-42   
gb|KHN07197.1|  Vesicle-associated membrane protein 722                 149   4e-42   
gb|AAC04922.1|  putative synaptobrevin                                  152   5e-42   
ref|XP_003636885.1|  Vesicle-associated membrane protein                149   5e-42   
gb|EAZ07996.1|  hypothetical protein OsI_30258                          159   1e-41   
ref|XP_005843431.1|  hypothetical protein CHLNCDRAFT_28123              151   2e-41   
gb|KCW84470.1|  hypothetical protein EUGRSUZ_B01305                     148   8e-41   
ref|XP_009146727.1|  PREDICTED: vesicle-associated membrane prote...    149   1e-40   
ref|XP_005648444.1|  R-SNARE protein, VAMP72-family                     149   1e-40   
gb|EEE69144.1|  hypothetical protein OsJ_28268                          158   2e-40   
ref|XP_007034428.1|  Vesicle-associated membrane 721, VAMP7B-like...    149   3e-40   
gb|KJB12631.1|  hypothetical protein B456_002G028200                    146   5e-40   
ref|XP_010098294.1|  Vesicle-associated membrane protein 724            147   6e-40   
ref|XP_002442624.1|  hypothetical protein SORBIDRAFT_08g023180          146   1e-39   
ref|XP_005643794.1|  R-SNARE protein, VAMP72-family                     146   1e-39   
ref|XP_003062253.1|  predicted protein                                  146   2e-39   
ref|NP_001130551.1|  uncharacterized protein LOC100191650               143   3e-39   
ref|XP_001777794.1|  R-SNARE, VAMP72-family                             145   7e-39   
ref|XP_001418265.1|  predicted protein                                  143   2e-38   
ref|XP_010680955.1|  PREDICTED: vesicle-associated membrane prote...    142   6e-38   
ref|NP_001132174.1|  uncharacterized protein LOC100193599               139   1e-37   



>ref|XP_007024899.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY27521.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=221

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVP+AFLERIKDDFV KYG GKAATAPAN L+KEFGPKL++HMQYC
Sbjct  62   GYTYCVVADESAGRQVPIAFLERIKDDFVSKYGSGKAATAPANGLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRSTGT
Sbjct  122  VEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_007147528.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
 gb|ESW19522.1| hypothetical protein PHAVU_006G132100g [Phaseolus vulgaris]
Length=221

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYC+VA+ES GRQVPMAFLER+KDDFV KYGGGKAATAPANSL+KEFGPKLR+HMQYC
Sbjct  62   GYTYCIVADESIGRQVPMAFLERVKDDFVSKYGGGKAATAPANSLNKEFGPKLREHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  RIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_008225792.1| PREDICTED: vesicle-associated membrane protein 721-like [Prunus 
mume]
Length=221

 Score =   263 bits (671),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQVP+AFLERIKDDFV KYGGGKAATAPANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVLGI+IALIL+I+LSVCHGFNCGK
Sbjct  182  KMRRKMWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>ref|XP_007212008.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
 gb|EMJ13207.1| hypothetical protein PRUPE_ppa011167mg [Prunus persica]
Length=221

 Score =   263 bits (671),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQVP+AFLERIKDDFV KYGGGKAATAPANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVADESSGRQVPIAFLERIKDDFVSKYGGGKAATAPANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNVGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVLGI+IALIL+I+LSVCHGFNCGK
Sbjct  182  KMRRKMWLQNMKVKLIVLGILIALILVIILSVCHGFNCGK  221



>ref|XP_006448759.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 ref|XP_006468428.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR61999.1| hypothetical protein CICLE_v10016613mg [Citrus clementina]
 gb|KDO77464.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=221

 Score =   262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQ+PMAFLER+KD+FV KYGGGKAATAPAN L+KEFGPKL++ MQYC
Sbjct  62   GYTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRSTGT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  182  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_010242074.1| PREDICTED: vesicle-associated membrane protein 721-like [Nelumbo 
nucifera]
Length=222

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+ GRQVPMAFLERIKDDFV +YGGGKAATAPANSL+KEFG KL++HMQYC
Sbjct  63   GYTYCVVADETVGRQVPMAFLERIKDDFVSRYGGGKAATAPANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  123  IDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRNTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  183  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_011096786.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=226

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQVPMAFL+RIKDDFV KYGGGKAATAPAN L+KEFGPKL++HMQYC
Sbjct  67   GFTYCVVAEESVGRQVPMAFLDRIKDDFVAKYGGGKAATAPANGLNKEFGPKLKEHMQYC  126

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  127  IEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRATGT  186

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  187  KIRRKMWLQNMKIKLIVLAIVIALILIIVLSVCKGFNCGK  226



>ref|XP_009802587.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
sylvestris]
Length=222

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQVP+AFLER+KDDFV KYGGGKAATA  NSL+KEFGPKL++HM YC
Sbjct  63   GFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMHYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  123  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMK+KLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  183  QIRRKMWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>ref|XP_009618936.1| PREDICTED: vesicle-associated membrane protein 721-like [Nicotiana 
tomentosiformis]
Length=222

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQVP+AFLER+KDDFV KYGGGKAATA  NSL+KEFGPKL++HM YC
Sbjct  63   GFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATATPNSLNKEFGPKLKEHMHYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  123  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMK+KLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  183  QIRRKMWLQNMKVKLIVLGILIALILIIVLSVCHGFNCGK  222



>gb|KJB69905.1| hypothetical protein B456_011G049200 [Gossypium raimondii]
Length=222

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVP+AFLERIKDDFV KY  GKAATAPANSL+KEFGPKL++HMQYC
Sbjct  62   GYTYCVVADESAGRQVPIAFLERIKDDFVSKYDNGKAATAPANSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRSTGT
Sbjct  122  MEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFRSTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>ref|XP_009604671.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
tomentosiformis]
 ref|XP_009759428.1| PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana 
sylvestris]
Length=222

 Score =   260 bits (664),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQVP+AFLER+KDDFV KYGGGKAATAP NSL+KEFGPKL++HMQYC
Sbjct  63   GFTYCVVAEESVGRQVPIAFLERVKDDFVSKYGGGKAATAPPNSLNKEFGPKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHP+EISK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  123  ADHPDEISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  183  QIRRKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>emb|CDP18918.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   260 bits (664),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQ+P+AFLER+KDDFV KYGGGKA TAPAN L+KEFGPKL+DHM+YC
Sbjct  67   GFTYCVVAEESAGRQIPIAFLERVKDDFVSKYGGGKATTAPANGLNKEFGPKLKDHMKYC  126

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+TGT
Sbjct  127  MDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGT  186

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVL I+IALILII+LS C GFNCGK
Sbjct  187  KMRRKMWLQNMKVKLIVLAIVIALILIIILSACKGFNCGK  226



>ref|XP_002530145.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF32237.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=221

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVPMAFLERIK+DF+ +YG GKAATAPANSL KEFGPKL++HMQYC
Sbjct  62   GFTYCVVADESAGRQVPMAFLERIKEDFMARYGNGKAATAPANSLDKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISK AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS+GT
Sbjct  122  VDHPEEISKFAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  182  KIRRKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  221



>ref|XP_003535044.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
1 [Glycine max]
 gb|ACJ61478.1| synaptobrevin-related protein [Glycine max]
 gb|KHN22964.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQ+PMAFLER+KD+FV KYGGGKAATAPANSL+KEFGPKLR+HMQYC
Sbjct  62   GYTYCVVADESIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  RIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_010092659.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXB51910.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=221

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVP+AFLER+KDDFV KYG GKA+TA ANSL+KEFGPKL++HMQYC
Sbjct  62   GYTYCVVADESVGRQVPLAFLERVKDDFVSKYGAGKASTAAANSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTAGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWL+NMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  182  KIRRKMWLKNMKIKLIVLGILIALILIIVLSVCHGFNCGK  221



>gb|KHN14368.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   258 bits (658),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQ+PMAFLER+KD+FV KYGGGKAATAP NSL+KEFGPKLR+HMQYC
Sbjct  62   GYTYCVVADESIGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  RIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_008383321.1| PREDICTED: vesicle-associated membrane protein 721-like [Malus 
domestica]
 ref|XP_009353936.1| PREDICTED: vesicle-associated membrane protein 721-like [Pyrus 
x bretschneideri]
Length=221

 Score =   258 bits (658),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQVP+AFLER+KDDFV KYG GKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVADESSGRQVPIAFLERVKDDFVAKYGSGKAATAAANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVLGI+IALILII++SVCHGFNCGK
Sbjct  182  KMRRKMWLQNMKVKLIVLGILIALILIIIMSVCHGFNCGK  221



>ref|XP_006377004.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
 gb|ABK92923.1| unknown [Populus trichocarpa]
 gb|ABK94486.1| unknown [Populus trichocarpa]
 gb|ABK95420.1| unknown [Populus trichocarpa]
 gb|ERP54801.1| hypothetical protein POPTR_0012s12000g [Populus trichocarpa]
Length=221

 Score =   257 bits (657),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVPMAFLER+KDDFV KYGGGKAATA AN L+KEFGPKL++HM+YC
Sbjct  62   GFTYCVVADESAGRQVPMAFLERVKDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRS GT
Sbjct  122  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMK+KLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  QIRRKMWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>ref|XP_004233223.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
lycopersicum]
 ref|XP_006362607.1| PREDICTED: vesicle-associated membrane protein 722-like [Solanum 
tuberosum]
Length=222

 Score =   257 bits (657),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVAEES GRQ+P+AFLERIKDDF+ KYG GKAATAP NSL+KEFGPKL++HMQYC
Sbjct  63   GFTYCVVAEESVGRQIPIAFLERIKDDFMSKYGSGKAATAPPNSLNKEFGPKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            A+HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR+TGT
Sbjct  123  AEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  183  QIRRKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  222



>ref|NP_001236634.1| uncharacterized protein LOC100500089 [Glycine max]
 gb|ACU14879.1| unknown [Glycine max]
Length=221

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQ+PMAFLER+KD+FV KYGGGKAATAP NSL+KEFGPKLR+HMQYC
Sbjct  62   GYTYCVVADESFGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  RIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_011016724.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=221

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVPMAFLER++DDFV KYGGGKAATA AN L+KEFGPKL++HM+YC
Sbjct  62   GFTYCVVADESAGRQVPMAFLERVRDDFVSKYGGGKAATAQANGLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFRS GT
Sbjct  122  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRSQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMK+KLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  QIRRKMWLQNMKVKLIVLGILIALILIIVLSVCKGFNCGK  221



>gb|EYU43691.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
 gb|EYU43692.1| hypothetical protein MIMGU_mgv1a013245mg [Erythranthe guttata]
Length=226

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYC+VAEES GRQ+PMAFLERIKD+FV KYGGGKAAT PAN L+KEFGPKL++HMQYC
Sbjct  67   GFTYCIVAEESAGRQLPMAFLERIKDNFVAKYGGGKAATTPANGLNKEFGPKLKEHMQYC  126

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKV+AQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN H QAQDF++TGT
Sbjct  127  MDHPEEISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLHNQAQDFKTTGT  186

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVL I+IALILII+LSVC GFNCGK
Sbjct  187  KIRRKMWLQNMKIKLIVLAIVIALILIIILSVCKGFNCGK  226



>gb|KJB57019.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=222

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E  GRQVP+AFLER+K+DFV KYG GKAATAPANSL+KEFGPKL++HMQYC
Sbjct  62   GYTYCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+TGT
Sbjct  122  VEHPEEISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  220



>gb|AFY26886.1| vesicle-associated membrane protein 72 [Morella rubra]
Length=219

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVPMAFLERIKDDF+ +YGGGKA+TAPAN L+KEFGPKL++HM+YC
Sbjct  62   GYTYCVVADESVGRQVPMAFLERIKDDFLSRYGGGKASTAPANGLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+TGT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  182  QIRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>ref|XP_002322360.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
 gb|EEF06487.1| hypothetical protein POPTR_0015s15690g [Populus trichocarpa]
Length=219

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDFV KYGGGKAATA AN L+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAAESAGRQVPIAFLERVKDDFVTKYGGGKAATAQANGLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS GT
Sbjct  122  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +IRRKMWLQNMK+KLIVLGI+I LILIIVLS+C GFNC
Sbjct  182  QIRRKMWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>gb|KDP29315.1| hypothetical protein JCGZ_19410 [Jatropha curcas]
Length=221

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVPMAFLERIK+DF+ KYG GKA TA ANSL KEFGPKL++HMQYC
Sbjct  62   GYTYCVVADESAGRQVPMAFLERIKEDFMAKYGNGKATTAVANSLDKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNCGK  221



>gb|KJB57020.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=169

 Score =   253 bits (645),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G  YCVVA+E  GRQVP+AFLER+K+DFV KYG GKAATAPANSL+KEFGPKL++HMQYC
Sbjct  9    GIAYCVVADELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYC  68

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+TGT
Sbjct  69   VEHPEEISKLAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGT  128

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  129  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCG  167



>gb|ACU19359.1| unknown [Glycine max]
Length=221

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E  GRQ+PMAFLER+KD+FV KYGGGKAATAPANSL+KEFGPKLR+HMQYC
Sbjct  62   GYTYCVVADEPIGRQLPMAFLERVKDEFVSKYGGGKAATAPANSLNKEFGPKLREHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV EVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR++GT
Sbjct  122  VDHPEEISKLAKVKAQVFEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            +IRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCGK
Sbjct  182  RIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK  221



>ref|XP_002276767.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis 
vinifera]
 emb|CAN81365.1| hypothetical protein VITISV_015772 [Vitis vinifera]
 emb|CBI27181.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVPMAFLERI+DDFV +YGG KAATAPANSL+K+F  KL++HMQYC
Sbjct  62   GYTYCVVADESVGRQVPMAFLERIRDDFVARYGGEKAATAPANSLNKDFSSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVK QVSEVKGVMMENIEKV DRGEKIEL VDKT N H+QAQDFRS GT
Sbjct  122  VDHPEEISKLAKVKDQVSEVKGVMMENIEKVLDRGEKIELLVDKTHNLHEQAQDFRSAGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVLGI++ALILIIVLSVCHGFNCGK
Sbjct  182  KIRRKMWLQNMKIKLIVLGILVALILIIVLSVCHGFNCGK  221



>ref|XP_008459063.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=222

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQVP+AFLERIKDDFV KYGGGKA+TAPANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVATESAGRQVPIAFLERIKDDFVSKYGGGKASTAPANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDF+++GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHNQAQDFKTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCG
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>ref|XP_011040378.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDFV K+GGGKAATA AN L+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAAESAGRQVPIAFLERVKDDFVTKFGGGKAATAQANGLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRS GT
Sbjct  122  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +IRRKMWLQNMK+KLIVLGI+I LILIIVLS+C GFNC
Sbjct  182  QIRRKMWLQNMKVKLIVLGILIVLILIIVLSICKGFNC  219



>ref|XP_004145455.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004165486.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
Length=222

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQVP+AFLERIKDDFV KY GGKA+TAPANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVATESAGRQVPIAFLERIKDDFVSKYAGGKASTAPANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDF+++GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHTQAQDFKTSGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            KIRRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNCG
Sbjct  182  KIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCG  220



>gb|KHN08022.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   250 bits (638),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVP+AFLER+KDDFV KYGGGKAAT  ANSL+KEFG KL++HMQYC
Sbjct  66   GFTYCVVADESIGRQVPVAFLERVKDDFVAKYGGGKAATVAANSLNKEFGSKLKEHMQYC  125

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  126  VEHPEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  185

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  186  KIRRKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_006352702.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Solanum tuberosum]
Length=220

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL+KEFGPK++D MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKDQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGII+ALIL+IVLS+CHGFNC
Sbjct  182  KVRRKMWLQNMKIKLIVLGIILALILVIVLSICHGFNC  219



>ref|XP_006583934.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
 gb|KHN42974.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=225

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            FTYCVVA+ES GRQVP+AFLER KDDFV KYGGGKA TA ANSL+KEFG KL++HMQYC 
Sbjct  67   FTYCVVADESIGRQVPVAFLERAKDDFVAKYGGGKATTAAANSLNKEFGSKLKEHMQYCV  126

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            +HPEEISKLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GTK
Sbjct  127  EHPEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTK  186

Query  272  IRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            IRRKMWLQNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  187  IRRKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_004242395.1| PREDICTED: vesicle-associated membrane protein 721-like [Solanum 
lycopersicum]
Length=220

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL+KEFGPK+++ MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKIKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGII ALI++IVLS+CHGFNC
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIFALIMVIVLSICHGFNC  219



>ref|XP_009588661.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
tomentosiformis]
Length=220

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL++EFGPK+++ MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ GT
Sbjct  122  IDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMK+KLIVL II+ALIL+IVLS+CHGF C
Sbjct  182  KVRRKMWLQNMKVKLIVLAIIVALILVIVLSICHGFKC  219



>ref|XP_010069066.1| PREDICTED: putative vesicle-associated membrane protein 726 [Eucalyptus 
grandis]
Length=219

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA ANSL++EFGPKL++HMQYC
Sbjct  62   GFTYCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMWLQNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  182  KIRRKMWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  219



>emb|CDY10053.1| BnaC08g43980D [Brassica napus]
Length=220

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+AL LIIVLSVCHGF C
Sbjct  183  QMRRKMWLQNMKIKLIVLAIIVALTLIIVLSVCHGFKC  220



>ref|XP_003594451.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES64702.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+TGRQVPMAFLER+KDDFV KYGG KA+TAP NSL+KEFGPKL++HMQYC
Sbjct  66   GYTYCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYC  125

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N H QAQDFRS+GT
Sbjct  126  VDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFRSSGT  185

Query  275  KIRRKMWLQNM  243
             IRRKMWLQNM
Sbjct  186  SIRRKMWLQNM  196



>ref|XP_011020669.1| PREDICTED: vesicle-associated membrane protein 721 isoform X1 
[Populus euphratica]
Length=219

 Score =   243 bits (619),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRKQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMK+KLIVLGIIIALILIIVLSVCHGFNC
Sbjct  182  KMRRKMWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>gb|ACJ84389.1| unknown [Medicago truncatula]
Length=197

 Score =   241 bits (615),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+ GRQVP+AFLER+KDDFV KYGGGKA+TA  NSL+KEFGPKL++HMQYC
Sbjct  64   GYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYC  123

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  124  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  183

Query  275  KIRRKMWLQNM  243
            KIRRKMWLQNM
Sbjct  184  KIRRKMWLQNM  194



>ref|XP_010522416.1| PREDICTED: vesicle-associated membrane protein 725 [Tarenaya 
hassleriana]
Length=220

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIAL+LI+VLS+CHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALVLIMVLSICHGFKC  219



>ref|XP_004505324.1| PREDICTED: vesicle-associated membrane protein 722-like [Cicer 
arietinum]
Length=222

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES GRQVP+AFLER+KDDFV KYGGGKA+TA  NSL+KEFGPKL++HMQYC
Sbjct  66   GYTYCVVADESVGRQVPVAFLERVKDDFVVKYGGGKASTAAPNSLNKEFGPKLKEHMQYC  125

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  126  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  185

Query  275  KIRRKMWLQNM  243
            KIRRKMW+QNM
Sbjct  186  KIRRKMWMQNM  196



>emb|CDY18254.1| BnaC05g02770D [Brassica napus]
Length=220

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  183  QMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>ref|XP_009413307.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFLER+K+DF  KYG GKAATA ANSLS+EFG KL++HMQYC
Sbjct  62   GYTYCVVAVESVGRQIPIAFLERVKEDFNKKYGAGKAATASANSLSREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_010522412.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_003607843.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|ACJ83853.1| unknown [Medicago truncatula]
 gb|AES90040.1| synaptobrevin-like protein [Medicago truncatula]
Length=220

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+ GRQVP+AFLER+KDDFV KYGGGKA+TA  NSL+KEFGPKL++HMQYC
Sbjct  64   GYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYC  123

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  124  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  183

Query  275  KIRRKMWLQNM  243
            KIRRKMWLQNM
Sbjct  184  KIRRKMWLQNM  194



>gb|AFK40215.1| unknown [Medicago truncatula]
Length=220

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+ GRQVP+AFLER+KDDFV KYGGGKA+TA  NSL+KEFGPKL++HMQYC
Sbjct  64   GYTYCVVADETVGRQVPVAFLERVKDDFVAKYGGGKASTAAPNSLNKEFGPKLKEHMQYC  123

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  124  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  183

Query  275  KIRRKMWLQNM  243
            KIRRKMWLQNM
Sbjct  184  KIRRKMWLQNM  194



>ref|XP_009119258.1| PREDICTED: vesicle-associated membrane protein 721 [Brassica 
rapa]
 emb|CDX89793.1| BnaA10g02890D [Brassica napus]
Length=220

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  183  QMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  220



>ref|XP_009787803.1| PREDICTED: vesicle-associated membrane protein 721 [Nicotiana 
sylvestris]
Length=220

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDF  KYGGGKAATA ANSL++EFGPK+++ MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKDDFTKKYGGGKAATAVANSLNREFGPKMKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF++ GT
Sbjct  122  IDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMK+KLIVL IIIALIL+IVLS+CHGF C
Sbjct  182  KVRRKMWLQNMKVKLIVLAIIIALILVIVLSICHGFKC  219



>gb|AFK36461.1| unknown [Lotus japonicus]
Length=226

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYC+VA+ES GRQVPMAFLER+KDDFV KYG GKAATAPANSL+KEFGPKL++HMQYC
Sbjct  69   GYTYCIVADESVGRQVPMAFLERVKDDFVSKYGDGKAATAPANSLNKEFGPKLKEHMQYC  128

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  129  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRTSGT  188

Query  275  KIRRKMWLQNM  243
             IRRKM LQNM
Sbjct  189  SIRRKMRLQNM  199



>emb|CDX86608.1| BnaC08g00950D [Brassica napus]
Length=219

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_010038359.1| PREDICTED: vesicle-associated membrane protein 721-like [Eucalyptus 
grandis]
 gb|KCW50175.1| hypothetical protein EUGRSUZ_K03606 [Eucalyptus grandis]
Length=222

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G TYCVVA ES GRQ+PMAFLERIK+DF  +Y  GKAATA ANSL++EFGPKL++HMQYC
Sbjct  62   GLTYCVVAVESVGRQIPMAFLERIKEDFTHRYDAGKAATASANSLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            K+RRKMWLQNMKIKLIVLGIIIALIL+IVLSVCHGFNCG
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILVIVLSVCHGFNCG  220



>gb|KDP26403.1| hypothetical protein JCGZ_17561 [Jatropha curcas]
Length=219

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLERIK+DF  KY GGKAATA AN L+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERIKEDFTKKYAGGKAATAVANGLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>emb|CDY19450.1| BnaC04g11490D [Brassica napus]
Length=223

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+KDDF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  64   GFTYCVVAVDSAGRQIPMAFLERVKDDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  123

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  124  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  183

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  184  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|XP_010556949.1| PREDICTED: vesicle-associated membrane protein 721 [Tarenaya 
hassleriana]
Length=220

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAADSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_006304190.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 ref|XP_006418097.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
 ref|XP_010484183.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 ref|XP_010457533.1| PREDICTED: vesicle-associated membrane protein 721 [Camelina 
sativa]
 gb|EOA37088.1| hypothetical protein CARUB_v10010251mg [Capsella rubella]
 gb|ESQ36450.1| hypothetical protein EUTSA_v10008733mg [Eutrema salsugineum]
Length=219

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_002892239.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68498.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_010475139.1| PREDICTED: vesicle-associated membrane protein 721-like [Camelina 
sativa]
Length=219

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>gb|KFK42812.1| hypothetical protein AALP_AA1G041800 [Arabis alpina]
Length=219

 Score =   240 bits (612),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_010109710.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
 gb|EXC24180.1| Putative vesicle-associated membrane protein 726 [Morus notabilis]
Length=219

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQIPIAFLERIKEDFTKRYGGGKAATAVANSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLA VKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  IDHPEEISKLANVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+ ALILIIVLSVC GFNC
Sbjct  182  QMRRKMWLQNMKIKLIVLGILFALILIIVLSVCGGFNC  219



>ref|XP_002304708.1| synptobrevin-related family protein [Populus trichocarpa]
 gb|EEE79687.1| synptobrevin-related family protein [Populus trichocarpa]
Length=219

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMK+KLIVLGIIIALILIIVLSVCHGFNC
Sbjct  182  KMRRKMWIQNMKMKLIVLGIIIALILIIVLSVCHGFNC  219



>ref|XP_010932918.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=220

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
 gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma 
cacao]
Length=219

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>emb|CDY06150.1| BnaA09g50530D [Brassica napus]
Length=220

 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANS +KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  183  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>gb|KHG06809.1| hypothetical protein F383_08210 [Gossypium arboreum]
Length=219

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  182  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>ref|XP_009118621.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=220

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANS +KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVDSAGRQIPMAFLERVKEDFSKRYGGGKAATAQANSFNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  183  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  220



>ref|XP_010542985.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   239 bits (610),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPEEISKLGKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>gb|KJB57021.1| hypothetical protein B456_009G150900 [Gossypium raimondii]
Length=216

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  608  ESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADHPEEISK  429
            E  GRQVP+AFLER+K+DFV KYG GKAATAPANSL+KEFGPKL++HMQYC +HPEEISK
Sbjct  65   ELAGRQVPIAFLERVKEDFVSKYGSGKAATAPANSLNKEFGPKLKEHMQYCVEHPEEISK  124

Query  428  LAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIRRKMWLQ  249
            LAK+K+QVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+TGTKIRRKMWLQ
Sbjct  125  LAKIKSQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRNTGTKIRRKMWLQ  184

Query  248  NMkiklivlgiiialiliivLSVCHGFNCG  159
            NMKIKLIVLGI+IALILIIVLSVCHGFNCG
Sbjct  185  NMKIKLIVLGILIALILIIVLSVCHGFNCG  214



>gb|KDP20321.1| hypothetical protein JCGZ_06407 [Jatropha curcas]
Length=219

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+P+AFLER+K+DF  +YGGGKAATA AN L +EFGPKL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPIAFLERVKEDFKKRYGGGKAATAQANGLKREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  MDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KI+RKMW++NMK+KLIV GI++ALILIIVLSVCHGFNC
Sbjct  182  KIKRKMWIENMKMKLIVFGIVLALILIIVLSVCHGFNC  219



>ref|XP_007049803.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
 gb|EOX93960.1| Vesicle-associated membrane protein 726 [Theobroma cacao]
Length=219

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GF+YCVVA ES GRQVP+AFLERIK+DF   YGGGKAATAPANSLS+EFGPKL++HMQYC
Sbjct  62   GFSYCVVAIESVGRQVPIAFLERIKEDFTKIYGGGKAATAPANSLSREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  IDHPEEISKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IALILII+LSVC GF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALILIIILSVCGGFKC  219



>ref|XP_009132911.1| PREDICTED: vesicle-associated membrane protein 722-like [Brassica 
rapa]
 emb|CDX84702.1| BnaA03g15280D [Brassica napus]
Length=222

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  183  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  222



>emb|CDX79510.1| BnaC03g18460D [Brassica napus]
Length=222

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  63   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  123  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL I+IALILIIVLSVC GFNCGK
Sbjct  183  QMRRKMWFQNMKIKLIVLAIVIALILIIVLSVCGGFNCGK  222



>ref|NP_171967.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 sp|Q9ZTW3.1|VA721_ARATH RecName: Full=Vesicle-associated membrane protein 721; Short=AtVAMP721; 
AltName: Full=v-SNARE synaptobrevin 7B; Short=AtVAMP7B 
[Arabidopsis thaliana]
 gb|AAC98905.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 gb|AAL85003.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 gb|AAM91491.1| At1g04740/T1G11_1 [Arabidopsis thaliana]
 dbj|BAD42978.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43361.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43374.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43437.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43557.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43592.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43735.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD43994.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44048.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44054.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44149.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44415.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44419.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 dbj|BAD44642.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27738.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=219

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>ref|XP_009143895.1| PREDICTED: vesicle-associated membrane protein 722 [Brassica 
rapa]
 emb|CDY17139.1| BnaA05g10490D [Brassica napus]
Length=223

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  64   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  123

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  124  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  183

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  184  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  223



>ref|XP_008235502.1| PREDICTED: vesicle-associated membrane protein 722 [Prunus mume]
Length=219

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAIGRQIPIAFLERIKEDFTSRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IALILIIVLSVC GFNC
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALILIIVLSVCKGFNC  219



>ref|XP_010509926.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
 ref|XP_010413909.1| PREDICTED: vesicle-associated membrane protein 722 isoform X1 
[Camelina sativa]
 ref|XP_010413910.1| PREDICTED: vesicle-associated membrane protein 722 isoform X2 
[Camelina sativa]
 ref|XP_010469516.1| PREDICTED: vesicle-associated membrane protein 722 [Camelina 
sativa]
Length=221

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_006650747.1| PREDICTED: vesicle-associated membrane protein 721-like [Oryza 
brachyantha]
Length=220

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFL+R+KDDF  +YGGGKAATA  NSL+++FG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLDRVKDDFTKRYGGGKAATAATNSLNRDFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  ADHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  QVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006420620.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006420621.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 ref|XP_006489783.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Citrus sinensis]
 gb|ESR33860.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|ESR33861.1| hypothetical protein CICLE_v10005852mg [Citrus clementina]
 gb|KDO49379.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
 gb|KDO49380.1| hypothetical protein CISIN_1g0277592mg [Citrus sinensis]
Length=219

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  KMRRKMWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>ref|XP_006410450.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
 gb|ESQ51903.1| hypothetical protein EUTSA_v10017216mg [Eutrema salsugineum]
Length=221

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_008775432.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=220

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKA+VSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAEVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQHGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
 gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma 
cacao]
Length=219

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVLGI+IALILIIVLSVCHGF C
Sbjct  182  KMRRKMWFQNMKIKLIVLGILIALILIIVLSVCHGFKC  219



>emb|CDY15521.1| BnaA08g28050D [Brassica napus]
Length=219

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_011080177.1| PREDICTED: vesicle-associated membrane protein 721 [Sesamum indicum]
Length=220

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  KYGGGKAATA ANSL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLERVKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>dbj|BAD43410.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
Length=219

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TG+
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGS  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  219



>gb|KJB37798.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=219

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  182  NMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  219



>ref|XP_009111083.1| PREDICTED: vesicle-associated membrane protein 721-like [Brassica 
rapa]
Length=219

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQASSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVL II+ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLAIIVALILIIVLSVCHGFKC  219



>ref|XP_002264270.1| PREDICTED: vesicle-associated membrane protein 721 [Vitis vinifera]
 emb|CBI40837.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGKAATA AN L+KEFGPKL++HMQYC
Sbjct  63   GFTYCVVAVESAGRQIPIAFLERVKDDFNKRYGGGKAATAVANGLNKEFGPKLKEHMQYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  123  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  183  KMRRKMWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  220



>ref|XP_006294968.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
 gb|EOA27866.1| hypothetical protein CARUB_v10024024mg [Capsella rubella]
Length=221

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMA+LER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAYLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>gb|KCW57284.1| hypothetical protein EUGRSUZ_H00084 [Eucalyptus grandis]
Length=378

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA ANSL++EFGPKL++HMQYC
Sbjct  221  GFTYCVVAAESAGRQIPIAFLERIKDDFNKRYGGGKATTAAANSLNREFGPKLKEHMQYC  280

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  GT
Sbjct  281  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFKQQGT  340

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMWLQNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  341  KIRRKMWLQNMKIKLIVLGIIVALILIIILSVCHGFKC  378



>ref|XP_002267063.1| PREDICTED: vesicle-associated membrane protein 722 [Vitis vinifera]
 emb|CBI37278.3| unnamed protein product [Vitis vinifera]
Length=219

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL+KEFGPKL++ MQYC
Sbjct  62   GYTYCVVAVEAVGRQIPIAFLERVKEDFTKRYGGGKAATAVANSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLS+C GFNC
Sbjct  182  KMRRKMWLQNMKIKLIVLGILIALILIIVLSICGGFNC  219



>emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera]
Length=200

 Score =   236 bits (602),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGKAATA AN L+KEFGPKL++HMQYC
Sbjct  43   GFTYCVVAVESAGRQIPIAFLERVKDDFNKRYGGGKAATAVANGLNKEFGPKLKEHMQYC  102

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  103  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  162

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  163  KMRRKMWMQNMKIKLIVLGIIIALILIIVLSICHGFKC  200



>ref|XP_010264069.1| PREDICTED: vesicle-associated membrane protein 722 [Nelumbo nucifera]
Length=219

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGKAATA ANSL+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPVAFLERVKDDFNKRYGGGKAATAVANSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+ KLAKVKAQVSEVK VMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVGKLAKVKAQVSEVKEVMMENIEKVLDRGEKIELLVDKTENLKSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLS+CHGFNC
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>ref|XP_009336053.1| PREDICTED: vesicle-associated membrane protein 722, partial [Pyrus 
x bretschneideri]
Length=182

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  25   GFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  84

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  85   VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  144

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMK+KLIVLGI+IALILIIVLSVC+GF C
Sbjct  145  QMRRKMWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  182



>ref|XP_010674670.1| PREDICTED: vesicle-associated membrane protein 722 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+KDDF  ++GGGKAATA A SL+K+FGPKL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKDDFNKRFGGGKAATAQAKSLNKDFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE++KLAKV+AQ+SEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEMNKLAKVQAQISEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMW QNMKIKLIVLGIIIALILIIVLS+CHGFNCGK
Sbjct  182  KMRRKMWFQNMKIKLIVLGIIIALILIIVLSICHGFNCGK  221



>ref|NP_001280954.1| putative vesicle-associated membrane protein 726 [Malus domestica]
 gb|AGG35508.1| vesicle-associated membrance protein [Malus domestica]
Length=219

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMK+KLIVLGI+IALILIIVLSVC+GF C
Sbjct  182  QMRRKMWLQNMKVKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_010241141.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nelumbo 
nucifera]
Length=219

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KDDF  +YGGGK  TA A SL+KEFGPKL+ HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKDDFSKRYGGGKGTTASAKSLNKEFGPKLKQHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW +NMKIKLIVLGI +AL+LIIVLS+CHGFNC
Sbjct  182  KLKRKMWWENMKIKLIVLGIFVALVLIIVLSICHGFNC  219



>gb|AAB80624.1| Strong similarity to Arabidopsis ATHSAR1 (gb|M90418). ESTs gb|T44122,gb|N65276,gb|AA041135 
come from this gene [Arabidopsis 
thaliana]
Length=175

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            F+YCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC 
Sbjct  19   FSYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCM  78

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT+
Sbjct  79   DHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQ  138

Query  272  IRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +RRKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  139  MRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  175



>ref|XP_010556950.1| PREDICTED: vesicle-associated membrane protein 721-like [Tarenaya 
hassleriana]
Length=220

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGIIIALILIIVLS+CHGF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGIIIALILIIVLSICHGFKC  219



>ref|XP_006443628.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 ref|XP_006479311.1| PREDICTED: vesicle-associated membrane protein 722-like [Citrus 
sinensis]
 gb|ESR56868.1| hypothetical protein CICLE_v10022162mg [Citrus clementina]
 gb|KDO65900.1| hypothetical protein CISIN_1g027720mg [Citrus sinensis]
Length=219

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+K+DF+ +YGGGKAATA AN L+KEFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKEDFIKRYGGGKAATAVANGLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VD+TEN   QAQDFR  GT
Sbjct  122  IDHPEEISKLAKVKAQVSEVKGVMMDNIEKVLDRGEKIELLVDRTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVLGIIIALILIIVLSVC GFNC
Sbjct  182  QMRRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>ref|XP_009351028.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L++EFGPKL+DHM+YC
Sbjct  62   GFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  182  KMKRKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_007200442.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
 gb|EMJ01641.1| hypothetical protein PRUPE_ppa011218mg [Prunus persica]
Length=219

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAIGRQIPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>gb|EYU46345.1| hypothetical protein MIMGU_mgv1a013442mg [Erythranthe guttata]
Length=220

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIK+DF  KYGGGKAATA ANSL+KEFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAYLERIKEDFTKKYGGGKAATAVANSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGII+ALILIIVLSVC GF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGIIVALILIIVLSVCGGFKC  219



>gb|KFK31144.1| hypothetical protein AALP_AA6G074500 [Arabis alpina]
Length=220

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K++F  +YGGGKA TA ANSL+KEFG KL+DHMQYC
Sbjct  62   GFTYCVVAIESVGRQIPMAFLERVKEEFNKRYGGGKATTAKANSLNKEFGSKLKDHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVLGI+IALILII+LSVCHGF C
Sbjct  182  KIRRKMWFENMKIKLIVLGIVIALILIIILSVCHGFKC  219



>ref|XP_008803805.1| PREDICTED: putative vesicle-associated membrane protein 726 [Phoenix 
dactylifera]
Length=220

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFKKRYGGGKAATASANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEIS LAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISNLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KIRRKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_002521112.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF41263.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=220

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLERIK++F  KYGGGKAATA ANSL+KEFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERIKEEFTKKYGGGKAATATANSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_006418096.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
 gb|ESQ36449.1| hypothetical protein EUTSA_v10008729mg [Eutrema salsugineum]
Length=220

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL+ HMQYC
Sbjct  62   GFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKAATAKANSLNKEFGSKLKQHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ FR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQAFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWL NMKIKL+V GII+ALILII LSVCHGF C
Sbjct  182  KMRRKMWLDNMKIKLVVFGIIVALILIIFLSVCHGFKC  219



>gb|EPS70718.1| hypothetical protein M569_04041 [Genlisea aurea]
Length=220

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+RIK+DFV KY GGKAATA ANSL+KEFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRIKEDFVKKYSGGKAATAVANSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRMQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW QNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  182  KIRRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_011083121.1| PREDICTED: vesicle-associated membrane protein 721-like [Sesamum 
indicum]
Length=220

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKAATA ANSL++EFG KL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQLPIAFLERIKDDFTKKYGGGKAATAVANSLNREFGSKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RR+MWLQNMKIKLIVL II+ALILIIVLSVC GF C
Sbjct  182  KMRRRMWLQNMKIKLIVLAIIVALILIIVLSVCGGFKC  219



>ref|XP_009627066.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
tomentosiformis]
 ref|XP_009777065.1| PREDICTED: vesicle-associated membrane protein 722 [Nicotiana 
sylvestris]
Length=220

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLIVLGIIIALILIIVLSVC GFNC
Sbjct  182  TMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFNC  219



>ref|XP_004134008.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004157674.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN56755.1| hypothetical protein Csa_3G132570 [Cucumis sativus]
Length=219

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAIEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  LDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVLGII+ALILII+LSVCHGF C
Sbjct  182  KMRRKMWFQNMKIKLIVLGIIVALILIIILSVCHGFQC  219



>ref|XP_009370116.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L+ EFGPKL+DHM+YC
Sbjct  62   GFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  182  KMKRKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|XP_009371395.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009371400.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=219

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_008371850.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_008371869.1| PREDICTED: vesicle-associated membrane protein 722-like [Malus 
domestica]
 ref|XP_009357270.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
 ref|XP_009378895.1| PREDICTED: vesicle-associated membrane protein 722-like [Pyrus 
x bretschneideri]
Length=221

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQVP+AFLER+KDDFV KYG GKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GYTYCVVADESSGRQVPIAFLERVKDDFVAKYGAGKAATAAANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRTVGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVLGI+IALILII+LS+CHGFNCGK
Sbjct  182  KMRRKMWLQNMKVKLIVLGILIALILIIILSICHGFNCGK  221



>gb|ADK78986.1| VAMP721 [Petunia integrifolia subsp. inflata]
Length=220

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKAATA A SL+KEFGPKL++HM+YC
Sbjct  62   GFTYCVVATESAGRQIPIAFLERIKDDFTKRYGGGKAATATAKSLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEISKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRK+W +NMKIKLIVLGIIIALILII+LSVC GFNC
Sbjct  182  KIRRKLWYENMKIKLIVLGIIIALILIIILSVCPGFNC  219



>ref|XP_004290222.1| PREDICTED: vesicle-associated membrane protein 722 [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEALGRQVPIAFLERIKEDFTNRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  182  QMRRKMWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|NP_180871.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 sp|P47192.2|VA722_ARATH RecName: Full=Vesicle-associated membrane protein 722; Short=AtVAMP722; 
AltName: Full=Synaptobrevin-related protein 1 [Arabidopsis 
thaliana]
 gb|AAL31896.1|AF419564_1 At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAC04921.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL62414.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAL79587.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AAM48025.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM64431.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAM91096.1| At2g33120/F25I18.14 [Arabidopsis thaliana]
 gb|AEC08787.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=221

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>ref|XP_008438380.1| PREDICTED: putative vesicle-associated membrane protein 726 [Cucumis 
melo]
Length=219

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA A+SL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAAGRQIPIAFLERVKEDFNKRYGGGKAATAVAHSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  LDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_009335952.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Pyrus x bretschneideri]
Length=220

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L  EFGPKL+DHM+YC
Sbjct  62   GFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLPSEFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  182  KMKRKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>ref|NP_001030968.1| vesicle-associated membrane protein 7B [Arabidopsis thaliana]
 dbj|BAD44122.1| putative vesicle-associated membrane protein, synaptobrevin 7B 
[Arabidopsis thaliana]
 gb|AEE27739.1| vesicle-associated membrane protein 721 [Arabidopsis thaliana]
Length=181

 Score =   233 bits (594),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA +S GRQ+PM+FLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC DH
Sbjct  27   YCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  86

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            P+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+TGT++R
Sbjct  87   PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMR  146

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RKMWLQNMKIKLIVL IIIALILIIVLSVCHGF C
Sbjct  147  RKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC  181



>ref|XP_004293741.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=221

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVP+AFLER+KDDFV KYGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVADESAGRQVPIAFLERVKDDFVAKYGGGKAATAAANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE  H QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTETLHHQAQDFRNVGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMK+KLIVLGI+IALILII+LSVCHGFNCGK
Sbjct  182  KMRRKMWLQNMKVKLIVLGILIALILIIILSVCHGFNCGK  221



>emb|CDP03855.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  KYGGGKAATA ANSL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQLPIAFLERIKEDFTKKYGGGKAATAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILIIVLSVC G  C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGVKC  219



>ref|XP_002889523.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65782.1| vesicle-associated membrane protein 7B [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RK+W +NMKIKLIV GII+ALILII+LSVCHGF C
Sbjct  182  KMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|XP_011034474.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
 ref|XP_011034475.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +Y GGKAATA A SL+ EFG KL+ HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN H QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVL IIIALILIIVLS+CHGFNC
Sbjct  182  KMRRKMWIQNMKIKLIVLAIIIALILIIVLSICHGFNC  219



>gb|KJB10140.1| hypothetical protein B456_001G186000 [Gossypium raimondii]
Length=219

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAATA ANSLSKEFGPKL++HM+YC
Sbjct  62   GYTYCVVAVESVGRQVPIAFLERIKEDFTKRYGGGKAATASANSLSKEFGPKLKEHMEYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISK+AKVKAQVSEVKGVMMENIEKV DRG KIE+ VDKTEN   QAQDFR  GT
Sbjct  122  IDHPEEISKIAKVKAQVSEVKGVMMENIEKVLDRGGKIEILVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMK+KLIVLGI+IALILIIVLS+C GF+C
Sbjct  182  RMRRKMWLQNMKVKLIVLGILIALILIIVLSICGGFHC  219



>ref|XP_002518125.1| Vesicle-associated membrane protein, putative [Ricinus communis]
 gb|EEF44258.1| Vesicle-associated membrane protein, putative [Ricinus communis]
Length=219

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA A+ L++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAQAHGLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVLGIIIALILIIVLSVCHGF C
Sbjct  182  KMRRKMWIQNMKIKLIVLGIIIALILIIVLSVCHGFKC  219



>gb|ABK22119.1| unknown [Picea sitchensis]
 gb|ABK25940.1| unknown [Picea sitchensis]
Length=222

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GF YCVVA+ES GRQVPMAFLER+K+DF  +YGGG+A TA  NSL+++FG KL++HMQYC
Sbjct  62   GFAYCVVADESVGRQVPMAFLERVKEDFKRRYGGGRADTAVGNSLNRDFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDF+  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRFQAQDFQKQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMK+KLIVLGI++ALILIIVLSVCHGFNC K
Sbjct  182  QLRRKMWFQNMKVKLIVLGIVVALILIIVLSVCHGFNCSK  221



>ref|XP_008372458.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
Length=219

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQVPIAFLERIKEDFXGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVLGI+IALILIIVLSVC+GF C
Sbjct  182  QMRRKMWFQNMKIKLIVLGILIALILIIVLSVCNGFKC  219



>ref|XP_004247095.1| PREDICTED: vesicle-associated membrane protein 722 [Solanum lycopersicum]
Length=220

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  182  TMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>gb|KJB37799.1| hypothetical protein B456_006G220500 [Gossypium raimondii]
Length=160

 Score =   231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
             YCVVA ES GRQVP+AFLER+K+DF  +YGGGKAATA A SL++EFG KL++HMQYC D
Sbjct  5    AYCVVAVESAGRQVPIAFLERVKEDFNKRYGGGKAATATAKSLNREFGSKLKEHMQYCVD  64

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT +
Sbjct  65   HPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNM  124

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNC
Sbjct  125  RRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC  160



>ref|NP_171968.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
 sp|Q9MAS5.2|VA726_ARATH RecName: Full=Putative vesicle-associated membrane protein 726; 
Short=AtVAMP726 [Arabidopsis thaliana]
 gb|AEE27740.1| vesicle-associated membrane protein 726 [Arabidopsis thaliana]
Length=220

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RK+W +NMKIKLIV GII+ALILII+LSVCHGF C
Sbjct  182  KMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  219



>ref|XP_008380599.1| PREDICTED: putative vesicle-associated membrane protein 726 [Malus 
domestica]
 ref|XP_009376355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Pyrus 
x bretschneideri]
Length=220

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIKDDF  +YGGGKAATA AN L++EFGPKL+DHM+YC
Sbjct  62   GFTYCVVAAESAGRQIPIAYLERIKDDFNKRYGGGKAATAVANGLNREFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW QNMK+KLIV+GI+I + L+I L++C GF C
Sbjct  182  KMKRKMWFQNMKMKLIVVGILILIALMIYLTICRGFKC  219



>ref|XP_010910152.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=220

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLER+K+DF  +YGGGKAATA AN L++EFGPKL++HMQYC
Sbjct  62   GFTYCVVAVEAAGRQIPIAFLERVKEDFKKRYGGGKAATASANGLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI KLAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEIGKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVLGI+IALILII+LSVCHGF C
Sbjct  182  KMRRKMWWQNMKIKLIVLGILIALILIIILSVCHGFKC  219



>ref|XP_007157801.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
 gb|ESW29795.1| hypothetical protein PHAVU_002G099400g [Phaseolus vulgaris]
Length=226

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA+ES GRQVP+AFLER+KDDF+ KYGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  66   GFTYCVVADESIGRQVPVAFLERVKDDFLAKYGGGKAATAAANSLNKEFGSKLKEHMQYC  125

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR++GT
Sbjct  126  VEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGT  185

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMWLQNMK+KLIVL I+IALILIIVLSVC GFNCGK
Sbjct  186  KIRRKMWLQNMKVKLIVLAILIALILIIVLSVCRGFNCGK  225



>ref|XP_003556884.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
Length=221

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KD+F  KYGGGKAATA ANSL++EFGPKL+  MQYC
Sbjct  62   GFTYCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW+QNMK+KLIV GI +ALILI+ +S+C GF+C
Sbjct  182  KVKRKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>ref|XP_006364264.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=220

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER K++F  KYGGGKAATA ANSL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLERTKEEFTKKYGGGKAATAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRLQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLIVLGIIIALILIIVLSVC GF C
Sbjct  182  TMRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFKC  219



>ref|XP_009408466.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA E+ GRQ+P+AFL+RIK+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GYTYCVVAVEALGRQIPIAFLDRIKEDFNKRYGGGKAATAVANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEIS+LAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+ H QAQDFR  GT
Sbjct  122  VDHPEEISRLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTESLHSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVL IIIALILII+LSVCHGF C
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIILSVCHGFKC  219



>ref|XP_009132860.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDX84731.1| BnaA03g14990D [Brassica napus]
Length=220

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIV GIIIALILII+LSVCHGF C
Sbjct  182  KIRRKMWFENMKIKLIVAGIIIALILIIILSVCHGFKC  219



>gb|KDO77465.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=143

 Score =   229 bits (584),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -3

Query  584  MAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADHPEEISKLAKVKAQV  405
            MAFLER+KD+FV KYGGGKAATAPAN L+KEFGPKL++ MQYC DHPEEISKLAKVKAQV
Sbjct  1    MAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDHPEEISKLAKVKAQV  60

Query  404  SEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIRRKMWLQNMkikliv  225
            SEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRSTGTK+RRKMWLQNMKIKLIV
Sbjct  61   SEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRKMWLQNMKIKLIV  120

Query  224  lgiiialiliivLSVCHGFNCGK  156
            LGI+IALILIIVLSVCHGFNCGK
Sbjct  121  LGILIALILIIVLSVCHGFNCGK  143



>ref|XP_009398406.1| PREDICTED: putative vesicle-associated membrane protein 726 [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   232 bits (591),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFL+RIK+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GYTYCVVAVESVGRQIPIAFLDRIKEDFNKRYGGGKAATARANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV +RGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLERGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW++NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWMKNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|AAA56991.1| formerly called HAT24; synaptobrevin-related protein [Arabidopsis 
thaliana]
Length=221

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  MAHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  221



>gb|AAC04496.1| putative synaptobrevin [Arabidopsis thaliana]
Length=220

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVLGIII LILII+LSVC GF C
Sbjct  182  KIRRKMWFENMKIKLIVLGIIITLILIIILSVCGGFKC  219



>gb|KFK31080.1| hypothetical protein AALP_AA6G065800 [Arabis alpina]
Length=221

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  IDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW +NMKIKLIVL IIIALILIIVLSVC GF C K
Sbjct  182  QMRRKMWFKNMKIKLIVLAIIIALILIIVLSVCGGFKCTK  221



>ref|XP_004152023.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 ref|XP_004169386.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Cucumis sativus]
 gb|KGN58350.1| hypothetical protein Csa_3G625650 [Cucumis sativus]
Length=219

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLER+ +DFV +YGGGKA TA ANSL+KEFG KL++HM+YC
Sbjct  62   GFTYCVVAVETAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMK+KLIVL II+ALILII+LSVC GFNC
Sbjct  182  KMRRKMWYQNMKMKLIVLAIILALILIIILSVCGGFNC  219



>gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Erythranthe guttata]
Length=219

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKA TA  N L KEFGPKL+D MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAGTAGPNGLKKEFGPKLKDQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISK+AKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKIAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW+QNMKIKL V GI +AL L++ LS+CHGF C
Sbjct  182  KMKRKMWVQNMKIKLAVFGIFVALGLVVFLSICHGFKC  219



>ref|XP_006306317.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
 gb|EOA39215.1| hypothetical protein CARUB_v10012187mg [Capsella rubella]
Length=220

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RK+W +NMKIKLIV GI++ALILIIVLSVC GF C
Sbjct  182  KMKRKLWFENMKIKLIVFGIVVALILIIVLSVCPGFKC  219



>ref|XP_002881263.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57522.1| hypothetical protein ARALYDRAFT_482248 [Arabidopsis lyrata subsp. 
lyrata]
Length=231

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC DH
Sbjct  75   YCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDH  134

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            P+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT++R
Sbjct  135  PDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMR  194

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            RKMW QNMKIKLIVL IIIALILII+LSVC GFNCGK
Sbjct  195  RKMWFQNMKIKLIVLAIIIALILIIILSVCGGFNCGK  231



>dbj|BAJ88124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES G+Q+P+AFL R+KDDF  +Y GGKAATA  +SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGQQMPIAFLVRVKDDFSKRYAGGKAATAAPSSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKV+AQVSEVK VMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEINKLAKVQAQVSEVKNVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMWLQNMKIKLIVLGII+ALILII+LSVCHGFNCGK
Sbjct  182  QVRRKMWLQNMKIKLIVLGIIVALILIIILSVCHGFNCGK  221



>ref|XP_008465086.1| PREDICTED: vesicle-associated membrane protein 722-like [Cucumis 
melo]
Length=219

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+AFLER+ +DFV +YGGGKA TA ANSL+KEFG KL++HM+YC
Sbjct  62   GFTYCVVAVEAAGRQIPIAFLERVNEDFVKRYGGGKAMTATANSLNKEFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVL I++ALILII+LSVC GFNC
Sbjct  182  KMRRKMWYQNMKIKLIVLAIVLALILIIILSVCGGFNC  219



>ref|XP_006857408.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
 gb|ERN18875.1| hypothetical protein AMTR_s00067p00148060 [Amborella trichopoda]
Length=217

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ PMAFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQAPMAFLERVKEDFNKRYGGGKAATAVANSLNREFGTKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFRS GT
Sbjct  122  VDHPEEMSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRSQGT  181

Query  275  KIRRKMWLQNM  243
            K+RRKMWLQNM
Sbjct  182  KMRRKMWLQNM  192



>gb|AAQ15287.1| synptobrevin-related protein [Pyrus pyrifolia]
Length=194

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQVP+AFLERIK+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQVPIAFLERIKEDFTGRYGGGKAATAVANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNM  243
            ++RRKMWLQNM
Sbjct  182  QMRRKMWLQNM  192



>ref|XP_003535217.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Glycine max]
 gb|KHN16316.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G TYCVVA ES GRQ+P+AFLER KD+F  KYGGGKAATA ANSL++EFGPKL+  MQYC
Sbjct  62   GVTYCVVAIESAGRQLPIAFLERTKDEFTQKYGGGKAATASANSLNREFGPKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW+QNMK+KLIV GI +ALILI+ +S+C GF+C
Sbjct  182  KVKRKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  219



>gb|KFK42811.1| hypothetical protein AALP_AA1G041700 [Arabis alpina]
Length=220

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVVIESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMWL NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  182  KMKRKMWLDNMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_007226125.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
 gb|EMJ27324.1| hypothetical protein PRUPE_ppa011188mg [Prunus persica]
Length=220

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+YC
Sbjct  62   GFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW QNMKIKLIV+GIII +  +I LS+CHGF C
Sbjct  182  KMKRKMWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>ref|XP_003604990.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES87187.1| synaptobrevin-like protein [Medicago truncatula]
 gb|AFK36407.1| unknown [Medicago truncatula]
Length=219

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGG+A TA A SL+KEFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLERIKDDFNKRYGGGRATTATAKSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEE+SKLAKVKAQVSEVKGVMMENI+KV DRGEKIE+ VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEVSKLAKVKAQVSEVKGVMMENIDKVIDRGEKIEVLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVCHGF+C
Sbjct  182  QLRRKMWYQNMKIKLIVLAIIIALILIIVLSVCHGFSC  219



>gb|EYU17981.1| hypothetical protein MIMGU_mgv1a013452mg [Erythranthe guttata]
Length=220

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFT+CVVA ES GRQ+P+A+LERIKDDF  KYGGGKAATA ANSL KEFGPKL++ MQYC
Sbjct  62   GFTFCVVAVESVGRQIPIAYLERIKDDFTKKYGGGKAATAVANSLKKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEVSKMAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVLGII+ALILII+LS+C GF C
Sbjct  182  QMRRKMWFQNMKIKLIVLGIIVALILIIILSICGGFKC  219



>ref|NP_180826.2| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
 sp|O48850.2|VA725_ARATH RecName: Full=Vesicle-associated membrane protein 725; Short=AtVAMP725 
[Arabidopsis thaliana]
 dbj|BAC42934.1| putative synaptobrevin [Arabidopsis thaliana]
 gb|AAP06822.1| putative synaptobrevin protein [Arabidopsis thaliana]
 gb|AEC08714.1| vesicle-associated membrane protein 725 [Arabidopsis thaliana]
Length=285

 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQYC
Sbjct  127  GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYC  186

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  187  VDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  246

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVLGIII LILII+LSVC GF C
Sbjct  247  KIRRKMWFENMKIKLIVLGIIITLILIIILSVCGGFKC  284



>ref|XP_010413912.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X1 [Camelina sativa]
Length=221

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DR   IE+ VDKTEN   QAQDF++ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_010469563.1| PREDICTED: vesicle-associated membrane protein 725-like [Camelina 
sativa]
Length=220

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW  NMKIKLIV GII+AL+LII+LSVC GF C
Sbjct  182  KLKRKMWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_008224587.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=220

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+YC
Sbjct  62   GFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  LDHPEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW QNMKIKLIV+GIII +  +I LS+CHGF C
Sbjct  182  KMKRKMWFQNMKIKLIVVGIIILIGFVIFLSICHGFKC  219



>ref|XP_009621355.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA A SL+KEFGPKL++HM+YC
Sbjct  62   GFTYCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRK+W +NMKIKLIVLGIIIALILII+LSVC GF+C
Sbjct  182  KIRRKLWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>ref|XP_006293513.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
 gb|EOA26411.1| hypothetical protein CARUB_v10024029mg [Capsella rubella]
Length=220

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA A SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQAKSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW +NMKIKLIV GI++ALILII+LSVCHGF C
Sbjct  182  KMRRKMWFENMKIKLIVFGIVVALILIIILSVCHGFKC  219



>ref|XP_010413966.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=220

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ GT
Sbjct  122  MDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW  NMKIKLIV GII+AL+LII+LSVC GF C
Sbjct  182  KLKRKMWYDNMKIKLIVFGIIMALVLIIILSVCPGFKC  219



>ref|XP_010413913.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Camelina sativa]
Length=221

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DR   IE+ VDKTEN   QAQDF++ GT
Sbjct  122  MDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRSAIIEILVDKTENLRSQAQDFKTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVC GFNCGK
Sbjct  182  QMRRKMWFQNMKIKLIVLAIIIALILIIVLSVCGGFNCGK  221



>ref|XP_010475140.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RK+W +NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  182  KMKRKLWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|XP_010457534.1| PREDICTED: putative vesicle-associated membrane protein 726 [Camelina 
sativa]
Length=219

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVVVESAGRQIPMAFLERVKEDFSKRYGGGKASTAKANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RK+W +NMKIKL+V GI++ALILII+LSVCHGF C
Sbjct  182  KMKRKLWFENMKIKLVVFGIVVALILIIILSVCHGFKC  219



>ref|NP_001031469.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
 dbj|BAH20114.1| AT2G33120 [Arabidopsis thaliana]
 gb|AEC08788.1| vesicle-associated membrane protein 722 [Arabidopsis thaliana]
Length=229

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
            +YCVVA +S GRQ+PMAFLER+K+DF  +YGGGKAATA ANSL+KEFG KL++HMQYC D
Sbjct  72   SYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMD  131

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT++
Sbjct  132  HPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQM  191

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            RRKMW QNMKIKLIVL IIIALILII+LS+C GFNCGK
Sbjct  192  RRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK  229



>ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55665.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRAQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW  NMKIKLIVLGIII LILII+LSVC G+ C
Sbjct  182  KMRRKMWFDNMKIKLIVLGIIITLILIIILSVCGGYKC  219



>gb|KEH41273.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K++F  KYGGGKAATA A SL+KE+GPKL+  MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEEFSKKYGGGKAATASARSLNKEYGPKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW+QNMKIKLI +GII  ++L+I +S+C GF+C
Sbjct  182  KMKRKMWIQNMKIKLIAVGIIFVIVLMIFMSICRGFSC  219



>ref|XP_009143949.1| PREDICTED: putative vesicle-associated membrane protein 726 [Brassica 
rapa]
 emb|CDY12188.1| BnaC04g12180D [Brassica napus]
Length=220

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+ MAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL+ HMQYC
Sbjct  62   GFTYCVVAVESAGRQITMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKGHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  VDHPEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KIRRKMWWENMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006360344.1| PREDICTED: vesicle-associated membrane protein 725-like [Solanum 
tuberosum]
Length=221

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPKL++HM+YC
Sbjct  62   GFTYCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTAAPKSLSKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             D+PEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDNPEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRK+W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  182  KIRRKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>emb|CDY19154.1| BnaA04g18940D [Brassica napus]
Length=220

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+PMAFLER+K+DF  +YGGGKA TA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIV GII ALILII++SVC GF C
Sbjct  182  KIRRKMWWENMKIKLIVAGIITALILIIIISVCPGFKC  219



>ref|XP_010524695.1| PREDICTED: putative vesicle-associated membrane protein 726 [Tarenaya 
hassleriana]
Length=219

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K++F  +YGGGKA+TA ANSL+KEFG KL++ MQYC
Sbjct  62   GFTYCVVAVESIGRQLPIAFLERVKEEFTKRYGGGKASTATANSLNKEFGSKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RR MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  182  KLRRNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_010069661.1| PREDICTED: vesicle-associated membrane protein 722 [Eucalyptus 
grandis]
 gb|KCW58076.1| hypothetical protein EUGRSUZ_H00803 [Eucalyptus grandis]
Length=220

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLER+KDDF  +YGGGKAATA A SL+KEFG KL++ MQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLERVKDDFTKRYGGGKAATAVAKSLNKEFGSKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNM  243
            +IRRKMWLQNM
Sbjct  182  QIRRKMWLQNM  192



>ref|XP_009767969.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  +YGGGKA TA A SL+KEFGPKL++HM+YC
Sbjct  62   GFTYCVVATESAGRQIPIAFLERIKDDFSKRYGGGKATTATAKSLNKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  G 
Sbjct  122  VEHPEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGI  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRK+W +NMKIKLIVLGIIIALILII+LSVC GF+C
Sbjct  182  KIRRKLWYENMKIKLIVLGIIIALILIIILSVCPGFDC  219



>ref|XP_009417150.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+ FL+R+K+DF  +YGGGKAATA ANSLS+EFG KL++ MQYC
Sbjct  62   GYTYCVVAVESVGRQIPIGFLDRVKEDFNKRYGGGKAATASANSLSREFGSKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DH EEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHSEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMK+KLIVLGIIIALILIIVLS+CHGF C
Sbjct  182  KMRRKMWLQNMKVKLIVLGIIIALILIIVLSICHGFKC  219



>ref|XP_002297816.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
 gb|EEE82621.2| hypothetical protein POPTR_0001s14430g [Populus trichocarpa]
Length=219

 Score =   227 bits (578),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +Y GGKAATA A SL+ EFG KL+ HMQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERVKEDFNKRYSGGKAATAVAKSLNGEFGSKLKGHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRG+KIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW+QNMKIKLIVLGIIIALILIIVLS+CHGFNC
Sbjct  182  KMRRKMWIQNMKIKLIVLGIIIALILIIVLSICHGFNC  219



>ref|XP_011016158.1| PREDICTED: vesicle-associated membrane protein 722-like [Populus 
euphratica]
Length=219

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GF+YCVVA ES GRQ+P+A+LERIK+DF  +YGGGKAA A ANSL++EFGPKL++ MQYC
Sbjct  62   GFSYCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRG KIEL VDKT+N H QAQDFR  GT
Sbjct  122  MDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGVKIELLVDKTDNLHSQAQDFRQHGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +IRRKMW QNMKIKLIVL I+IALI+IIVLS+C GF C
Sbjct  182  QIRRKMWWQNMKIKLIVLAILIALIIIIVLSICGGFKC  219



>ref|XP_004296647.1| PREDICTED: putative vesicle-associated membrane protein 726 [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+A+LERIKDDF  +Y GGKA TA AN L++EFGPKL++HM+YC
Sbjct  62   GFTYCVVAAESAGRQVPIAYLERIKDDFNKRYAGGKAGTATANGLNREFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDF+  GT
Sbjct  122  VEHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFKQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMK+KLIV GI++AL LI+ LS+C GF C
Sbjct  182  KMRRKMWFQNMKMKLIVAGIVVALGLILFLSICGGFKC  219



>gb|KJB42279.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=219

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDK+EN   QAQDFR  GT
Sbjct  122  IDHPEEVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IAL+LIIVLSVCHGFNC
Sbjct  182  QMRRKMWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  219



>ref|XP_004955737.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=222

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGFNCGK
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFNCGK  221



>gb|KJB71677.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71678.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
 gb|KJB71679.1| hypothetical protein B456_011G160700 [Gossypium raimondii]
Length=219

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  +YGGGKAATA A SL++EF  KL++HM+YC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERIKEDFSRRYGGGKAATATAKSLNREFKSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KI+RKMW++NMK+KLIV GI++AL+LIIVLS+C GF C
Sbjct  182  KIKRKMWIENMKMKLIVFGIVLALVLIIVLSICPGFKC  219



>emb|CDO99425.1| unnamed protein product [Coffea canephora]
Length=182

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
             TYCVVA E+ GRQ+P+AFLERIK+DF  +YGGGKA+TA A SL+KEFGPKL++HM+YC 
Sbjct  25   ITYCVVAAEAAGRQLPIAFLERIKEDFHKRYGGGKASTASAKSLNKEFGPKLKEHMKYCV  84

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHPEEI+KLAK+KAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GTK
Sbjct  85   DHPEEINKLAKIKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTK  144

Query  272  IRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RKMW+QNMKIKLIV GII+A++LII+LSVC GF C
Sbjct  145  MKRKMWVQNMKIKLIVAGIILAILLIIILSVCPGFKC  181



>ref|XP_009757440.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
sylvestris]
Length=220

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GR++P+AFL+R+KDDF  +Y GGKAATA A SL++EFG KL++HM+YC
Sbjct  62   GFTYCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVL III +ILII+LSVC GF C
Sbjct  182  KIRRKMWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>ref|XP_009608699.1| PREDICTED: putative vesicle-associated membrane protein 726 [Nicotiana 
tomentosiformis]
Length=220

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GR++P+AFL+R+KDDF  +Y GGKAATA A SL++EFG KL++HM+YC
Sbjct  62   GFTYCVVATESAGREIPIAFLDRVKDDFSKRYAGGKAATASAKSLNREFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIVL III +ILII+LSVC GF C
Sbjct  182  KIRRKMWYENMKIKLIVLAIIIIIILIIILSVCPGFKC  219



>ref|XP_009335953.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Pyrus x bretschneideri]
Length=220

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ++    +P+A+LERIKDDF  +YGGGKAATA AN L+ EFGPKL+DHM+YC
Sbjct  62   GFTYCVVAADAVANGLPIAYLERIKDDFNKRYGGGKAATAVANGLNSEFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMWLQNMK+KLIV+ I++ + LII LS+C GF C
Sbjct  182  KMKRKMWLQNMKMKLIVVAILVVIALIIYLSICRGFKC  219



>gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin homolog F25I18.14 gi|2924792 
from A. thaliana on BAC gb|AC002334 [Arabidopsis thaliana]
Length=229

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 142/167 (85%), Gaps = 9/167 (5%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+PMAFLER+K+DF  +YGGGKA+TA ANSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQ---------  303
            ADHPEEISKL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   Q         
Sbjct  122  ADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQVNNNHISNT  181

Query  302  AQDFRSTGTKIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            AQDFR+ GTK++RK+W +NMKIKLIV GII+ALILII+LSVCHGF C
Sbjct  182  AQDFRTQGTKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC  228



>gb|EPS61521.1| hypothetical protein M569_13274 [Genlisea aurea]
Length=220

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTY VVA ES GRQ+P+AFLERIKDDF+ KY GGKAATA ANSL+K+FGPKL++ MQ+C
Sbjct  62   GFTYGVVAVESLGRQIPIAFLERIKDDFIKKYSGGKAATAVANSLNKDFGPKLKEQMQFC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HP+EISK++KVKAQVSEVKGVMMENIEKV DRGEKIEL VD+TEN   QAQDFR  GT
Sbjct  122  VEHPDEISKISKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDRTENLRSQAQDFRMQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKL VLG I+A ILI+VLSVC GF C
Sbjct  182  SMRRKMWLQNMKIKLFVLGFIVAFILILVLSVCGGFKC  219



>gb|KJB22568.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=220

 Score =   225 bits (573),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQYC
Sbjct  62   GFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISK+AKVKAQVSEVKGVMMENIEKV DRGE+IEL VD+TEN   QAQDFR  GT
Sbjct  122  IDHPEEISKIAKVKAQVSEVKGVMMENIEKVLDRGERIELLVDRTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMK+KLIVLGI++ALILIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKVKLIVLGILVALILIIVLSVCHGFKC  219



>emb|CDY59642.1| BnaAnng16140D [Brassica napus]
Length=178

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            F YCVVA ES GRQ+ MAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL+ HMQYC 
Sbjct  21   FAYCVVAVESAGRQITMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKGHMQYCV  80

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHPEEI+KL+KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GTK
Sbjct  81   DHPEEINKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTK  140

Query  272  IRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            IRRKMW +NMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  141  IRRKMWWENMKIKLIVLGIIIALILIIILSVCHGFKC  177



>emb|CDX79466.1| BnaC03g18020D [Brassica napus]
Length=176

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
            TYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL++ MQYC D
Sbjct  20   TYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAKPNSLNKEFGSKLKEQMQYCVD  79

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HPEEI+KL KVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDFR+ GTKI
Sbjct  80   HPEEINKLVKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFRTQGTKI  139

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RRKMW +NMKIKLIV GIIIALILII+LSVCHGF C
Sbjct  140  RRKMWFENMKIKLIVAGIIIALILIIILSVCHGFKC  175



>ref|XP_004247839.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=221

 Score =   224 bits (572),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPK+++ M+YC
Sbjct  62   GFTYCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             D+PEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDNPEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRK+W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  182  KIRRKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  219



>ref|XP_006410397.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
 gb|ESQ51850.1| hypothetical protein EUTSA_v10017717mg, partial [Eutrema salsugineum]
Length=248

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL++EFG KL++HMQYC
Sbjct  111  GFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQPNSLNREFGSKLKEHMQYC  170

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  171  VDHPEEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  230

Query  275  KIRRKMWLQNM  243
            KIRRKMW +NM
Sbjct  231  KIRRKMWFENM  241



>gb|KHM99990.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=232

 Score =   224 bits (572),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 140/169 (83%), Gaps = 11/169 (7%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+KD+F  KYGGGKAATA ANSL++EFGPKL+  MQYC
Sbjct  62   GFTYCVVAIESAGRQLPIAFLERVKDEFSKKYGGGKAATASANSLNREFGPKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEK-----------VXDRGEKIELXVDKTENXH  309
             DHPEEI+KLAKVKAQVSEVKGVMMENIEK           V DRGEKIE+ VDKT+N  
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKARLIYKMALLRVLDRGEKIEMLVDKTDNLR  181

Query  308  QQAQDFRSTGTKIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             QAQDFR+ GTK++RKMW+QNMK+KLIV GI +ALILI+ +S+C GF+C
Sbjct  182  SQAQDFRTQGTKVKRKMWVQNMKMKLIVFGIAVALILIMFMSICRGFSC  230



>ref|XP_009141263.1| PREDICTED: vesicle-associated membrane protein 725-like [Brassica 
rapa]
Length=220

 Score =   224 bits (571),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+PMAFLER+K+DF  +YGGGKA TA  NSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQIPMAFLERVKEDFSKRYGGGKATTAKPNSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIV GIIIALILII++SVC GF C
Sbjct  182  KIRRKMWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>ref|XP_004253005.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=221

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+YC
Sbjct  62   GFTYCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  GT
Sbjct  122  CDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  182  KIRRKMWYENMKIKLVVFAIILVLILIIILSVCPGFKC  219



>ref|XP_004506588.1| PREDICTED: vesicle-associated membrane protein 721-like [Cicer 
arietinum]
Length=219

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFT+CVVA ES GRQ+P+AFLERIK+DF+ +YGGGKA TA A SL+KEFGPKL++HMQYC
Sbjct  62   GFTFCVVAVESVGRQIPIAFLERIKEDFITRYGGGKATTATAKSLNKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SK AKVKAQVSEVKGVM+ENI+KV DRG K+E  VDKT+N   QAQDFR  GT
Sbjct  122  VDHPEEVSKFAKVKAQVSEVKGVMLENIDKVLDRGVKMEDLVDKTDNLRSQAQDFRHNGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMW QNMKIKLIVL IIIALILIIVLSVCHGF+C
Sbjct  182  QLRRKMWYQNMKIKLIVLAIIIALILIIVLSVCHGFSC  219



>ref|XP_007145403.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
 gb|ESW17397.1| hypothetical protein PHAVU_007G235900g [Phaseolus vulgaris]
Length=221

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K++F  KYG GKAATA A SL++EFGPKL+  MQYC
Sbjct  62   GFTYCVVAVESAGRQLPIAFLERVKEEFSKKYGAGKAATASAKSLNREFGPKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW+QNMKIKLIV GI++AL LI+ +S+C G +C
Sbjct  182  KVKRKMWVQNMKIKLIVFGIVVALFLIMFMSICRGISC  219



>emb|CDY48531.1| BnaC04g43180D [Brassica napus]
Length=220

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+PMAFLERIK+DF  +YGGGKA  A  NSL+KEFG KL++HMQYC
Sbjct  62   GFTYCVVAVEAVGRQIPMAFLERIKEDFSNRYGGGKATNAKPNSLNKEFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMMENIEKV DRGEKIEL VDKTE+    AQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSHAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKLIV GIIIALILII++SVC GF C
Sbjct  182  KIRRKMWWENMKIKLIVAGIIIALILIIIISVCPGFKC  219



>gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlisea aurea]
Length=219

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVV  ES GRQ+P+AFLER+K+DF  +YGGGKAA A  N+L KE+GPKL +HMQYC
Sbjct  62   GFTYCVVVVESAGRQLPIAFLERVKEDFNKRYGGGKAANAGPNALKKEYGPKLMEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEINKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRKQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +++RKMW++NMKIKLIV GI +AL L++ LSVCHGF C
Sbjct  182  RMKRKMWVKNMKIKLIVFGIFVALALVVFLSVCHGFKC  219



>ref|NP_001148792.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACG32929.1| vesicle-associated membrane protein 725 [Zea mays]
Length=222

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL +EFGPKL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLKREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
             +RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  182  NVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>ref|XP_011073775.1| PREDICTED: putative vesicle-associated membrane protein 726 [Sesamum 
indicum]
Length=219

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+PMAFLER+KDDF  KY GGKA+ A +N L KEFGPKL++HM+YC
Sbjct  62   GFTYCVVAIESAGRQIPMAFLERVKDDFNKKYSGGKASAAKSNGLKKEFGPKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEIS+LAKVKAQVSEVKGVM+ENIEKV DRGEKIEL VDKTEN   QAQDFR+ GT
Sbjct  122  TEHPEEISQLAKVKAQVSEVKGVMLENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW +NMKIKL+V  I   LILIIVLS+C  F C
Sbjct  182  KLKRKMWYENMKIKLVVFAIFFVLILIIVLSICPRFKC  219



>ref|XP_002459506.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 ref|XP_008667049.1| PREDICTED: uncharacterized protein LOC100191650 isoform X1 [Zea 
mays]
 gb|ACF84519.1| unknown [Zea mays]
 gb|ACF84742.1| unknown [Zea mays]
 gb|ACG28427.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACN28437.1| unknown [Zea mays]
 gb|EER96027.1| hypothetical protein SORBIDRAFT_02g005730 [Sorghum bicolor]
 tpg|DAA42472.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=222

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  220



>ref|XP_010547077.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Tarenaya hassleriana]
Length=219

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K++F  +YGGGKA TA ANSL+KEF  K+++ MQYC
Sbjct  62   GFTYCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFASKMKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHP+EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  GT
Sbjct  122  VDHPDEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RR MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  182  KLRRNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  219



>ref|XP_004514024.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X1 [Cicer arietinum]
Length=221

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LER+K++F  KYGGGKAATA  +SL+KEFG KL+  MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAYLERVKEEFSKKYGGGKAATATTHSLNKEFGSKLKQQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKT+N   QAQDFR+ GT
Sbjct  122  VDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEMLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K++RKMW++NMKIKLI  GII+A+IL+I +S+C GF+C
Sbjct  182  KMKRKMWIENMKIKLIAFGIILAIILMIFMSLCRGFSC  219



>ref|XP_003622969.1| Vesicle-associated membrane protein [Medicago truncatula]
 gb|AES79187.1| synaptobrevin-like protein [Medicago truncatula]
Length=221

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKA  A A SL+KEFG KL++ MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERIKEDFSKKYAGGKAENAAAKSLNKEFGSKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEEISKL+KV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VEHPEEISKLSKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMW QNMKIKLIVLGIIIALILIIVLS+C GFNC K
Sbjct  182  KLRRKMWFQNMKIKLIVLGIIIALILIIVLSICGGFNCSK  221



>ref|XP_008234811.1| PREDICTED: putative vesicle-associated membrane protein 726 [Prunus 
mume]
Length=221

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LER+KDDF  +Y GGKA TA AN L++EFGPKL+DHM+YC
Sbjct  62   GFTYCVVASESAGRQIPIAYLERVKDDFNKRYAGGKAGTAVANGLNREFGPKLKDHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKT+N   QAQDFR+ GT
Sbjct  122  LDHPEEINKLAKVKAQVTEVKGVMMDNIEKVLDRGEKIELLVDKTDNLRSQAQDFRTQGT  181

Query  275  KIRRKMWLQNM  243
            K++RKMW QNM
Sbjct  182  KMKRKMWFQNM  192



>ref|XP_003532299.1| PREDICTED: vesicle-associated membrane protein 722-like [Glycine 
max]
Length=221

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A SL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  182  KIRRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|NP_001241434.1| uncharacterized protein LOC100804314 [Glycine max]
 gb|ACU24640.1| unknown [Glycine max]
 gb|KHN36363.1| Putative vesicle-associated membrane protein 726 [Glycine soja]
Length=221

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A+SL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAHSLNREFGPKLKEEMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  182  KIRRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>ref|XP_007140571.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|AGV54239.1| vesicle-associated membrane protein [Phaseolus vulgaris]
 gb|ESW12565.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=221

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A SL++EFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            KIRRKMW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  182  KIRRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  221



>gb|KJB33092.1| hypothetical protein B456_006G056000 [Gossypium raimondii]
Length=219

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAA A A SL++EFG KL+ HM+YC
Sbjct  62   GFTYCVVATESAGRQIPIAFLERVKEDFSKRYGGGKAANAKAKSLNREFGSKLKAHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            A+HPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  GT
Sbjct  122  AEHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KI+RKMW++NMK+KLIV GI+  +I++I++SVC   NC
Sbjct  182  KIKRKMWIENMKMKLIVFGIVAVIIIVIIISVCRNLNC  219



>ref|XP_010326818.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X3 [Solanum lycopersicum]
Length=183

 Score =   218 bits (556),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPK+++ M+YC D+
Sbjct  27   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYCVDN  86

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            PEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GTKIR
Sbjct  87   PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  146

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RK+W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  147  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  181



>ref|XP_006349936.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X1 [Solanum tuberosum]
Length=221

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+YC
Sbjct  62   GFTYCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  GT
Sbjct  122  CDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  182  KIRRKMWYENMKIKLVVFSIILVLILIIILSVCPGFKC  219



>ref|NP_001059109.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAD30158.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 emb|CAD70274.1| synaptobrevin 1 [Oryza sativa Japonica Group]
 dbj|BAF21023.1| Os07g0194000 [Oryza sativa Japonica Group]
 dbj|BAG87612.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96866.1| unnamed protein product [Oryza sativa Japonica Group]
Length=220

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_010314763.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Solanum lycopersicum]
Length=183

 Score =   218 bits (554),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+YC DH
Sbjct  27   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  86

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            PEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  GTKIR
Sbjct  87   PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  146

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RKMW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  147  RKMWYENMKIKLVVFAIILVLILIIILSVCPGFKC  181



>ref|XP_010923320.1| PREDICTED: vesicle-associated membrane protein 721-like [Elaeis 
guineensis]
Length=219

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFLERIK+DF  +YGGGKAATA ANSL+++FGPKL++HMQYC
Sbjct  62   GYTYCVVAVESAGRQIPIAFLERIKEDFGKRYGGGKAATAAANSLNRDFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|KDO77463.1| hypothetical protein CISIN_1g027612mg [Citrus sinensis]
Length=203

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 137/160 (86%), Gaps = 18/160 (11%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+ES+GRQ+PMAFLER+KD+FV KYGGGKAATAPAN L+KEFG          
Sbjct  62   GYTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFG----------  111

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
                    KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN HQQAQDFRSTGT
Sbjct  112  --------KLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGT  163

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMKIKLIVLGI+IALILIIVLSVCHGFNCGK
Sbjct  164  KMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNCGK  203



>ref|NP_001051606.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|AAO72389.1| synaptobrevin-like protein [Oryza sativa Japonica Group]
 gb|ABF99408.1| Vesicle-associated membrane protein 724, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13520.1| Os03g0803000 [Oryza sativa Japonica Group]
 gb|EEC76360.1| hypothetical protein OsI_13946 [Oryza sativa Indica Group]
 gb|EEE60123.1| hypothetical protein OsJ_13000 [Oryza sativa Japonica Group]
Length=220

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+R+KDDF  +Y GGKAATA ANSL+++FG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRVKDDFTKRYAGGKAATAAANSLNRDFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQAGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  QVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_002303031.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
 gb|EEE82304.1| hypothetical protein POPTR_0002s24200g [Populus trichocarpa]
Length=219

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+A+LERIK+DF  +YGGGKAA A AN L KEFGPKL++ MQ+C
Sbjct  62   GFTYCVVAVESVGRQIPIAYLERIKEDFTNRYGGGKAAIAVANGLKKEFGPKLKEQMQFC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ FR  G 
Sbjct  122  MDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQVFRQQGG  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +I+RKMW QNMKIKLIVL I+I LILIIVLS+C GF C
Sbjct  182  QIKRKMWWQNMKIKLIVLAILIVLILIIVLSICGGFKC  219



>tpg|DAA59924.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=161

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
            +YCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL +EFGPKL++HMQYC D
Sbjct  3    SYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLKREFGPKLKEHMQYCVD  62

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT +
Sbjct  63   HPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTNV  122

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  123  RRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  159



>gb|KJB22567.1| hypothetical protein B456_004G058500 [Gossypium raimondii]
Length=226

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 144/165 (87%), Gaps = 6/165 (4%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVPMAFLERIK+DF  +YGGGKAA APANSLSKEFGPKL++HMQYC
Sbjct  62   GFTYCVVAIESVGRQVPMAFLERIKEDFTKRYGGGKAAAAPANSLSKEFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEK------VXDRGEKIELXVDKTENXHQQAQD  294
             DHPEEISK+AKVKAQVSEVKGVMMENIEK      V DRGE+IEL VD+TEN   QAQD
Sbjct  122  IDHPEEISKIAKVKAQVSEVKGVMMENIEKLTNFFQVLDRGERIELLVDRTENLRSQAQD  181

Query  293  FRSTGTKIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            FR  GT++RRKMWLQNMK+KLIVLGI++ALILIIVLSVCHGF C 
Sbjct  182  FRQQGTQMRRKMWLQNMKVKLIVLGILVALILIIVLSVCHGFKCS  226



>ref|XP_004981381.1| PREDICTED: vesicle-associated membrane protein 725-like [Setaria 
italica]
Length=220

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFL+R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQVPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006657530.1| PREDICTED: vesicle-associated membrane protein 725-like [Oryza 
brachyantha]
Length=220

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFL+R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQIPIAFLDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEITKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_010326817.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Solanum lycopersicum]
Length=232

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA ES GRQ+P+AFLERIKDDF  KYGGGKA TA   SLSKEFGPK+++ M+YC D+
Sbjct  76   YCVVATESAGRQLPIAFLERIKDDFSKKYGGGKATTATPKSLSKEFGPKMKEQMKYCVDN  135

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            PEEI+KLAKVKAQVSEVKGVMM+NIEKV DRGEKIEL VDKTEN   QAQDFR  GTKIR
Sbjct  136  PEEINKLAKVKAQVSEVKGVMMQNIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKIR  195

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RK+W +NMKIKLIVLGIIIALILII+LSVC GF C
Sbjct  196  RKLWYENMKIKLIVLGIIIALILIIILSVCPGFKC  230



>ref|XP_009388457.1| PREDICTED: vesicle-associated membrane protein 721-like [Musa 
acuminata subsp. malaccensis]
Length=219

 Score =   217 bits (553),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTY VVA ES GRQVP+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYGVVAAESFGRQVPIAFLERVKEDFSKRYGGGKAATAAANSLTREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKV+AQVSEVKGVMMENIEKV DRGEKIEL VDKTEN H QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVQAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>tpg|DAA42468.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=168

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
             YCVVA ES GRQ+P+AFL+R+K+DF  KYGGGKAATA ANSL++EFG KL++HMQYC D
Sbjct  10   AYCVVAVESVGRQIPIAFLDRVKEDFTKKYGGGKAATAAANSLNREFGSKLKEHMQYCVD  69

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GTK+
Sbjct  70   HPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKV  129

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNCG  159
            RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF CG
Sbjct  130  RRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCG  166



>gb|KJB42280.1| hypothetical protein B456_007G153200 [Gossypium raimondii]
Length=217

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQVP+AFLERIK+DF  +YGGGKAA APANSLSKE  PKL++HMQYC
Sbjct  62   GFTYCVVAVESAGRQVPIAFLERIKEDFTKRYGGGKAAAAPANSLSKE--PKLKEHMQYC  119

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SK+AKVKAQVSEVKGVMMENIEKV DRGEKIEL VDK+EN   QAQDFR  GT
Sbjct  120  IDHPEEVSKIAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKSENLRSQAQDFRQQGT  179

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMKIKLIVLGI+IAL+LIIVLSVCHGFNC
Sbjct  180  QMRRKMWLQNMKIKLIVLGILIALVLIIVLSVCHGFNC  217



>ref|XP_009418833.1| PREDICTED: vesicle-associated membrane protein 721 [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFLER+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GYTYCVVAVESVGRQIPIAFLERVKEDFNKRYGGGKAATAAANSLTREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQHGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            ++RRKMWLQNMK+KLIVLGIIIAL+LIIVLSVCHGF C
Sbjct  182  QMRRKMWLQNMKVKLIVLGIIIALVLIIVLSVCHGFKC  219



>ref|XP_010547078.1| PREDICTED: vesicle-associated membrane protein 721-like isoform 
X2 [Tarenaya hassleriana]
Length=227

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
             +YCVVA ES GRQ+P+AFLER+K++F  +YGGGKA TA ANSL+KEF  K+++ MQYC 
Sbjct  71   LSYCVVAVESVGRQLPIAFLERVKEEFTKRYGGGKADTATANSLNKEFASKMKEQMQYCV  130

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHP+EI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIE+ VDKTEN   QAQDFR  GTK
Sbjct  131  DHPDEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQQGTK  190

Query  272  IRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            +RR MWLQNMKIKLIVLGI+IALILIIVLSVC GF C
Sbjct  191  LRRNMWLQNMKIKLIVLGILIALILIIVLSVCGGFKC  227



>ref|XP_007140570.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
 gb|ESW12564.1| hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris]
Length=164

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  629  TYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCAD  450
             YCVVA ES GRQ+P+AFLERIK+DF  KY GGKAATA A SL++EFGPKL++ MQYC D
Sbjct  7    AYCVVAVESAGRQIPIAFLERIKEDFTKKYAGGKAATAAAQSLNREFGPKLKEQMQYCVD  66

Query  449  HPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKI  270
            HPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GTKI
Sbjct  67   HPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKI  126

Query  269  RRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            RRKMW QNMKIKLIVLGIIIALILIIVLSVC GFNCGK
Sbjct  127  RRKMWFQNMKIKLIVLGIIIALILIIVLSVCGGFNCGK  164



>gb|KCW62998.1| hypothetical protein EUGRSUZ_G00599, partial [Eucalyptus grandis]
Length=209

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            FTYCVVA ES GRQ+PMAFLERIKD+F  +YGGGKAATA A+SL +EFGPKL++ M+YCA
Sbjct  49   FTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCA  108

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHPEEISKLAKVKAQ SEVKGVMME +EKV DRGEK+EL +DKTEN   QAQDFR   T+
Sbjct  109  DHPEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFRQQATQ  168

Query  272  IRRKMWLQNM  243
            IRR+MWLQNM
Sbjct  169  IRRRMWLQNM  178



>gb|EMT18448.1| Putative vesicle-associated membrane protein 726 [Aegilops tauschii]
Length=249

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 142/187 (76%), Gaps = 27/187 (14%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES G+Q+P+AFL R+KDDF  +Y GGKAATA  +SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGQQMPIAFLVRVKDDFSKRYAGGKAATAAPSSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEK---------------------------VXD  357
             DHPEEI+KLAKV+AQVSEVK VMMENIEK                           V D
Sbjct  122  VDHPEEINKLAKVQAQVSEVKNVMMENIEKVHLCTLQIHRRYNLEEVSDPYSTSEIQVLD  181

Query  356  RGEKIELXVDKTENXHQQAQDFRSTGTKIRRKMWLQNMkiklivlgiiialiliivLSVC  177
            RGEKIEL VDKTEN   QAQDFR  GT++RRKMWLQNMKIKLIVLGII+ALILII+LSVC
Sbjct  182  RGEKIELLVDKTENLRSQAQDFRQQGTQVRRKMWLQNMKIKLIVLGIIVALILIIILSVC  241

Query  176  HGFNCGK  156
            HGFNCGK
Sbjct  242  HGFNCGK  248



>ref|XP_010068178.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
Length=214

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            FTYCVVA ES GRQ+PMAFLERIKD+F  +YGGGKAATA A+SL +EFGPKL++ M+YCA
Sbjct  54   FTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCA  113

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHPEEISKLAKVKAQ SEVKGVMME +EKV DRGEK+EL +DKTEN   QAQDFR   T+
Sbjct  114  DHPEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFRQQATQ  173

Query  272  IRRKMWLQNM  243
            IRR+MWLQNM
Sbjct  174  IRRRMWLQNM  183



>ref|XP_003557429.1| PREDICTED: vesicle-associated membrane protein 721 [Brachypodium 
distachyon]
Length=221

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ P+AFL+R+KDDF  +YGGGKAATA A+SL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGRQTPIAFLDRVKDDFTKRYGGGKAATAGASSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             D+PEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDNPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNCGK  156
            K+RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C K
Sbjct  182  KVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKCNK  221



>ref|XP_011091409.1| PREDICTED: vesicle-associated membrane protein 722-like [Sesamum 
indicum]
Length=220

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+AFLERIKD+F  KY GGK AT  ANSL KEFGPKLR+ MQYC
Sbjct  62   GFTYCVVATESAGRQLPIAFLERIKDEFNKKYSGGKKATGGANSLKKEFGPKLREQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            +D+PEEI+KLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTE+   QAQDF++ GT
Sbjct  122  SDNPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTEDLRSQAQDFKAKGT  181

Query  275  KIRRKMWLQNM  243
            ++R+K+W+QNM
Sbjct  182  QVRKKLWIQNM  192



>ref|XP_010934067.1| PREDICTED: putative vesicle-associated membrane protein 726 [Elaeis 
guineensis]
Length=219

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFLERIK+DF  ++GGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GYTYCVVAVESAGRQIPIAFLERIKEDFNKRFGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RRKMW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRKMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_006349937.1| PREDICTED: vesicle-associated membrane protein 725-like isoform 
X2 [Solanum tuberosum]
Length=183

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  626  YCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCADH  447
            YCVVA ES GR++P+AFL+R+K+DF  KY GGKAATA A SL++EFG KL++HM+YC DH
Sbjct  27   YCVVATESAGREIPLAFLDRVKNDFSKKYAGGKAATASAKSLNREFGSKLKEHMKYCCDH  86

Query  446  PEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTKIR  267
            PEEISKL+KVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N   QAQDFR  GTKIR
Sbjct  87   PEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLRSQAQDFRQQGTKIR  146

Query  266  RKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            RKMW +NMKIKL+V  II+ LILII+LSVC GF C
Sbjct  147  RKMWYENMKIKLVVFSIILVLILIIILSVCPGFKC  181



>ref|XP_010065488.1| PREDICTED: vesicle-associated membrane protein 722-like [Eucalyptus 
grandis]
 gb|KCW62996.1| hypothetical protein EUGRSUZ_G00596 [Eucalyptus grandis]
Length=222

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -3

Query  632  FTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYCA  453
            FTYCVVA ES GRQ+PMAFLERIKD+F  +YGGGKAATA A+SL +EFGPKL++ M+YCA
Sbjct  62   FTYCVVAVESIGRQIPMAFLERIKDEFTNRYGGGKAATAVAHSLDREFGPKLKEQMRYCA  121

Query  452  DHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGTK  273
            DHPEEISKLAKVKAQ SEVKGVMME +EKV DRGEK+EL +DKTEN   QAQDF+    +
Sbjct  122  DHPEEISKLAKVKAQASEVKGVMMEYVEKVLDRGEKVELLLDKTENLRSQAQDFQQQAIR  181

Query  272  IRRKMWLQNMkiklivlgiiialiliivLS-VCHGFNCG  159
            IRR+MWLQNMKIK IVLGI++ALI+IIVLS +C  F CG
Sbjct  182  IRRRMWLQNMKIKPIVLGIVVALIVIIVLSTICGAFRCG  220



>ref|NP_001149329.1| vesicle-associated membrane protein 725 [Zea mays]
 gb|ACF83939.1| unknown [Zea mays]
 gb|ACG35049.1| vesicle-associated membrane protein 725 [Zea mays]
 tpg|DAA51998.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=220

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES G+Q+P+AF++R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGQQIPIAFMDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  NVRRKMWLQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>ref|XP_008808719.1| PREDICTED: vesicle-associated membrane protein 721-like [Phoenix 
dactylifera]
Length=219

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA ES GRQ+P+AFLERIK+DF  +YGGGKAATA AN L++EFGPKL++HMQYC
Sbjct  62   GYTYCVVAGESAGRQIPIAFLERIKEDFNKRYGGGKAATAAANGLNREFGPKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEEISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQDFR  GT
Sbjct  122  VDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            K+RR+MW QNMKIKLIVLGIIIALILII+LSVCHGF C
Sbjct  182  KMRRRMWFQNMKIKLIVLGIIIALILIIILSVCHGFKC  219



>gb|AFK47779.1| unknown [Medicago truncatula]
Length=219

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            G+TYCVVA+E+TGRQVPMAFLER+KDDFV KYGG KA+TAP NSL+KEFGPKL++HMQYC
Sbjct  66   GYTYCVVADETTGRQVPMAFLERVKDDFVSKYGGEKASTAPPNSLNKEFGPKLKEHMQYC  125

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFR  288
             DHP+EISKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKT+N H QAQDFR
Sbjct  126  VDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTDNLHHQAQDFR  181



>ref|XP_008651398.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X2 [Zea mays]
Length=220

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+ F+ER+KDDF  KY GGKA TA AN L +E+GPKL++HM+YC
Sbjct  63   GFTYCVVATESAGRQLPVGFIERVKDDFSKKYSGGKAKTANANGLKREYGPKLKEHMKYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HPEEI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  GT
Sbjct  123  DQHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRAQAQDFRQQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMK+KLIV GI++ALIL+IVL+VC  F+C
Sbjct  183  KIRRKMWWENMKMKLIVFGIVVALILLIVLTVCKDFDC  220



>ref|XP_008651397.1| PREDICTED: putative vesicle-associated membrane protein 726 isoform 
X1 [Zea mays]
 tpg|DAA43558.1| TPA: putative vesicle-associated membrane protein family protein 
[Zea mays]
Length=221

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+ F+ER+KDDF  KY GGKA TA AN L +E+GPKL++HM+YC
Sbjct  63   GFTYCVVATESAGRQLPVGFIERVKDDFSKKYSGGKAKTANANGLKREYGPKLKEHMKYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HPEEI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  GT
Sbjct  123  DQHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRAQAQDFRQQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMK+KLIV GI++ALIL+IVL+VC  F+C
Sbjct  183  KIRRKMWWENMKMKLIVFGIVVALILLIVLTVCKDFDC  220



>ref|XP_006649451.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
[Oryza brachyantha]
Length=223

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ESTGRQ+P+ F+ER+K+DF  KY GGKA +A ANSL +E+G KL++HM+YC
Sbjct  65   GFTYCVVATESTGRQLPVGFIERVKEDFSKKYSGGKARSATANSLKREYGSKLKEHMRYC  124

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HPEEI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  GT
Sbjct  125  DQHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGT  184

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMK+KLIV GI++ALIL+IVL++C  FNC
Sbjct  185  KIRRKMWWENMKMKLIVFGIVVALILLIVLTICRDFNC  222



>gb|AFK40729.1| unknown [Lotus japonicus]
Length=219

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES G+Q+PMAFLERIK+DF  KY GG+A+TA A SL+KEFGPKL++ MQYC
Sbjct  62   GFTYCVVAVESFGQQIPMAFLERIKEDFTKKYAGGRASTAAAKSLNKEFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             +HPEE++KLAKVKAQVSEVK VMMENIEKV DRG KI++  +KTEN   QAQDFR  GT
Sbjct  122  VEHPEEVNKLAKVKAQVSEVKEVMMENIEKVLDRGVKIDVLEEKTENLRSQAQDFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFN  165
            ++RRKMW QNMKIKLI+L IIIALILIIVLSVC+GFN
Sbjct  182  QLRRKMWYQNMKIKLIILAIIIALILIIVLSVCNGFN  218



>ref|XP_010065491.1| PREDICTED: vesicle-associated membrane protein 722-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62992.1| hypothetical protein EUGRSUZ_G00592 [Eucalyptus grandis]
Length=223

 Score =   212 bits (540),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GF YCVVA ES GRQ+P+AFLERIKD+F  +YGGGKAATA A+SL++EFGPKL++ MQYC
Sbjct  62   GFAYCVVAVESIGRQIPLAFLERIKDEFTNRYGGGKAATAVAHSLNREFGPKLKEQMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
            ADHPEEISKLAK+ AQ+SEVKGVMME IEKV DRG+++EL +DKTEN   QAQDFR   T
Sbjct  122  ADHPEEISKLAKLTAQISEVKGVMMEYIEKVLDRGQEVELLLDKTENLRSQAQDFRQQAT  181

Query  275  KIRRKMWLQNMkiklivl-giiialiliivLSVCHGFNCG  159
            ++RRKMWLQN+KIK IVL  ++  +++I++  +C GF CG
Sbjct  182  RMRRKMWLQNIKIKRIVLGIVVALILIIVLSIICGGFRCG  221



>ref|NP_001049070.1| Os03g0165800 [Oryza sativa Japonica Group]
 gb|ABF94152.1| Vesicle-associated membrane protein 724, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10984.1| Os03g0165800 [Oryza sativa Japonica Group]
 gb|EAY88679.1| hypothetical protein OsI_10154 [Oryza sativa Indica Group]
 dbj|BAG91292.1| unnamed protein product [Oryza sativa Japonica Group]
Length=223

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES GRQ+P+ F+ER+K+DF  KY GGKA  A ANSL +E+GPKL++HM+YC
Sbjct  65   GFTYCVVATESAGRQLPVGFIERVKEDFSKKYSGGKAKNATANSLKREYGPKLKEHMKYC  124

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HPEEI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  GT
Sbjct  125  DAHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRKAGT  184

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMK+KLIV GI++ALIL+I+L+VC   NC
Sbjct  185  KIRRKMWWENMKMKLIVFGIVVALILVIILTVCRDLNC  222



>ref|XP_002466264.1| hypothetical protein SORBIDRAFT_01g004700 [Sorghum bicolor]
 gb|EER93262.1| hypothetical protein SORBIDRAFT_01g004700 [Sorghum bicolor]
Length=220

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA ES G+Q+P+AF++R+K+DF  +YGGGKAATA ANSL++EFG KL++HMQYC
Sbjct  62   GFTYCVVAVESVGQQIPIAFMDRVKEDFTKRYGGGKAATAAANSLNREFGSKLKEHMQYC  121

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
             DHPEE+SKLAKVKAQVSEVKGVMMENIEKV DRGEKIEL VDKTEN   QAQ+FR  GT
Sbjct  122  VDHPEEVSKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQNFRQQGT  181

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
             +RRKMWLQNMKIKLI LGIIIALILII+LSVCHGF C
Sbjct  182  NVRRKMWLQNMKIKLIGLGIIIALILIIILSVCHGFKC  219



>ref|XP_004985586.1| PREDICTED: putative vesicle-associated membrane protein 726-like 
isoform X2 [Setaria italica]
Length=220

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  635  GFTYCVVAEESTGRQVPMAFLERIKDDFVXKYGGGKAATAPANSLSKEFGPKLRDHMQYC  456
            GFTYCVVA E+ GRQ+P+ F+ER+K+DF  KY GGKA +A AN L +E+GPKL++HM+YC
Sbjct  63   GFTYCVVATEAAGRQLPIGFIERVKEDFSKKYSGGKARSATANGLKREYGPKLKEHMRYC  122

Query  455  ADHPEEISKLAKVKAQVSEVKGVMMENIEKVXDRGEKIELXVDKTENXHQQAQDFRSTGT  276
              HPEEI KLAKVKAQV+EVKGVMM+NIEKV DRGEKIEL VDKTE+   QAQDFR  GT
Sbjct  123  DQHPEEIDKLAKVKAQVTEVKGVMMQNIEKVLDRGEKIELLVDKTEDLRSQAQDFRQQGT  182

Query  275  KIRRKMWLQNMkiklivlgiiialiliivLSVCHGFNC  162
            KIRRKMW +NMK+KLIV GI++ALIL+IVL+VC  FNC
Sbjct  183  KIRRKMWWENMKMKLIVFGIVVALILLIVLTVCKDFNC  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125